HHsearch alignment for GI: 254780520 and conserved domain: PRK06792

>PRK06792 flgD flagellar basal body rod modification protein; Validated.
Probab=99.98  E-value=1.3e-31  Score=202.18  Aligned_cols=114  Identities=27%  Similarity=0.482  Sum_probs=104.7

Q ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHCCCEEECC-
Q ss_conf             77333388999999999832998999889789999999999999999999999999---99999764553226146638-
Q gi|254780520|r   18 KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQASSYIGKNITNA-   93 (131)
Q Consensus        18 ~~~~~l~~d~FLkLL~aQL~nQDP~~P~d~~e~isQlAqfs~leq~~~~~~~l~~~---~~~~~~~~a~sliGk~V~~~-   93 (131)
T Consensus        46 ktpGvLgKDdFLKLLltQLqnQDPlnPMD~~qmmaQmAQfSsLEQmqNMtkaVdkL~~t~~~taldggmkflgkyv~g~~  125 (190)
T PRK06792         46 KTPGVMGKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQSTMYSTALDGGMKFLGKYVRGVS  125 (190)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             68873678899999999960179999657899999999998999999999999999999988776405888877750667


Q ss_pred             --CCEEEEEEEEEEECCCCEEEEEECCEEEECCCCEEEEC
Q ss_conf             --97189999788862796699997897896231058609
Q gi|254780520|r   94 --DGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN  131 (131)
Q Consensus        94 --~~~~~G~v~~V~~~~~g~~~~~v~~~~v~~~~v~~V~d  131 (131)
T Consensus       126 ~~g~~v~g~v~~vrla~nn~vqlvv~~kvv~~r~v~~vsd  165 (190)
T PRK06792        126 NDGKQVTGQVETVRLAENNDVQLVVDNKVVSLRFVERVSD  165 (190)
T ss_pred             CCCCEEEEEEEEEEECCCCCEEEEECCEEEEEEEEHHCCC
T ss_conf             9887776556678731478158997686887630023266