HHsearch alignment for GI: 254780520 and conserved domain: PRK09618

>PRK09618 flgD flagellar basal body rod modification protein; Provisional.
Probab=100.00  E-value=1.5e-35  Score=224.85  Aligned_cols=118  Identities=34%  Similarity=0.541  Sum_probs=104.7

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHCCCEE
Q ss_conf             55667733338899999999983299899988978999999999999999999999999999---999764553226146
Q gi|254780520|r   14 FSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK---SNNLAQASSYIGKNI   90 (131)
Q Consensus        14 ~~~~~~~~~l~~d~FLkLL~aQL~nQDP~~P~d~~e~isQlAqfs~leq~~~~~~~l~~~~~---~~~~~~a~sliGk~V   90 (131)
T Consensus        19 ~~~~~~~~~L~kd~FLkLL~aQLqnQDP~~PmD~~efiaQmAqfS~lEq~~~mn~~l~~l~~~~~~~~~~~a~slIGk~V   98 (146)
T PRK09618         19 AQRRSNKSNLGKDDFLKLLITQLQNQDPTNPMEDKEFIAQMAQFSSLEQMTNMNKSMQQFVKLQSSFTLLKYLEWIGKEV   98 (146)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEE
T ss_conf             34567633369899999999997248989998778999999999999999999999999999887899999985559878


Q ss_pred             ECCC--C-EEEEEEEEEEECCCCEEEEEE-CCEEEECCCCEEEEC
Q ss_conf             6389--7-189999788862796699997-897896231058609
Q gi|254780520|r   91 TNAD--G-SISGVVNAIQVSSTGLTAITV-DNTEIPITTGIRISN  131 (131)
Q Consensus        91 ~~~~--~-~~~G~v~~V~~~~~g~~~~~v-~~~~v~~~~v~~V~d  131 (131)
T Consensus        99 ~~~~~dg~~~sG~V~sv~~~~~g~v~~~ldnG~~i~~~~V~~V~~  143 (146)
T PRK09618         99 EWEHGDGEIVKGTVTSVKTGINGQVMVELDDGKWYVASNVTSVGL  143 (146)
T ss_pred             EEECCCCCEEEEEEEEEEECCCCEEEEEECCCCEECHHHCEEECC
T ss_conf             997389988877899999865984999976994985798747334