Query         gi|254780520|ref|YP_003064933.1| flagellar basal body rod modification protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 131
No_of_seqs    110 out of 613
Neff          5.5 
Searched_HMMs 23785
Date          Tue May 31 22:02:18 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780520.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3c12_A FLGD, flagellar protein  95.6   0.023 9.5E-07   32.3   5.8   32   98-130   106-138 (138)
  2 1pm3_A MTH1895; unknown functi  77.9     3.3 0.00014   19.8   6.5   50   82-131    24-88  (97)
  3 3htr_A Uncharacterized PRC-bar  53.0      11 0.00045   16.8   4.6   40   78-117    13-54  (120)
  4 2e70_A Transcription elongatio  24.7      24   0.001   14.8   1.4   36   83-118    17-52  (71)
  5 3n22_A Protein S100-A2; EF-han  23.6      33  0.0014   14.0   2.3   30   15-44     22-53  (98)
  6 2joj_A Centrin protein; N-term  23.3      32  0.0014   14.1   1.9   22   19-40     56-77  (77)
  7 2pi2_E Replication protein A 1  20.2      39  0.0017   13.6   2.7   19   82-105    38-56  (142)
  8 1k8u_A S100A6, calcyclin, CACY  20.0      40  0.0017   13.5   2.4   30   15-44     21-50  (90)
  9 3czt_X Protein S100-B; EF-hand  16.0      50  0.0021   13.0   3.2   30   15-44     20-51  (92)
 10 1j55_A S-100P protein; metal b  13.6      58  0.0024   12.6   3.7   30   15-44     20-51  (95)

No 1  
>3c12_A FLGD, flagellar protein; HOOK capping, IG-like domain, FN-III domain, tudor-like domain, flagellar biogenesis, flagellum; 2.51A {Xanthomonas campestris PV}
Probab=95.59  E-value=0.023  Score=32.25  Aligned_cols=32  Identities=19%  Similarity=0.397  Sum_probs=18.6

Q ss_pred             EEEEEEEEECCCCEEEEEE-CCEEEECCCCEEEE
Q ss_conf             9999788862796699997-89789623105860
Q gi|254780520|r   98 SGVVNAIQVSSTGLTAITV-DNTEIPITTGIRIS  130 (131)
Q Consensus        98 ~G~v~~V~~~~~g~~~~~v-~~~~v~~~~v~~V~  130 (131)
                      .|.|++|++..++ +.+.+ ++..+++..|.+|+
T Consensus       106 ~~~V~~V~~~~~~-~~L~l~g~~~v~~~~V~~Is  138 (138)
T 3c12_A          106 DAPVDSVTIGSDG-LYLNLTGLGTSPLANVLRVS  138 (138)
T ss_dssp             EEEEEEEEEETTE-EEEEETTTEEEETTSCCBCC
T ss_pred             EEEEEEEEECCCC-EEEEECCCCEEEHHHEEECC
T ss_conf             9999999976990-79998799599489909909


No 2  
>1pm3_A MTH1895; unknown function, structural genomics, PSI, protein structure initiative; 3.15A {Methanothermobacterthermautotrophicus} SCOP: b.41.1.2
Probab=77.89  E-value=3.3  Score=19.78  Aligned_cols=50  Identities=16%  Similarity=0.389  Sum_probs=36.3

Q ss_pred             HHHHCCCEEECCCCEEEEEEEEEEEC-CCCE-EEEEECC-------------EEEECCCCEEEEC
Q ss_conf             55322614663897189999788862-7966-9999789-------------7896231058609
Q gi|254780520|r   82 ASSYIGKNITNADGSISGVVNAIQVS-STGL-TAITVDN-------------TEIPITTGIRISN  131 (131)
Q Consensus        82 a~sliGk~V~~~~~~~~G~v~~V~~~-~~g~-~~~~v~~-------------~~v~~~~v~~V~d  131 (131)
                      +..|+||.|...+|..-|.|.-+.+. +.|. ..+.+..             ..+|.+.|..|+|
T Consensus        24 ~~eL~Gk~Vit~~G~~LG~V~Dv~iD~~tG~I~~LiV~~~~~~~~~~~~~~~v~IP~~~V~~IGD   88 (97)
T 1pm3_A           24 VEEMVGKEVLDSSAKVIGKVKDVEVDIESQAIESLVLGKGGISEGLGLSKGETIVPYEMVKKIGD   88 (97)
T ss_dssp             TTTSSSCEEECTTSCEEEEEEEEEEETTTTEEEEEEEECCC---------CEEEEEGGGEEEESS
T ss_pred             HHHHCCCEEECCCCCEEEEEEEEEEECCCCEEEEEEEECCCCCCCCCCCCCEEEEEHHHEEEECC
T ss_conf             78859997799999898589889996899999999992798211213588369971699499899


No 3  
>3htr_A Uncharacterized PRC-barrel domain protein; beta-barrel, photo-reaction-center domain, structural genomics, PSI-2; HET: MSE; 2.06A {Rhodopseudomonas palustris}
Probab=52.97  E-value=11  Score=16.81  Aligned_cols=40  Identities=15%  Similarity=0.303  Sum_probs=29.0

Q ss_pred             HHHHHHHHCCCEEECCCCEEEEEEEEEEEC-CCCEE-EEEEC
Q ss_conf             976455322614663897189999788862-79669-99978
Q gi|254780520|r   78 NLAQASSYIGKNITNADGSISGVVNAIQVS-STGLT-AITVD  117 (131)
Q Consensus        78 ~~~~a~sliGk~V~~~~~~~~G~v~~V~~~-~~g~~-~~~v~  117 (131)
                      .+..+..|+|+.|...+|..-|.|..+-+. .+|.+ .++++
T Consensus        13 ~li~a~~l~G~~V~~~dG~~iG~V~dv~id~~~g~i~~~vV~   54 (120)
T 3htr_A           13 KLIGSDKVQGTAVYGPDGEKIGSIERVMIEKVSGRVSYAVLS   54 (120)
T ss_dssp             SEEEHHHHTTCEEECTTSCEEEEEEEEEEETTTCBEEEEEEE
T ss_pred             CCEECCCCCCCEEECCCCCEEEEEEEEEEECCCCCEEEEEEE
T ss_conf             122101034987897998988888899998899958899996


No 4  
>2e70_A Transcription elongation factor SPT5; KOW motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=24.69  E-value=24  Score=14.83  Aligned_cols=36  Identities=11%  Similarity=0.378  Sum_probs=21.4

Q ss_pred             HHHCCCEEECCCCEEEEEEEEEEECCCCEEEEEECC
Q ss_conf             532261466389718999978886279669999789
Q gi|254780520|r   83 SSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDN  118 (131)
Q Consensus        83 ~sliGk~V~~~~~~~~G~v~~V~~~~~g~~~~~v~~  118 (131)
                      -.||||+|...-|...|..-.|.-..+..+.+....
T Consensus        17 d~liGktV~I~~GpyKG~~G~Vkd~t~~~~rVELhs   52 (71)
T 2e70_A           17 NELIGQTVRISQGPYKGYIGVVKDATESTARVELHS   52 (71)
T ss_dssp             TSSTTSEEEECSSTTTTCEEEEEEECSSCEEEEESS
T ss_pred             CCCCCCEEEEEECCCCCEEEEEEECCCCEEEEEEEC
T ss_conf             333588889966376886899996528879999815


No 5  
>3n22_A Protein S100-A2; EF-hand, calcium-binding, zinc-binding, tumor supressor, CAL binding protein; 1.30A {Homo sapiens} PDB: 2rgi_A
Probab=23.63  E-value=33  Score=13.97  Aligned_cols=30  Identities=17%  Similarity=0.256  Sum_probs=22.4

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHCC--CCCCCC
Q ss_conf             566773333889999999998329--989998
Q gi|254780520|r   15 SKSKSKKTLGQDAFLKLLITQIKH--QDPTEP   44 (131)
Q Consensus        15 ~~~~~~~~l~~d~FLkLL~aQL~n--QDP~~P   44 (131)
                      .......+|.+.+|-.||-.|+.+  +.|.+|
T Consensus        22 ~~~g~~~tLsk~Elk~Ll~~El~~~l~~~~d~   53 (98)
T 3n22_A           22 SQEGDKFKLSKGEMKELLHKELPSFVGEKVDE   53 (98)
T ss_dssp             TTSSSTTSBCHHHHHHHHHHHCHHHHCSSCCH
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCH
T ss_conf             62798353189999999998728874699987


No 6  
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus}
Probab=23.29  E-value=32  Score=14.06  Aligned_cols=22  Identities=32%  Similarity=0.635  Sum_probs=14.1

Q ss_pred             CCCCCCHHHHHHHHHHHHCCCC
Q ss_conf             7333388999999999832998
Q gi|254780520|r   19 SKKTLGQDAFLKLLITQIKHQD   40 (131)
Q Consensus        19 ~~~~l~~d~FLkLL~aQL~nQD   40 (131)
                      ++..++.++|++++...++..|
T Consensus        56 ~~g~i~f~eF~~~m~~~~~~~D   77 (77)
T 2joj_A           56 GNGYIGFDDFLDIMTEKIKNRD   77 (77)
T ss_dssp             SSSEEEHHHHHHHHTHHHHTCC
T ss_pred             CCCCCCHHHHHHHHHHHHHCCC
T ss_conf             8791919999999999970799


No 7  
>2pi2_E Replication protein A 14 kDa subunit; FULL-length RPA14/32, ssDNA binding protein, OB-fold, dioxane, DNA binding protein; 2.00A {Homo sapiens} SCOP: b.40.4.3 PDB: 2pqa_B 2z6k_C
Probab=20.24  E-value=39  Score=13.57  Aligned_cols=19  Identities=21%  Similarity=0.410  Sum_probs=11.3

Q ss_pred             HHHHCCCEEECCCCEEEEEEEEEE
Q ss_conf             553226146638971899997888
Q gi|254780520|r   82 ASSYIGKNITNADGSISGVVNAIQ  105 (131)
Q Consensus        82 a~sliGk~V~~~~~~~~G~v~~V~  105 (131)
                      -..++||.|...     |+|..+.
T Consensus        38 L~qfvGk~VriV-----GkV~~v~   56 (142)
T 2pi2_E           38 LAQFIDKPVCFV-----GRLEKIH   56 (142)
T ss_dssp             GGGSTTCEEEEE-----EEEEEEC
T ss_pred             HHHCCCCEEEEE-----EEEEEEC
T ss_conf             966089769999-----9998876


No 8  
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, APO, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A
Probab=20.04  E-value=40  Score=13.54  Aligned_cols=30  Identities=13%  Similarity=0.252  Sum_probs=21.1

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHCCCCCCCC
Q ss_conf             566773333889999999998329989998
Q gi|254780520|r   15 SKSKSKKTLGQDAFLKLLITQIKHQDPTEP   44 (131)
Q Consensus        15 ~~~~~~~~l~~d~FLkLL~aQL~nQDP~~P   44 (131)
                      .+.....+|.+.+|-+||-.|+.+-.+.+|
T Consensus        21 ~~~G~~~tLsk~Elk~Ll~~El~~~~~~d~   50 (90)
T 1k8u_A           21 GREGDKHTLSKKELKELIQKELTIGSKLQD   50 (90)
T ss_dssp             TSSSCTTEEEHHHHHHHHHHHSCCGGGTTS
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCCCCH
T ss_conf             637984628899999999998543467987


No 9  
>3czt_X Protein S100-B; EF-hand,calcium, zinc, copper, cytoplasm, metal- binding, nucleus, metal binding protein; 1.40A {Homo sapiens} PDB: 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 1mq1_A 1uwo_A 2pru_A 1b4c_A 1dt7_A 1mwn_A 1qlk_A 1sym_A 1xyd_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* ...
Probab=15.96  E-value=50  Score=12.98  Aligned_cols=30  Identities=17%  Similarity=0.368  Sum_probs=21.6

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHCC--CCCCCC
Q ss_conf             566773333889999999998329--989998
Q gi|254780520|r   15 SKSKSKKTLGQDAFLKLLITQIKH--QDPTEP   44 (131)
Q Consensus        15 ~~~~~~~~l~~d~FLkLL~aQL~n--QDP~~P   44 (131)
                      .+.....+|.+.+|-+||-.||.+  ++|.+|
T Consensus        20 ~~~g~~~tLsk~Elk~Ll~~El~~~~~~~~d~   51 (92)
T 3czt_X           20 GREGDKHKLKKSELKELINNELSHFLEEIKEQ   51 (92)
T ss_dssp             TTSSSTTSBCHHHHHHHHHHHSTTTSCCCCCH
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCH
T ss_conf             53798465779999999999889986478989


No 10 
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A
Probab=13.62  E-value=58  Score=12.61  Aligned_cols=30  Identities=17%  Similarity=0.214  Sum_probs=21.7

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHCC--CCCCCC
Q ss_conf             566773333889999999998329--989998
Q gi|254780520|r   15 SKSKSKKTLGQDAFLKLLITQIKH--QDPTEP   44 (131)
Q Consensus        15 ~~~~~~~~l~~d~FLkLL~aQL~n--QDP~~P   44 (131)
                      .......+|.+.+|-+||-.|+.+  +.|-+|
T Consensus        20 ~~~g~~~tLsk~Elk~Ll~~El~~~l~~~~d~   51 (95)
T 1j55_A           20 GSEGSTQTLTKGELKVLMEKELPGFLQSGKDK   51 (95)
T ss_dssp             TSSSCTTEECHHHHHHHHHHHSTTCC------
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCH
T ss_conf             62798355789999999999889986688988


Done!