BLAST/PSIBLAST alignment of GI: 254780520 and GI: 116250505 at iteration 1
>gi|116250505|ref|YP_766343.1| flagellar basal body rod modification protein [Rhizobium leguminosarum bv. viciae 3841] Length = 142
>gi|115255153|emb|CAK06227.1| putative hook formation protein [Rhizobium leguminosarum bv. viciae 3841] Length = 142
 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 85/115 (73%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           ++SK TL  D FL+LLI Q+K+QDPT+P+ ASEQ++QLA FSQ+EQ++Q N+ L  LL S
Sbjct: 21  AQSKATLNYDNFLQLLIAQMKNQDPTDPVDASEQMSQLASFSQVEQTIQTNTKLDTLLAS 80

Query: 77  NNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           ++L QASSY+GK + +ADG++ G + +++V S G+ A T D   I +  GI I++
Sbjct: 81  SSLTQASSYVGKYMESADGTVKGTIESVKVYSDGIIATTTDGGNILVQAGITIAD 135