BLAST/PSIBLAST alignment of GI: 254780520 and GI: 218506521 at iteration 1
>gi|218506521|ref|ZP_03504399.1| flagellar basal body rod modification protein [Rhizobium etli Brasil 5] Length = 118
 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 58/110 (52%), Positives = 84/110 (76%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
           TL  D FL+LLI Q+K+QDPT+PM ASEQVAQLA FSQ+EQ++Q N+ L  LL S++L Q
Sbjct: 2   TLNYDNFLQLLIAQMKNQDPTDPMDASEQVAQLATFSQVEQTIQTNTKLDTLLASSSLTQ 61

Query: 82  ASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           ASSY+GK + +ADG++ GV+++++V S G+ A T D  +I +  GI +++
Sbjct: 62  ASSYVGKYMESADGTVKGVIDSVKVYSDGIIATTTDGGKILVQAGITVAD 111