BLAST/PSIBLAST alignment of GI: 254780520 and GI: 86356335 at iteration 1
>gi|86356335|ref|YP_468227.1| flagellar basal body rod modification protein [Rhizobium etli CFN 42] Length = 142
>gi|86280437|gb|ABC89500.1| flagellar basal-body rod protein [Rhizobium etli CFN 42] Length = 142
 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 88/115 (76%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           ++SK TL  D FL+LLI Q+K+QDPT+PM ASEQVAQLA FSQ+EQ++Q N+ L  LL S
Sbjct: 21  AQSKATLNYDNFLQLLIAQMKNQDPTDPMDASEQVAQLATFSQVEQTIQTNTKLDTLLAS 80

Query: 77  NNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           ++L QASSY+GK + +ADG++ GV+++++V S G+ A T D  +I +  GI +++
Sbjct: 81  SSLTQASSYVGKYMESADGTVKGVIDSVKVYSDGIIATTTDGDKILVQAGITVAD 135