BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780520|ref|YP_003064933.1| flagellar basal body rod
modification protein [Candidatus Liberibacter asiaticus str. psy62]
         (131 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780520|ref|YP_003064933.1| flagellar basal body rod modification protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040197|gb|ACT56993.1| flagellar basal body rod modification protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 131

 Score =  261 bits (667), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 131/131 (100%), Positives = 131/131 (100%)

Query: 1   MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
           MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM
Sbjct: 1   MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60

Query: 61  EQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE 120
           EQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE
Sbjct: 61  EQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE 120

Query: 121 IPITTGIRISN 131
           IPITTGIRISN
Sbjct: 121 IPITTGIRISN 131


>gi|315122289|ref|YP_004062778.1| flagellar basal body rod modification protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495691|gb|ADR52290.1| flagellar basal body rod modification protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 125

 Score =  191 bits (486), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/124 (75%), Positives = 105/124 (84%)

Query: 7   VNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQM 66
           +N TQ+E   SK    +G DAF KLLI Q+KHQDPTEPMKASEQVAQLAVFSQMEQSVQM
Sbjct: 1   MNSTQKESLPSKPNTMMGHDAFFKLLIAQMKHQDPTEPMKASEQVAQLAVFSQMEQSVQM 60

Query: 67  NSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTG 126
           N+ L+ELL SNNLAQASSYIGKNI N DGS+SG+V A+QVSSTGLTAIT +N EIPI TG
Sbjct: 61  NTNLKELLNSNNLAQASSYIGKNIENVDGSMSGIVKAVQVSSTGLTAITAENQEIPIKTG 120

Query: 127 IRIS 130
           IR+S
Sbjct: 121 IRVS 124


>gi|227820880|ref|YP_002824850.1| flagellar basal body rod modification protein [Sinorhizobium fredii
           NGR234]
 gi|227339879|gb|ACP24097.1| predicted flagellar hook capping protein FlgD [Sinorhizobium fredii
           NGR234]
          Length = 148

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 84/108 (77%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           L   +FLKLLI Q+++QDPT+PM A+EQ++QLA FSQ+EQS++ NS L+ LL S +L QA
Sbjct: 33  LNYQSFLKLLIAQMQNQDPTDPMDATEQISQLATFSQVEQSIKTNSNLESLLASESLTQA 92

Query: 83  SSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           S+YIGK IT++DG  SGVV  ++V+S G+TAIT D  EI I TGI +S
Sbjct: 93  STYIGKTITSSDGKTSGVVAEVEVTSDGVTAITTDGKEIAIETGISVS 140


>gi|86356335|ref|YP_468227.1| flagellar basal body rod modification protein [Rhizobium etli CFN
           42]
 gi|86280437|gb|ABC89500.1| flagellar basal-body rod protein [Rhizobium etli CFN 42]
          Length = 142

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 88/115 (76%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           ++SK TL  D FL+LLI Q+K+QDPT+PM ASEQVAQLA FSQ+EQ++Q N+ L  LL S
Sbjct: 21  AQSKATLNYDNFLQLLIAQMKNQDPTDPMDASEQVAQLATFSQVEQTIQTNTKLDTLLAS 80

Query: 77  NNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           ++L QASSY+GK + +ADG++ GV+++++V S G+ A T D  +I +  GI +++
Sbjct: 81  SSLTQASSYVGKYMESADGTVKGVIDSVKVYSDGIIATTTDGDKILVQAGITVAD 135


>gi|190890387|ref|YP_001976929.1| flagellar basal-body rod protein [Rhizobium etli CIAT 652]
 gi|190695666|gb|ACE89751.1| flagellar basal-body rod protein [Rhizobium etli CIAT 652]
 gi|327193064|gb|EGE59976.1| flagellar basal-body rod protein [Rhizobium etli CNPAF512]
          Length = 141

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/112 (52%), Positives = 85/112 (75%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K TL  D FL+LLI Q+K+QDPT+PM ASEQVAQLA FSQ+EQ++Q N+ L  LL S++L
Sbjct: 23  KATLNYDNFLQLLIAQMKNQDPTDPMDASEQVAQLATFSQVEQTIQTNTKLDTLLASSSL 82

Query: 80  AQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            QASSY+GK + +ADG++ GV+++++V S G+ A T D  +I +  GI +++
Sbjct: 83  TQASSYVGKYMESADGTVKGVIDSVKVYSDGIIATTTDGGKILVQAGITVAD 134


>gi|218506521|ref|ZP_03504399.1| flagellar basal body rod modification protein [Rhizobium etli
           Brasil 5]
          Length = 118

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 58/110 (52%), Positives = 84/110 (76%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
           TL  D FL+LLI Q+K+QDPT+PM ASEQVAQLA FSQ+EQ++Q N+ L  LL S++L Q
Sbjct: 2   TLNYDNFLQLLIAQMKNQDPTDPMDASEQVAQLATFSQVEQTIQTNTKLDTLLASSSLTQ 61

Query: 82  ASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           ASSY+GK + +ADG++ GV+++++V S G+ A T D  +I +  GI +++
Sbjct: 62  ASSYVGKYMESADGTVKGVIDSVKVYSDGIIATTTDGGKILVQAGITVAD 111


>gi|116250505|ref|YP_766343.1| flagellar basal body rod modification protein [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115255153|emb|CAK06227.1| putative hook formation protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 142

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 85/115 (73%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           ++SK TL  D FL+LLI Q+K+QDPT+P+ ASEQ++QLA FSQ+EQ++Q N+ L  LL S
Sbjct: 21  AQSKATLNYDNFLQLLIAQMKNQDPTDPVDASEQMSQLASFSQVEQTIQTNTKLDTLLAS 80

Query: 77  NNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           ++L QASSY+GK + +ADG++ G + +++V S G+ A T D   I +  GI I++
Sbjct: 81  SSLTQASSYVGKYMESADGTVKGTIESVKVYSDGIIATTTDGGNILVQAGITIAD 135


>gi|237817497|ref|ZP_04596488.1| flagellar basal body rod modification protein [Brucella abortus
           str. 2308 A]
 gi|294852963|ref|ZP_06793635.1| flagellar hook capping protein [Brucella sp. NVSL 07-0026]
 gi|237787332|gb|EEP61549.1| flagellar basal body rod modification protein [Brucella abortus
           str. 2308 A]
 gi|294818618|gb|EFG35618.1| flagellar hook capping protein [Brucella sp. NVSL 07-0026]
          Length = 151

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 82/111 (73%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K ++  D+FLKLL+TQ+++QDPT+PM  ++ V+QLA FS +EQSVQMNS L+ L+ + +L
Sbjct: 41  KASVDYDSFLKLLVTQMQNQDPTQPMDPTQYVSQLATFSNVEQSVQMNSKLETLIANTSL 100

Query: 80  AQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            QA  +IG+ +TNADGSISGVV ++ + S+G+ A   D   + I  G+RIS
Sbjct: 101 TQAEGWIGRTLTNADGSISGVVKSVTIQSSGMLAELEDGKTLTIGEGVRIS 151


>gi|17988508|ref|NP_541141.1| flagellar basal body rod modification protein [Brucella melitensis
           bv. 1 str. 16M]
 gi|23500849|ref|NP_700289.1| flagellar basal body rod modification protein [Brucella suis 1330]
 gi|62317952|ref|YP_223805.1| flagellar basal body rod modification protein [Brucella abortus bv.
           1 str. 9-941]
 gi|83269929|ref|YP_419220.1| flagellar basal body rod modification protein [Brucella melitensis
           biovar Abortus 2308]
 gi|148557915|ref|YP_001257999.1| flagellar basal body rod modification protein [Brucella ovis ATCC
           25840]
 gi|161621177|ref|YP_001595063.1| flagellar basal body rod modification protein [Brucella canis ATCC
           23365]
 gi|163845452|ref|YP_001623107.1| flagellar basal body rod modification protein [Brucella suis ATCC
           23445]
 gi|189023203|ref|YP_001932944.1| flagellar basal body rod modification protein [Brucella abortus
           S19]
 gi|225628424|ref|ZP_03786458.1| flagellar basal body rod modification protein [Brucella ceti str.
           Cudo]
 gi|225686880|ref|YP_002734852.1| flagellar basal body rod modification protein [Brucella melitensis
           ATCC 23457]
 gi|254691616|ref|ZP_05154870.1| flagellar basal body rod modification protein [Brucella abortus bv.
           6 str. 870]
 gi|254695088|ref|ZP_05156916.1| flagellar basal body rod modification protein [Brucella abortus bv.
           3 str. Tulya]
 gi|254698184|ref|ZP_05160012.1| flagellar basal body rod modification protein [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254699258|ref|ZP_05161086.1| flagellar basal body rod modification protein [Brucella suis bv. 5
           str. 513]
 gi|254702378|ref|ZP_05164206.1| flagellar basal body rod modification protein [Brucella suis bv. 3
           str. 686]
 gi|254706501|ref|ZP_05168329.1| flagellar basal body rod modification protein [Brucella
           pinnipedialis M163/99/10]
 gi|254711214|ref|ZP_05173025.1| flagellar basal body rod modification protein [Brucella
           pinnipedialis B2/94]
 gi|254711813|ref|ZP_05173624.1| flagellar basal body rod modification protein [Brucella ceti
           M644/93/1]
 gi|254714882|ref|ZP_05176693.1| flagellar basal body rod modification protein [Brucella ceti
           M13/05/1]
 gi|254731629|ref|ZP_05190207.1| flagellar basal body rod modification protein [Brucella abortus bv.
           4 str. 292]
 gi|256015893|ref|YP_003105902.1| flagellar basal body rod modification protein [Brucella microti CCM
           4915]
 gi|256030157|ref|ZP_05443771.1| flagellar basal body rod modification protein [Brucella
           pinnipedialis M292/94/1]
 gi|256042861|ref|ZP_05445807.1| flagellar basal body rod modification protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256059809|ref|ZP_05450004.1| flagellar basal body rod modification protein [Brucella neotomae
           5K33]
 gi|256112181|ref|ZP_05453102.1| flagellar basal body rod modification protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|256158336|ref|ZP_05456240.1| flagellar basal body rod modification protein [Brucella ceti
           M490/95/1]
 gi|256252730|ref|ZP_05458266.1| flagellar basal body rod modification protein [Brucella ceti B1/94]
 gi|256256803|ref|ZP_05462339.1| flagellar basal body rod modification protein [Brucella abortus bv.
           9 str. C68]
 gi|256261983|ref|ZP_05464515.1| flagellar hook capping protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260166791|ref|ZP_05753602.1| flagellar basal body rod modification protein [Brucella sp. F5/99]
 gi|260544137|ref|ZP_05819958.1| flagellar hook capping protein [Brucella abortus NCTC 8038]
 gi|260564098|ref|ZP_05834583.1| flagellar hook capping protein [Brucella melitensis bv. 1 str. 16M]
 gi|260568719|ref|ZP_05839188.1| flagellar hook capping protein [Brucella suis bv. 4 str. 40]
 gi|260757247|ref|ZP_05869595.1| flagellar hook capping protein [Brucella abortus bv. 6 str. 870]
 gi|260759388|ref|ZP_05871736.1| flagellar hook capping protein [Brucella abortus bv. 4 str. 292]
 gi|260762631|ref|ZP_05874963.1| flagellar hook capping protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883051|ref|ZP_05894665.1| flagellar hook capping protein [Brucella abortus bv. 9 str. C68]
 gi|261215439|ref|ZP_05929720.1| flagellar hook capping protein [Brucella abortus bv. 3 str. Tulya]
 gi|261216572|ref|ZP_05930853.1| flagellar hook capping protein [Brucella ceti M13/05/1]
 gi|261219808|ref|ZP_05934089.1| flagellar hook capping protein [Brucella ceti B1/94]
 gi|261313955|ref|ZP_05953152.1| flagellar hook capping protein [Brucella pinnipedialis M163/99/10]
 gi|261318805|ref|ZP_05958002.1| flagellar hook capping protein [Brucella pinnipedialis B2/94]
 gi|261319442|ref|ZP_05958639.1| flagellar hook capping protein [Brucella ceti M644/93/1]
 gi|261323789|ref|ZP_05962986.1| flagellar hook capping protein [Brucella neotomae 5K33]
 gi|261749697|ref|ZP_05993406.1| flagellar hook capping protein [Brucella suis bv. 5 str. 513]
 gi|261752941|ref|ZP_05996650.1| flagellar hook capping protein [Brucella suis bv. 3 str. 686]
 gi|261756168|ref|ZP_05999877.1| flagellar hook capping protein [Brucella sp. F5/99]
 gi|265987188|ref|ZP_06099745.1| flagellar hook capping protein [Brucella pinnipedialis M292/94/1]
 gi|265989296|ref|ZP_06101853.1| flagellar hook capping protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993608|ref|ZP_06106165.1| flagellar hook capping protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265996851|ref|ZP_06109408.1| flagellar hook capping protein [Brucella ceti M490/95/1]
 gi|297250156|ref|ZP_06933857.1| flagellar hook capping protein [Brucella abortus bv. 5 str. B3196]
 gi|17984300|gb|AAL53405.1| basal-body rod modification protein flgd [Brucella melitensis bv. 1
           str. 16M]
 gi|23464513|gb|AAN34294.1| basal-body rod modification protein FlgD, putative [Brucella suis
           1330]
 gi|62198145|gb|AAX76444.1| hypothetical FlgD basal-body rod modification protein [Brucella
           abortus bv. 1 str. 9-941]
 gi|82940203|emb|CAJ13259.1| ATP/GTP-binding site motif A (P-loop):Flagellar hook capping
           protein [Brucella melitensis biovar Abortus 2308]
 gi|148369200|gb|ABQ62072.1| putative basal-body rod modification protein FlgD [Brucella ovis
           ATCC 25840]
 gi|161337988|gb|ABX64292.1| flagellar hook capping protein [Brucella canis ATCC 23365]
 gi|163676175|gb|ABY40285.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189021777|gb|ACD74498.1| Flagellar hook capping protein [Brucella abortus S19]
 gi|225616270|gb|EEH13318.1| flagellar basal body rod modification protein [Brucella ceti str.
           Cudo]
 gi|225642985|gb|ACO02898.1| flagellar hook capping protein [Brucella melitensis ATCC 23457]
 gi|255998553|gb|ACU50240.1| flagellar basal body rod modification protein [Brucella microti CCM
           4915]
 gi|260097408|gb|EEW81282.1| flagellar hook capping protein [Brucella abortus NCTC 8038]
 gi|260151741|gb|EEW86834.1| flagellar hook capping protein [Brucella melitensis bv. 1 str. 16M]
 gi|260155384|gb|EEW90465.1| flagellar hook capping protein [Brucella suis bv. 4 str. 40]
 gi|260669706|gb|EEX56646.1| flagellar hook capping protein [Brucella abortus bv. 4 str. 292]
 gi|260673052|gb|EEX59873.1| flagellar hook capping protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260677355|gb|EEX64176.1| flagellar hook capping protein [Brucella abortus bv. 6 str. 870]
 gi|260872579|gb|EEX79648.1| flagellar hook capping protein [Brucella abortus bv. 9 str. C68]
 gi|260917046|gb|EEX83907.1| flagellar hook capping protein [Brucella abortus bv. 3 str. Tulya]
 gi|260918392|gb|EEX85045.1| flagellar hook capping protein [Brucella ceti B1/94]
 gi|260921661|gb|EEX88229.1| flagellar hook capping protein [Brucella ceti M13/05/1]
 gi|261292132|gb|EEX95628.1| flagellar hook capping protein [Brucella ceti M644/93/1]
 gi|261298028|gb|EEY01525.1| flagellar hook capping protein [Brucella pinnipedialis B2/94]
 gi|261299769|gb|EEY03266.1| flagellar hook capping protein [Brucella neotomae 5K33]
 gi|261302981|gb|EEY06478.1| flagellar hook capping protein [Brucella pinnipedialis M163/99/10]
 gi|261736152|gb|EEY24148.1| flagellar hook capping protein [Brucella sp. F5/99]
 gi|261739450|gb|EEY27376.1| flagellar hook capping protein [Brucella suis bv. 5 str. 513]
 gi|261742694|gb|EEY30620.1| flagellar hook capping protein [Brucella suis bv. 3 str. 686]
 gi|262551148|gb|EEZ07309.1| flagellar hook capping protein [Brucella ceti M490/95/1]
 gi|262764478|gb|EEZ10510.1| flagellar hook capping protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262999965|gb|EEZ12655.1| flagellar hook capping protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263091467|gb|EEZ16003.1| flagellar hook capping protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264659385|gb|EEZ29646.1| flagellar hook capping protein [Brucella pinnipedialis M292/94/1]
 gi|297174025|gb|EFH33389.1| flagellar hook capping protein [Brucella abortus bv. 5 str. B3196]
 gi|326411298|gb|ADZ68362.1| flagellar basal body rod modification protein [Brucella melitensis
           M28]
 gi|326554587|gb|ADZ89226.1| flagellar basal body rod modification protein [Brucella melitensis
           M5-90]
          Length = 137

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 82/111 (73%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K ++  D+FLKLL+TQ+++QDPT+PM  ++ V+QLA FS +EQSVQMNS L+ L+ + +L
Sbjct: 27  KASVDYDSFLKLLVTQMQNQDPTQPMDPTQYVSQLATFSNVEQSVQMNSKLETLIANTSL 86

Query: 80  AQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            QA  +IG+ +TNADGSISGVV ++ + S+G+ A   D   + I  G+RIS
Sbjct: 87  TQAEGWIGRTLTNADGSISGVVKSVTIQSSGMLAELEDGKTLTIGEGVRIS 137


>gi|163758037|ref|ZP_02165125.1| flagellar basal-body rod modification protein D [Hoeflea
           phototrophica DFL-43]
 gi|162284326|gb|EDQ34609.1| flagellar basal-body rod modification protein D [Hoeflea
           phototrophica DFL-43]
          Length = 133

 Score =  117 bits (292), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 81/110 (73%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K TL  D FL LL+ Q+K+QDPT+PM ++EQ+AQLA FSQ+EQ++Q N  L+ELL+S++L
Sbjct: 23  KATLDYDTFLTLLVEQMKNQDPTDPMDSTEQIAQLATFSQVEQTIQTNKHLEELLQSSSL 82

Query: 80  AQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
           +QA S IG+ IT+ D ++SG +  +QV S GL A+  D T++ +  G+ I
Sbjct: 83  SQAGSLIGRTITSNDETVSGTIEEVQVYSDGLVAVLEDGTKVVVGPGVSI 132


>gi|13472597|ref|NP_104164.1| flagellar basal body rod modification protein [Mesorhizobium loti
           MAFF303099]
 gi|14023343|dbj|BAB49950.1| flagellar hook assembly scaffolding protein; FlgD [Mesorhizobium
           loti MAFF303099]
          Length = 135

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 88/115 (76%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           +KS SK  +   +FLKLLI ++K+QDPT+PM +++ VAQLA FSQ+EQSVQ N+ L +++
Sbjct: 17  TKSTSKTAVDYQSFLKLLIAEMKNQDPTKPMDSTQYVAQLATFSQVEQSVQSNTKLDQIM 76

Query: 75  KSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
           +S+ L+QA + IG++IT+ADG  +G+V ++ ++S+GL A+  D T++P+  G+ I
Sbjct: 77  QSSALSQADAIIGRSITSADGKTTGIVASVTLASSGLIAVLQDGTKVPVGPGVSI 131


>gi|241203129|ref|YP_002974225.1| flagellar basal body rod modification protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240857019|gb|ACS54686.1| flagellar hook capping protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 144

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 82/112 (73%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K TL  D FL+LLI Q+K+QDPT+P+ ASEQ++QLA FSQ+EQ++Q N+ L  LL S++L
Sbjct: 24  KATLNYDNFLQLLIAQMKNQDPTDPVDASEQMSQLASFSQVEQTIQTNTKLDTLLASSSL 83

Query: 80  AQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            QASSY+GK + +ADG++ G + +++V S G+ A T D   I +  GI +++
Sbjct: 84  TQASSYVGKYMESADGTVKGTIESVKVYSDGIIATTTDGGNILVQAGITVAD 135


>gi|254720778|ref|ZP_05182589.1| flagellar basal body rod modification protein [Brucella sp. 83/13]
 gi|265985836|ref|ZP_06098571.1| flagellar hook capping protein [Brucella sp. 83/13]
 gi|306840131|ref|ZP_07472916.1| flagellar basal body rod modification protein [Brucella sp. NF
           2653]
 gi|306845414|ref|ZP_07477988.1| flagellar basal body rod modification protein [Brucella sp. BO1]
 gi|264664428|gb|EEZ34689.1| flagellar hook capping protein [Brucella sp. 83/13]
 gi|306274157|gb|EFM55973.1| flagellar basal body rod modification protein [Brucella sp. BO1]
 gi|306404776|gb|EFM61070.1| flagellar basal body rod modification protein [Brucella sp. NF
           2653]
          Length = 137

 Score =  115 bits (289), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 82/111 (73%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K ++  D+FLKLL+TQ+++QDPT+PM  ++ V+QLA FS +EQSVQMNS L+ L+ + +L
Sbjct: 27  KASVDYDSFLKLLVTQMQNQDPTQPMDPTQYVSQLATFSNVEQSVQMNSKLETLIANTSL 86

Query: 80  AQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            QA  +IG+ +T+ADGSISGVV ++ + S+G+ A   D   + I  G+RIS
Sbjct: 87  TQAEGWIGRTLTSADGSISGVVKSVTIQSSGMLAELEDGKTLTIGEGVRIS 137


>gi|306841281|ref|ZP_07473992.1| flagellar basal body rod modification protein [Brucella sp. BO2]
 gi|306288683|gb|EFM60014.1| flagellar basal body rod modification protein [Brucella sp. BO2]
          Length = 137

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 82/111 (73%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K ++  D+FLKLL+TQ+++QDPT+PM  ++ V+QLA FS +EQSVQMNS L+ L+ + +L
Sbjct: 27  KASVDYDSFLKLLVTQMQNQDPTQPMDPTQYVSQLATFSNVEQSVQMNSKLETLIANTSL 86

Query: 80  AQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            QA  +IG+ +T+ADGSI+GVV ++ + S+G+ A   D   + I  G+RIS
Sbjct: 87  TQAEGWIGRTLTSADGSITGVVKSVTIQSSGMLAELEDGKTLTIGEGVRIS 137


>gi|239834422|ref|ZP_04682750.1| flagellar basal body rod modification protein [Ochrobactrum
           intermedium LMG 3301]
 gi|239822485|gb|EEQ94054.1| flagellar basal body rod modification protein [Ochrobactrum
           intermedium LMG 3301]
          Length = 136

 Score =  114 bits (284), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 84/114 (73%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           + +K ++  ++FLKLL+TQ+++QDPT+PM A++ V+QLA FS +EQ+VQMNS L+ L+ +
Sbjct: 23  AANKASVDYNSFLKLLVTQMQNQDPTQPMDATQYVSQLATFSNVEQAVQMNSKLETLIAN 82

Query: 77  NNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            +L QA  +IG+ +TNADGSISGVV ++ + S G+ A   D   + I  G++IS
Sbjct: 83  TSLTQAEGWIGRTLTNADGSISGVVKSVTIQSNGMLAELEDGKTLMIGAGVKIS 136


>gi|153011503|ref|YP_001372717.1| flagellar basal body rod modification protein [Ochrobactrum
           anthropi ATCC 49188]
 gi|151563391|gb|ABS16888.1| flagellar hook capping protein [Ochrobactrum anthropi ATCC 49188]
          Length = 136

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 82/111 (73%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K ++  ++FLKLL+TQ+++QDPT+PM A++ V+QLA FS +EQ+VQMNS L+ L+ + +L
Sbjct: 26  KASVDYNSFLKLLVTQMQNQDPTQPMDATQYVSQLATFSNVEQAVQMNSKLETLIANTSL 85

Query: 80  AQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            QA  +IG+ +TNADGSISGVV ++ + S G+ A   D   + I  G++IS
Sbjct: 86  TQAEGWIGRTLTNADGSISGVVKSVTIQSNGMLAELEDGKTLMIGAGVKIS 136


>gi|260466598|ref|ZP_05812786.1| flagellar hook capping protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259029604|gb|EEW30892.1| flagellar hook capping protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 135

 Score =  111 bits (277), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 50/103 (48%), Positives = 80/103 (77%)

Query: 27  AFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYI 86
           +FLKLLI ++K+QDPT+PM +++ VAQLA FSQ+EQSVQ N+ L+++++S+ L+QA + I
Sbjct: 29  SFLKLLIAEMKNQDPTKPMDSTQYVAQLATFSQVEQSVQTNTKLEQIMQSSALSQADAII 88

Query: 87  GKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
           G+ IT+ADG  +G V ++ ++S GL A+  D T++P+  G+ I
Sbjct: 89  GRTITSADGKTTGTVASVTLASNGLIAVLQDGTQVPVGAGVSI 131


>gi|296445191|ref|ZP_06887151.1| flagellar hook capping protein [Methylosinus trichosporium OB3b]
 gi|296257365|gb|EFH04432.1| flagellar hook capping protein [Methylosinus trichosporium OB3b]
          Length = 134

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 78/108 (72%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           LG D FL LL+T++++QDPT P+ +++ V+QLA FS +EQ V+ N TL  +L S +L QA
Sbjct: 27  LGYDQFLTLLVTEMQNQDPTNPVDSTQTVSQLASFSAVEQQVKTNDTLTSMLASQSLTQA 86

Query: 83  SSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            S+IGK +T+ADGS+SGVV ++ + S+  TA   D + I +TTGI +S
Sbjct: 87  QSFIGKTVTSADGSVSGVVASVTIGSSSQTATLTDGSTIDLTTGITVS 134


>gi|110632635|ref|YP_672843.1| flagellar basal body rod modification protein [Mesorhizobium sp.
           BNC1]
 gi|110283619|gb|ABG61678.1| flagellar hook capping protein [Chelativorans sp. BNC1]
          Length = 129

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 90/130 (69%), Gaps = 1/130 (0%)

Query: 1   MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
           M ++T V  T Q    + + +T+   +FL+LL+ Q+K+QDPT PM++++ VAQLA FSQ+
Sbjct: 1   MNVST-VTSTPQNQQTASAPQTVDYQSFLRLLVAQMKNQDPTSPMESTDYVAQLATFSQV 59

Query: 61  EQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE 120
           EQSVQMNS L+++L ++ L+QA   IG+ IT+ADGS++G+V  +++ S G+ A      E
Sbjct: 60  EQSVQMNSKLEQILAASALSQAGGVIGREITSADGSVTGIVKEVKLYSDGVIAKLESGQE 119

Query: 121 IPITTGIRIS 130
           + +  G+ IS
Sbjct: 120 VVVGPGVVIS 129


>gi|218680426|ref|ZP_03528323.1| flagellar basal body rod modification protein [Rhizobium etli CIAT
           894]
          Length = 112

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 73/97 (75%)

Query: 35  QIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIGKNITNAD 94
           Q+K+QDPT+PMKASEQVAQLA FSQ+EQ+VQ N+ L  LL S++L QASSY+GK + +AD
Sbjct: 2   QMKNQDPTDPMKASEQVAQLATFSQVEQTVQTNTKLDTLLASSSLTQASSYVGKYMESAD 61

Query: 95  GSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           G++ G + +++V S G+ A T D   I +  GI +++
Sbjct: 62  GTVKGTIESVKVYSDGIIATTTDGGNILVQAGITVAD 98


>gi|319781660|ref|YP_004141136.1| flagellar hook capping protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167548|gb|ADV11086.1| flagellar hook capping protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 135

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 91/129 (70%)

Query: 1   MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
           +++ T +     + + S SK  +   +FLKLLI ++K+QDPT+PM +++ VAQLA FSQ+
Sbjct: 3   VDMTTTIPTGANQATASTSKTAVDYQSFLKLLIAEMKNQDPTKPMDSTQYVAQLATFSQV 62

Query: 61  EQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE 120
           EQSVQ N+ L ++++S+ L+QA + IG++IT+ADG  +G V +++++S GL A+  + TE
Sbjct: 63  EQSVQTNTKLNQIMQSSALSQADALIGRSITSADGLTTGTVASVRLASNGLIAVLQNGTE 122

Query: 121 IPITTGIRI 129
           + +  G+ +
Sbjct: 123 VAVGPGVSV 131


>gi|150395508|ref|YP_001325975.1| flagellar basal body rod modification protein [Sinorhizobium
           medicae WSM419]
 gi|150027023|gb|ABR59140.1| flagellar hook capping protein [Sinorhizobium medicae WSM419]
          Length = 138

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 49/117 (41%), Positives = 82/117 (70%)

Query: 13  EFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE 72
           E +   S  TL  ++FLKLL+ Q+K+QDPT+PM A++Q+AQLA FSQ+EQ+++ N  L+ 
Sbjct: 21  ESAGDASAATLNYESFLKLLVAQMKNQDPTQPMDATQQIAQLATFSQVEQTIKTNKNLES 80

Query: 73  LLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
           LL+  +L++A + IG+ +T+ADG  +GVV  +++ S G+ A+     E+ I  G+++
Sbjct: 81  LLQRTSLSEADAVIGRTVTSADGKTTGVVKEVKLYSDGIIAVLDTGKELVIGPGVKV 137


>gi|325291967|ref|YP_004277831.1| flagellar basal body rod modification protein [Agrobacterium sp.
           H13-3]
 gi|325059820|gb|ADY63511.1| flagellar basal body rod modification protein [Agrobacterium sp.
           H13-3]
          Length = 156

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/117 (43%), Positives = 80/117 (68%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           S  KS  +L  D+FLKLLI Q+K+QDPT PM A +Q++QLA FSQ+EQ+++ N+ L+ +L
Sbjct: 21  SNDKSAASLNYDSFLKLLIAQMKNQDPTSPMDAGQQMSQLASFSQVEQTIKTNTHLKSML 80

Query: 75  KSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           ++  L +AS  +GK + +AD  ++GVV  ++V S G+ AIT    ++ +  G+  SN
Sbjct: 81  QAEALTRASDLVGKTVKSADDKVTGVVKEVEVYSDGVVAITEAGDKVLLQAGVTFSN 137


>gi|15887924|ref|NP_353605.1| flagellar basal body rod modification protein [Agrobacterium
           tumefaciens str. C58]
 gi|15155520|gb|AAK86390.1| hook formation protein [Agrobacterium tumefaciens str. C58]
          Length = 157

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/117 (42%), Positives = 80/117 (68%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           S  K+  +L  D+FLKLLI Q+K+QDPT PM A +Q++QLA FSQ+EQ+++ N+ L+ +L
Sbjct: 21  SSDKNAASLNYDSFLKLLIAQMKNQDPTSPMDAGQQMSQLASFSQVEQTIKTNTHLKSML 80

Query: 75  KSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           ++  L +AS  +GK + +AD  ++GVV  +QV S G+ A+T    ++ +  G+  SN
Sbjct: 81  QAEALTRASDLVGKTVMSADDKVTGVVKEVQVFSDGIVAVTEAGDKVLLQAGVVFSN 137


>gi|170744548|ref|YP_001773203.1| flagellar basal body rod modification protein [Methylobacterium sp.
           4-46]
 gi|168198822|gb|ACA20769.1| flagellar hook capping protein [Methylobacterium sp. 4-46]
          Length = 142

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 50/114 (43%), Positives = 80/114 (70%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           SK+  +L  DAFL+LL+TQ+K+QDPT+PM ++  + +LA FS++EQS +MN+ L  LL S
Sbjct: 29  SKTATSLNTDAFLQLLLTQLKNQDPTKPMDSTAYMGELATFSEVEQSTKMNNKLDALLSS 88

Query: 77  NNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           N L+QA S IG+  T+ DG I+GVV ++++++ G  A   D  ++ +  G+ +S
Sbjct: 89  NYLSQAESAIGRTATSDDGKITGVVASVKITTDGPLATLKDGRQLLLGNGVSLS 142


>gi|15964437|ref|NP_384790.1| flagellar basal body rod modification protein [Sinorhizobium
           meliloti 1021]
 gi|307311579|ref|ZP_07591220.1| flagellar hook capping protein [Sinorhizobium meliloti BL225C]
 gi|307318934|ref|ZP_07598365.1| flagellar hook capping protein [Sinorhizobium meliloti AK83]
 gi|10998533|gb|AAG25963.1|AF300968_5 FlgD [Sinorhizobium meliloti]
 gi|15073614|emb|CAC45256.1| Putative basal-body rod modification protein [Sinorhizobium
           meliloti 1021]
 gi|306895348|gb|EFN26103.1| flagellar hook capping protein [Sinorhizobium meliloti AK83]
 gi|306899596|gb|EFN30225.1| flagellar hook capping protein [Sinorhizobium meliloti BL225C]
          Length = 138

 Score =  103 bits (256), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 77/109 (70%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           S  TL  ++FLKLL+ Q+K+QDPT+PM A++Q+AQLA FSQ+EQ+++ N  L+ LL+   
Sbjct: 27  SAATLNYESFLKLLVAQMKNQDPTQPMDATQQIAQLATFSQVEQTIKTNKNLESLLQRTA 86

Query: 79  LAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGI 127
           L++A + IG+ +T+ADG  +GVV  +++ S G+ A+     E+ I  G+
Sbjct: 87  LSEADAVIGRTVTSADGKTTGVVKEVKLYSDGIIAVLDTGKELVIGPGV 135


>gi|218671388|ref|ZP_03521058.1| flagellar basal body rod modification protein [Rhizobium etli GR56]
          Length = 159

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 85/115 (73%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           ++ K TL  D FL+LLI Q+K+QDPT+PM ASEQ++QLA FSQ+EQ++Q N+ L  LL S
Sbjct: 35  AQKKATLNYDNFLQLLIAQMKNQDPTDPMDASEQMSQLASFSQVEQTIQTNTKLDTLLSS 94

Query: 77  NNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           ++L QASSY+GK + +ADG++ G V +++V S G+ A T D  +I +  GI +++
Sbjct: 95  SSLTQASSYVGKYMESADGTVKGTVESVKVYSDGIIATTTDGGKILVQAGITVAD 149


>gi|218662878|ref|ZP_03518808.1| flagellar basal body rod modification protein [Rhizobium etli
           IE4771]
          Length = 146

 Score =  100 bits (249), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 57/112 (50%), Positives = 83/112 (74%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K TL  D FL+LLI Q+K+QDPT+PM ASEQ++QLA FSQ+EQ++Q N+ L  LL S++L
Sbjct: 23  KATLNYDNFLQLLIAQMKNQDPTDPMDASEQMSQLASFSQVEQTIQTNTKLDTLLSSSSL 82

Query: 80  AQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            QASSY+GK + +ADG++ G V +++V S G+ A T D  +I +  GI +++
Sbjct: 83  TQASSYVGKYMESADGTVKGTVESVKVYSDGIIATTTDGGKILVQAGITVAD 134


>gi|163850128|ref|YP_001638171.1| flagellar basal body rod modification protein [Methylobacterium
           extorquens PA1]
 gi|218528732|ref|YP_002419548.1| flagellar basal body rod modification protein [Methylobacterium
           chloromethanicum CM4]
 gi|163661733|gb|ABY29100.1| flagellar hook capping protein [Methylobacterium extorquens PA1]
 gi|218521035|gb|ACK81620.1| flagellar hook capping protein [Methylobacterium chloromethanicum
           CM4]
          Length = 138

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 73/105 (69%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSY 85
           D FL LL+ Q+++QDPT+PM ++E V QLA FSQ+EQ+ + N  L  LL S+ L QA + 
Sbjct: 34  DTFLTLLMAQLQNQDPTKPMDSTEYVGQLATFSQVEQATKTNQKLDSLLTSSFLNQADAI 93

Query: 86  IGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           IG+++T+ADG ISG V +++V+  G+ A   D  E+ + +GI IS
Sbjct: 94  IGRSLTSADGLISGTVQSVRVTGDGVMAKLTDGREMLLASGISIS 138


>gi|222084890|ref|YP_002543419.1| flagellar basal-body rod protein [Agrobacterium radiobacter K84]
 gi|221722338|gb|ACM25494.1| flagellar basal-body rod protein [Agrobacterium radiobacter K84]
          Length = 158

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/103 (46%), Positives = 73/103 (70%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIG 87
           FLKLLI Q+K QDPT+PM A++Q++QLA FSQ+EQ +Q NS L+ +L++  ++QAS YIG
Sbjct: 33  FLKLLIAQMKTQDPTDPMDATQQISQLASFSQVEQQIQTNSHLETVLQNQWISQASDYIG 92

Query: 88  KNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           K I +ADG+ +G +  + V S G+ A T    +I +  G+ ++
Sbjct: 93  KEIMSADGTTTGTIKEVTVYSDGIIAQTEAGDKILLQAGVTVA 135


>gi|170748120|ref|YP_001754380.1| flagellar basal body rod modification protein [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654642|gb|ACB23697.1| flagellar hook capping protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 139

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 69/91 (75%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           L  D FLKLL+ Q+K+Q+PT+PMK+++ +AQLA FSQ+EQSV MNS L  LL S+ L+QA
Sbjct: 32  LNYDNFLKLLLAQMKNQNPTDPMKSTDYMAQLATFSQVEQSVNMNSKLDALLTSSTLSQA 91

Query: 83  SSYIGKNITNADGSISGVVNAIQVSSTGLTA 113
              +G  +T+AD +++G V +++V+S GL A
Sbjct: 92  GGLVGHTVTSADKTLTGTVVSVEVASNGLLA 122


>gi|323136996|ref|ZP_08072076.1| flagellar hook capping protein [Methylocystis sp. ATCC 49242]
 gi|322397757|gb|EFY00279.1| flagellar hook capping protein [Methylocystis sp. ATCC 49242]
          Length = 136

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 74/105 (70%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSY 85
           +AFL+LL+T+++HQDP +PM  ++ V QLA F+ +EQ++Q NS L  L +++ L+QASS 
Sbjct: 32  NAFLQLLVTELRHQDPMKPMDPTQTVTQLATFASVEQAIQTNSLLASLNENSALSQASSL 91

Query: 86  IGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           IG+ +++ADG  SGVV ++ +   G+ A+  D  ++ +  G+ IS
Sbjct: 92  IGRTVSSADGKTSGVVKSVMIDDGGMIAVLADGRKVLLGPGVTIS 136


>gi|255610098|ref|XP_002539132.1| conserved hypothetical protein [Ricinus communis]
 gi|223508457|gb|EEF23251.1| conserved hypothetical protein [Ricinus communis]
          Length = 228

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/103 (46%), Positives = 73/103 (70%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIG 87
           FL+LLI Q+++QDPT+PM AS+Q++QLA FSQ+EQ +Q NS L+ +L++  ++QAS YIG
Sbjct: 33  FLQLLIAQMQNQDPTDPMDASQQISQLASFSQVEQQIQTNSHLETVLQNQWISQASDYIG 92

Query: 88  KNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           K I +ADG  +G +  + V + G+ A T    +I I  G+ I+
Sbjct: 93  KQIMSADGKTTGTIKEVTVYTDGIIAQTDAGDKILIQAGVTIA 135


>gi|188579930|ref|YP_001923375.1| flagellar basal body rod modification protein [Methylobacterium
           populi BJ001]
 gi|179343428|gb|ACB78840.1| flagellar hook capping protein [Methylobacterium populi BJ001]
          Length = 138

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 73/105 (69%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSY 85
           D FL+LL+ Q+++QDPT+PM ++E V QLA FSQ+EQ+ + N  L  LL S+ L QA + 
Sbjct: 34  DTFLQLLMAQLQNQDPTKPMDSTEYVGQLASFSQVEQATKTNQKLDSLLASSFLNQADAI 93

Query: 86  IGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           IG++IT+ADG  +G V +++V+  G+ A   D  E+ + +GI IS
Sbjct: 94  IGRSITSADGLTTGTVQSVRVTGDGVMAKLTDGREMLLASGISIS 138


>gi|254559273|ref|YP_003066368.1| Basal body rod modification protein FlgD [Methylobacterium
           extorquens DM4]
 gi|254266551|emb|CAX22315.1| FlgD ( BASAL-BODY ROD MODIFICATION PROTEIN)/hook formation protein
           [Methylobacterium extorquens DM4]
          Length = 138

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 72/105 (68%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSY 85
           D FL LL+ Q+++QDPT+PM ++E V QLA FSQ+EQ+ + N  L  LL S+ L QA + 
Sbjct: 34  DTFLTLLMAQLQNQDPTKPMDSTEYVGQLATFSQVEQATKTNQKLDSLLTSSFLNQADAI 93

Query: 86  IGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           IG+++T+ADG  SG V +++V+  G+ A   D  E+ + +GI IS
Sbjct: 94  IGRSLTSADGLTSGTVQSVRVTGDGVMAKLTDGREMLLASGISIS 138


>gi|240137262|ref|YP_002961731.1| FlgD (basal-body rod modification protein)/hook formation protein
           [Methylobacterium extorquens AM1]
 gi|240007228|gb|ACS38454.1| FlgD (basal-body rod modification protein)/hook formation protein
           [Methylobacterium extorquens AM1]
          Length = 135

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 72/105 (68%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSY 85
           D FL LL+ Q+++QDPT+PM ++E V QLA FSQ+EQ+ + N  L  LL S+ L QA + 
Sbjct: 31  DTFLTLLMAQLQNQDPTKPMDSTEYVGQLATFSQVEQATKTNQKLDSLLTSSFLNQADAI 90

Query: 86  IGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           IG+++T+ADG  SG V +++V+  G+ A   D  E+ + +GI IS
Sbjct: 91  IGRSLTSADGLTSGTVQSVRVTGDGVMAKLTDGREMLLASGISIS 135


>gi|300024583|ref|YP_003757194.1| flagellar hook capping protein [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526404|gb|ADJ24873.1| flagellar hook capping protein [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 136

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 77/106 (72%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
           TL  + FLKL++ Q+++QDP  P  +++ ++Q+A FS +EQ +  N+ L +LL ++N++Q
Sbjct: 26  TLNYNDFLKLMVAQLRNQDPLNPTDSTQYMSQIAQFSSVEQGINTNAKLDQLLVNSNISQ 85

Query: 82  ASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGI 127
           AS+ IG ++T+ADGS+SG+V ++++ STG TAI  +  E+ I  G+
Sbjct: 86  ASTMIGLSLTSADGSVSGIVTSVRIDSTGSTAILNNGKEVRIDQGV 131


>gi|222147594|ref|YP_002548551.1| flagellar basal body rod modification protein [Agrobacterium vitis
           S4]
 gi|221734582|gb|ACM35545.1| hook formation protein [Agrobacterium vitis S4]
          Length = 151

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 76/106 (71%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSY 85
           ++FL+LLI Q+++QDPT+PM A+EQV+QLA +SQ+EQS++ N+ L+ +L++  L +A   
Sbjct: 44  NSFLQLLIAQLQNQDPTDPMSATEQVSQLATYSQVEQSIKTNTLLRSMLQAEALTRAGDI 103

Query: 86  IGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           +GK +T++DG  +GVV+ ++V+   +T  T     + + TG+  S+
Sbjct: 104 VGKTVTSSDGETTGVVSNVKVADDAVTLTTSSGGTVELQTGVNFSS 149


>gi|209547951|ref|YP_002279868.1| flagellar basal body rod modification protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209533707|gb|ACI53642.1| flagellar hook capping protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 147

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 83/112 (74%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K TL  D FL+LLI Q+K+QDPT+P+ ASEQ++QLA FSQ+EQ++Q N+ L  LL S++L
Sbjct: 24  KATLNYDNFLQLLIAQMKNQDPTDPVDASEQMSQLASFSQVEQTIQTNTKLDTLLSSSSL 83

Query: 80  AQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            QASSY+GK + +ADG++ G + +++V S G+ A T +  +I +  GI +++
Sbjct: 84  TQASSYVGKYMESADGTVKGTIESVKVYSDGIIATTTNGGKILVQAGITVAD 135


>gi|182680452|ref|YP_001834598.1| flagellar basal body rod modification protein [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182636335|gb|ACB97109.1| flagellar hook capping protein [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 141

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/110 (44%), Positives = 73/110 (66%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
           T+   +FL+LL+ ++K+QDPT P   ++ ++QLA FS +EQ VQ NS L  LL +++L Q
Sbjct: 32  TVDYSSFLQLLVAELKNQDPTSPTDPTQYMSQLASFSSVEQQVQTNSKLDSLLTASSLGQ 91

Query: 82  ASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           A + IGK IT+ADGSISG V ++ VSS   TA   +  ++ +  GI I +
Sbjct: 92  AETVIGKTITSADGSISGKVQSVTVSSGTATATLDNGGQVKLADGISIGS 141


>gi|118589961|ref|ZP_01547365.1| flagellar basal-body rod modification protein D [Stappia aggregata
           IAM 12614]
 gi|118437458|gb|EAV44095.1| flagellar basal-body rod modification protein D [Stappia aggregata
           IAM 12614]
          Length = 131

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/127 (42%), Positives = 85/127 (66%), Gaps = 5/127 (3%)

Query: 7   VNPTQQEFSKSKSKK--TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSV 64
           V+ T+   S + ++K  T+  D FL L++ Q+++QDPT PM ASEQ+AQLA FSQ+EQS+
Sbjct: 7   VSATEGAASPATAQKQLTVDYDTFLHLMMAQMQNQDPTNPMDASEQLAQLASFSQVEQSI 66

Query: 65  QMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE-IPI 123
           Q N+ L+ LL + +  Q    IG+ +T+A+G+ +GVV  ++V S G T + +DN + I +
Sbjct: 67  QTNAKLETLLTNLSFGQVDDLIGRTVTDANGT-TGVVEKVEVYSDG-TVLALDNGKGILL 124

Query: 124 TTGIRIS 130
             G+ IS
Sbjct: 125 GPGVTIS 131


>gi|254503888|ref|ZP_05116039.1| flagellar hook capping protein [Labrenzia alexandrii DFL-11]
 gi|222439959|gb|EEE46638.1| flagellar hook capping protein [Labrenzia alexandrii DFL-11]
          Length = 134

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 80/110 (72%), Gaps = 3/110 (2%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
           T+  +AFL+L++TQ+K+QDPT+PM ASEQ++QLA FSQ+EQ++Q NS L+ +L + +  Q
Sbjct: 27  TVDYNAFLQLMMTQMKNQDPTKPMDASEQLSQLATFSQVEQAIQTNSKLETMLTNMSFGQ 86

Query: 82  ASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE-IPITTGIRIS 130
               IG+ +T+++G+ +GVV  +++ S G T + +DN + + +  G+ IS
Sbjct: 87  VDDLIGRTVTDSNGT-TGVVEKVEIYSDG-TILGLDNGKGVLLGPGVSIS 134


>gi|121602800|ref|YP_989378.1| flagellar hook capping protein [Bartonella bacilliformis KC583]
 gi|120614977|gb|ABM45578.1| flagellar hook capping protein [Bartonella bacilliformis KC583]
          Length = 190

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 75/113 (66%), Gaps = 4/113 (3%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           QQ+   + +KK    D F+KLL+ Q+K+QDPT PM ++E VAQLA FS +EQ+++MN  L
Sbjct: 19  QQDTPDTGAKKNTDYDTFVKLLVAQMKNQDPTNPMNSTEFVAQLASFSMVEQAIKMNDKL 78

Query: 71  QELLKSNNLAQASSYIGKNI--TNADGS-ISGVVNAIQVSSTGLTAITVDNTE 120
           +++L +  ++ A  Y+GK I   + DG+ I G V ++ + S G+ A T+DN E
Sbjct: 79  EQVLANGAISGAEGYVGKYIQFEDKDGNIIEGYVKSVDIYSDGIVA-TLDNGE 130


>gi|319898661|ref|YP_004158754.1| flagellar hook capping protein [Bartonella clarridgeiae 73]
 gi|319402625|emb|CBI76170.1| Flagellar hook capping protein (fragment) [Bartonella clarridgeiae
           73]
          Length = 169

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 49/115 (42%), Positives = 75/115 (65%), Gaps = 5/115 (4%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           +KK    D F+KLL+ Q+K+QDPT+PM ++E VAQLA FS +EQ+++MN TL ++L + +
Sbjct: 25  AKKNADYDTFIKLLVAQMKNQDPTKPMDSTEFVAQLASFSSVEQAIKMNETLTQMLSNGS 84

Query: 79  LAQASSYIGKNI---TNADGSISGVVNAIQVSSTGLTAITVDNTE-IPITTGIRI 129
           +  A  Y+GK I      D  I G V +I + S G+ A T+DN E + I  G+++
Sbjct: 85  INGAEGYVGKYIQFTDEKDKIIEGYVVSIDIYSDGIVA-TLDNGEKVVIGPGVKV 138


>gi|319405426|emb|CBI79045.1| Flagellar hook capping protein [Bartonella sp. AR 15-3]
          Length = 169

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/115 (42%), Positives = 77/115 (66%), Gaps = 5/115 (4%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           +KK    D F+KLL+ Q+K+QDPT+PM ++E VA LA FS +EQ+++MN TL ++L + +
Sbjct: 25  AKKNADYDTFIKLLVAQMKNQDPTKPMDSTEFVAHLASFSSVEQAIKMNETLAQMLSNGS 84

Query: 79  LAQASSYIGKNI--TNADGS-ISGVVNAIQVSSTGLTAITVDNTE-IPITTGIRI 129
           +  A  Y+GK I  T+  G+ I G V +I + S G+ A T+DN E + I  G+++
Sbjct: 85  INGAEGYVGKYIQFTDEKGTVIEGYVVSIDIYSDGIVA-TLDNGEKVVIGPGVKV 138


>gi|319406999|emb|CBI80636.1| Flagellar hook capping protein (fragment) [Bartonella sp. 1-1C]
          Length = 170

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 74/115 (64%), Gaps = 5/115 (4%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           +KK    D F+KLL+ Q+K+QDPT+PM ++E V+QLA FS +EQ+++MN TL ++L +  
Sbjct: 26  AKKNADYDMFIKLLVAQMKNQDPTKPMDSTEFVSQLASFSSVEQAIKMNETLSQMLSNGL 85

Query: 79  LAQASSYIGKNI---TNADGSISGVVNAIQVSSTGLTAITVDNTE-IPITTGIRI 129
           +  A  Y+GK I      D  I G V +I + S G+ A T+DN E + I  G+++
Sbjct: 86  INGAEGYVGKYIQFTDEKDKVIEGYVVSIDIYSDGIVA-TLDNGEKVVIGPGVKV 139


>gi|304392488|ref|ZP_07374428.1| flagellar hook capping protein [Ahrensia sp. R2A130]
 gi|303295118|gb|EFL89478.1| flagellar hook capping protein [Ahrensia sp. R2A130]
          Length = 131

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 70/105 (66%), Gaps = 2/105 (1%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K  +  D+FLKLL+ ++++QDPT+PM++SE VAQLA FS +EQS+Q N+ L  LL  N L
Sbjct: 23  KAQVDYDSFLKLLVAELENQDPTKPMESSEFVAQLATFSGVEQSIQTNTKLDALLAGNVL 82

Query: 80  AQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPIT 124
            QA + IG+ +T  D  ++G+V+++ + S   + +  D   + ++
Sbjct: 83  GQAGTMIGRTVTAGD--VTGLVDSVAIESGSASLVLDDGRRVALS 125


>gi|319403983|emb|CBI77571.1| hypothetical protein BARRO_30152 [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 169

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 74/115 (64%), Gaps = 5/115 (4%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           +KK    D F+KLL+ Q+K+QDPT+PM ++E V+QLA FS +EQ+++MN TL ++L +  
Sbjct: 25  AKKNADYDMFIKLLVAQMKNQDPTKPMDSTEFVSQLASFSSVEQAIKMNETLSQMLSNGL 84

Query: 79  LAQASSYIGKNI---TNADGSISGVVNAIQVSSTGLTAITVDNTE-IPITTGIRI 129
           +  A  Y+GK I      D  I G V +I + S G+ A T+DN E + I  G+++
Sbjct: 85  INGAEGYVGKYIQFTDEKDKVIEGYVVSIDIYSDGIVA-TLDNGEKVVIGPGVKV 138


>gi|312115275|ref|YP_004012871.1| flagellar hook capping protein [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220404|gb|ADP71772.1| flagellar hook capping protein [Rhodomicrobium vannielii ATCC
           17100]
          Length = 100

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 68/100 (68%)

Query: 31  LLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIGKNI 90
           +L+ Q+++QDPT+P   ++ ++QLA FS +EQ V  NS L  LL    ++Q +S IGK +
Sbjct: 1   MLVAQLQNQDPTDPTDPTQFISQLASFSSVEQLVNANSRLDTLLTQTAISQGASLIGKTV 60

Query: 91  TNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           T+ADG+ISG + +I++SS+G  A   D + I + +G+ IS
Sbjct: 61  TSADGTISGTIASIEISSSGSVATLADGSTIELASGVVIS 100


>gi|90418360|ref|ZP_01226272.1| flagellar hook capping protein FlgD [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90338032|gb|EAS51683.1| flagellar hook capping protein FlgD [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 134

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 72/125 (57%)

Query: 5   TEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSV 64
           T     Q   S +  K  +  DAFLKLL+ ++ +QDP  P  ++E VAQ A FS +EQ++
Sbjct: 9   TSATAAQTGISAATQKTGMDYDAFLKLLVAEMSNQDPLNPTDSTEYVAQFASFSSVEQAI 68

Query: 65  QMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPIT 124
           Q N  L  ++  + L QA+S IG+  T+ADG++SG V A++  +  + AI      +P+ 
Sbjct: 69  QTNKKLDSMMTVSALTQANSLIGQTATSADGTLSGKVAAVRAVNGVVEAILESGDSLPLI 128

Query: 125 TGIRI 129
           +G  +
Sbjct: 129 SGTTV 133


>gi|328545486|ref|YP_004305595.1| flagellar hook capping protein [polymorphum gilvum SL003B-26A1]
 gi|326415227|gb|ADZ72290.1| Flagellar hook capping protein [Polymorphum gilvum SL003B-26A1]
          Length = 131

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/110 (40%), Positives = 79/110 (71%), Gaps = 3/110 (2%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
           TL  +AFL+L++ Q+K+QDPT+P+ +++Q+AQLA FSQ+EQ+++ N+ L+ +L + +  Q
Sbjct: 24  TLDYNAFLQLMLAQMKNQDPTDPVDSTQQLAQLATFSQVEQAMKTNTKLEAMLTNMSFGQ 83

Query: 82  ASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE-IPITTGIRIS 130
               IG+  T+A G+ +GVV +++V S G T + +DN + I +  G++IS
Sbjct: 84  VDDLIGRTATDAIGT-TGVVTSVEVYSDG-TLLGLDNGKGILLGPGVKIS 131


>gi|220932519|ref|YP_002509427.1| flagellar hook capping protein [Halothermothrix orenii H 168]
 gi|219993829|gb|ACL70432.1| flagellar hook capping protein [Halothermothrix orenii H 168]
          Length = 142

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 66/112 (58%), Gaps = 4/112 (3%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           L +DAF KLLITQ++HQDP +PM+  E +AQ+A FS +EQ   MN  L   ++  +L+Q 
Sbjct: 31  LDKDAFFKLLITQLRHQDPLKPMEDREFIAQMAEFSSLEQMANMNENLSTFMRMESLSQG 90

Query: 83  SSYIGKNITNADGS----ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           ++ IG+N+   D      +SG V  +   S  L A   ++ +IP+ T   IS
Sbjct: 91  AALIGRNVEYVDSQSGRILSGKVTKVVYESGTLYAHLDNDVKIPVDTITSIS 142


>gi|319409164|emb|CBI82808.1| Flagellar hook capping protein [Bartonella schoenbuchensis R1]
          Length = 160

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 72/115 (62%), Gaps = 3/115 (2%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           ++KK    D F+KLL+ Q+ +QDPT PM ++E VAQLA FS +EQ+++ N  L ++L + 
Sbjct: 26  EAKKDTDFDTFIKLLVAQMNNQDPTNPMDSTEFVAQLASFSVVEQTIKTNDKLDQILSNG 85

Query: 78  NLAQASSYIGKNI--TNADGS-ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
           ++  A  Y+GK I   +ADG  I G V +I + + G+ A   +N ++ I  GI +
Sbjct: 86  SINGAEGYVGKYIQFEDADGKIIEGYVESIDIYTDGMVATLDNNEKVLIGPGITV 140


>gi|158422276|ref|YP_001523568.1| flagellar basal body rod modification protein [Azorhizobium
           caulinodans ORS 571]
 gi|158329165|dbj|BAF86650.1| flagellar hook assembly scaffolding protein [Azorhizobium
           caulinodans ORS 571]
          Length = 138

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIG 87
           FL+LL+ Q+K+QDPT+PM ++  ++QLA FSQ+EQ    N  L  LL ++ L  A + IG
Sbjct: 34  FLQLLVAQLKNQDPTQPMDSTAYLSQLASFSQVEQQTNTNKKLDTLLSASALQSADAAIG 93

Query: 88  KNITNADGSISGVVNAIQVSSTGLTAITV-DNTEIPITTGIRISN 131
           K +T+ADG++SG V ++ + S G    T+ D +++ + + + IS 
Sbjct: 94  KTVTSADGTVSGTVASVSLVSGGAPIATLKDGSKVTLDSSVSISG 138


>gi|217976245|ref|YP_002360392.1| flagellar basal body rod modification protein [Methylocella
           silvestris BL2]
 gi|217501621|gb|ACK49030.1| flagellar hook capping protein [Methylocella silvestris BL2]
          Length = 135

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 69/104 (66%), Gaps = 5/104 (4%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIG 87
           FL+LLIT++K+QDPT P   ++ ++QLA FS +EQ V+ NS L  LL +    QA + IG
Sbjct: 34  FLQLLITELKNQDPTSPTDPTQYMSQLASFSSVEQQVKTNSALDALLAT----QAGALIG 89

Query: 88  KNITNADGSISGVVNAIQVSSTG-LTAITVDNTEIPITTGIRIS 130
           K  T+ADG ISGV+ ++  S+ G +TA   + + I + +G+ IS
Sbjct: 90  KTATSADGKISGVIASVTTSAGGDVTATLKNGSAITLGSGVTIS 133


>gi|114706623|ref|ZP_01439524.1| flagellar basal-body rod modification protein D [Fulvimarina pelagi
           HTCC2506]
 gi|114538015|gb|EAU41138.1| flagellar basal-body rod modification protein D [Fulvimarina pelagi
           HTCC2506]
          Length = 136

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 66/105 (62%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSY 85
           DAFL+LL+ Q+K+QDP  P +++E +AQ A F+ +EQS+Q N+ L+ ++  + L QA + 
Sbjct: 32  DAFLQLLVAQMKNQDPLNPAESTEYIAQFATFANVEQSIQTNTRLESMMTVSALTQADAL 91

Query: 86  IGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           IG+ +T+ DG+  G V +I+    G+ A       I +  G+ ++
Sbjct: 92  IGRTLTSLDGATRGTVTSIRAVDGGIQATIEGGETIMLGDGVSVA 136


>gi|323703175|ref|ZP_08114828.1| flagellar hook capping protein [Desulfotomaculum nigrificans DSM
           574]
 gi|323531834|gb|EGB21720.1| flagellar hook capping protein [Desulfotomaculum nigrificans DSM
           574]
          Length = 138

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 2/105 (1%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           S  K  KTL +DAFL++++ Q+K+QDPT PM   + + Q+A F+ +EQ   +NS  ++L 
Sbjct: 17  SPRKPVKTLDKDAFLQIMVAQLKYQDPTSPMDNDKMIEQIAQFTTLEQITNLNSNFEKLY 76

Query: 75  KSNNLAQASSYIGKNIT--NADGSISGVVNAIQVSSTGLTAITVD 117
               L   SS IG  +T  N D +ISG V  + + +TG+     D
Sbjct: 77  SLQQLGYGSSLIGYGVTLQNGDENISGTVQKVTMDATGVKIWVAD 121


>gi|323490148|ref|ZP_08095368.1| flagellar basal body rod modification protein [Planococcus
           donghaensis MPA1U2]
 gi|323396196|gb|EGA89022.1| flagellar basal body rod modification protein [Planococcus
           donghaensis MPA1U2]
          Length = 143

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 74/121 (61%), Gaps = 6/121 (4%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           +K +    LGQDAFLK+L+TQ+KHQDP EP+K +E + Q+A F+ +EQ   +N T+ + +
Sbjct: 18  TKEEPTNALGQDAFLKILVTQMKHQDPMEPLKDTEFIGQMAQFTSLEQLTNLNKTMTQFV 77

Query: 75  K---SNNLAQASSYIGKNIT--NADGSISGVVNAIQVSSTGLTA-ITVDNTEIPITTGIR 128
               S++LA  +  IG ++   +  GS  G+V A+   +  L A +   +T++PI + I 
Sbjct: 78  SNQGSSSLADYAHLIGTSVKWESETGSGEGMVKALSSKNGELLAELEGSDTKVPIASIIH 137

Query: 129 I 129
           I
Sbjct: 138 I 138


>gi|27381964|ref|NP_773493.1| flagellar basal body rod modification protein [Bradyrhizobium
           japonicum USDA 110]
 gi|27355134|dbj|BAC52118.1| hook formation protein [Bradyrhizobium japonicum USDA 110]
          Length = 140

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 68/106 (64%), Gaps = 3/106 (2%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIG 87
           FL+LL+ ++K+QDPT PM  S+ ++Q A  S +EQ++Q N+ L  LL S +L+QA   IG
Sbjct: 33  FLQLLVAEMKNQDPTNPMDTSQYMSQFAQLSTVEQAMQTNTKLDALLSSQSLSQADGLIG 92

Query: 88  KNI--TNADGS-ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           K +  T+A G+  SG V +I ++S G  A   + T++ +  G+ IS
Sbjct: 93  KTVSFTDATGATFSGKVKSISINSDGSVATLENGTKVAVGPGLTIS 138


>gi|254473493|ref|ZP_05086890.1| flagellar hook capping protein [Pseudovibrio sp. JE062]
 gi|211957609|gb|EEA92812.1| flagellar hook capping protein [Pseudovibrio sp. JE062]
          Length = 152

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 70/112 (62%), Gaps = 4/112 (3%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           L  +AFL L +  +K QDPT+P+  +E + QLA FS +EQS + N+ L  +L+ +++ QA
Sbjct: 29  LDYNAFLMLFMESLKSQDPTDPLDTAEYMGQLAQFSAVEQSTKTNTHLTAMLQQHSINQA 88

Query: 83  SSYIGK--NITNADG--SISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           ++ IG    + NADG  + +GV+ ++Q+ + G  A   D T++ +  GI IS
Sbjct: 89  NNLIGATVEVPNADGTETTTGVIKSVQILTDGSIATLEDGTKVALVPGIEIS 140


>gi|256750747|ref|ZP_05491632.1| flagellar hook capping protein [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|256750330|gb|EEU63349.1| flagellar hook capping protein [Thermoanaerobacter ethanolicus
           CCSD1]
          Length = 131

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 74/130 (56%), Gaps = 14/130 (10%)

Query: 1   MEINTEVNPTQQEFSK-SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           M+INT  N T    ++ + SK  LG+D FLKLL+TQ+K+QDP  PM   E +AQLA FS 
Sbjct: 1   MDINTNYNITTVYTNRVTTSKDQLGKDDFLKLLVTQLKNQDPLNPMDDREFIAQLAQFST 60

Query: 60  MEQSVQMNSTLQELLKSNNLAQASSYIGKN----ITNADGSISGVVNAIQV--SSTGLTA 113
           +EQ   MNS++       N  +A + IGKN    IT+ +G+   V+  + V     G   
Sbjct: 61  LEQMQNMNSSI-------NAIRAINLIGKNIYATITDNNGNSRTVIGKVDVVYKQNGEYF 113

Query: 114 ITVDNTEIPI 123
           + V+  +IP+
Sbjct: 114 LEVNGIDIPL 123


>gi|307264874|ref|ZP_07546436.1| flagellar hook capping protein [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306920132|gb|EFN50344.1| flagellar hook capping protein [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 131

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 76/131 (58%), Gaps = 16/131 (12%)

Query: 1   MEINTEVNPTQQEFSK-SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           M+INT  N T    ++ + SK  LG+D FLKLL+TQ+K+QDP +PM   E +AQLA FS 
Sbjct: 1   MDINTNYNITTVYTNRVTTSKDQLGKDDFLKLLVTQLKNQDPLKPMDDREFIAQLAQFST 60

Query: 60  MEQSVQMNSTLQELLKSNNLAQASSYIGKN----ITNADG---SISGVVNAIQVSSTGLT 112
           +EQ   MNS+        N  +A + IGKN    IT+ +G   +++G V+ +     G  
Sbjct: 61  LEQMQNMNSSF-------NAVRAINLIGKNIYATITDNNGNSRTVTGKVDVV-YKQNGEY 112

Query: 113 AITVDNTEIPI 123
            + V+  ++P+
Sbjct: 113 FLQVNGIDVPV 123


>gi|46579855|ref|YP_010663.1| basal-body rod modification protein FlgD [Desulfovibrio vulgaris
           str. Hildenborough]
 gi|120602679|ref|YP_967079.1| flagellar hook capping protein [Desulfovibrio vulgaris DP4]
 gi|46449271|gb|AAS95922.1| basal-body rod modification protein FlgD [Desulfovibrio vulgaris
           str. Hildenborough]
 gi|120562908|gb|ABM28652.1| flagellar hook capping protein [Desulfovibrio vulgaris DP4]
 gi|311234144|gb|ADP86998.1| flagellar hook capping protein [Desulfovibrio vulgaris RCH1]
          Length = 265

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 62/108 (57%), Gaps = 6/108 (5%)

Query: 3   INTEVNPTQQEFS---KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           +N  +   + EF    K      LG+DAFL+LL+TQ+KHQDP  PM   E VAQLA F+ 
Sbjct: 5   VNNILGQAENEFQSAVKKSGNADLGKDAFLQLLVTQLKHQDPLNPMDDKEFVAQLAQFTS 64

Query: 60  MEQSVQMN---STLQELLKSNNLAQASSYIGKNITNADGSISGVVNAI 104
           +EQ + +N   +++ E  K   +  A SYIGK++  +   IS + + +
Sbjct: 65  LEQLMGINTGVTSMNEAFKQQQMMNAVSYIGKDVLASGDQISKIKDGV 112


>gi|328948414|ref|YP_004365751.1| flagellar hook capping protein [Treponema succinifaciens DSM 2489]
 gi|328448738|gb|AEB14454.1| flagellar hook capping protein [Treponema succinifaciens DSM 2489]
          Length = 149

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/92 (47%), Positives = 60/92 (65%), Gaps = 8/92 (8%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           K ++ LG+D FLKLLITQ+ +QDPT PM+ +E +AQ+A FS +EQ   MN   QE  K N
Sbjct: 35  KVQRDLGKDDFLKLLITQLSNQDPTSPMENTEFIAQMAQFSSLEQMTNMN---QEFAKMN 91

Query: 78  NL---AQASSYIGK--NITNADGSISGVVNAI 104
           ++   +QA   IGK  +IT  D   +GVV A+
Sbjct: 92  SMLVSSQAVGTIGKTVDITLGDTKTTGVVEAV 123


>gi|56964027|ref|YP_175758.1| flagellar basal body rod modification protein [Bacillus clausii
           KSM-K16]
 gi|56910270|dbj|BAD64797.1| flagellar basal-body rod modification protein FlgD [Bacillus
           clausii KSM-K16]
          Length = 144

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 64/102 (62%), Gaps = 6/102 (5%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KSNNL 79
           LGQDAFLKLLITQ+++QDP+ P++  E +AQLA FSQ+EQ  ++NST++ +    KS  L
Sbjct: 24  LGQDAFLKLLITQLQNQDPSNPIEDREFIAQLATFSQLEQLTKLNSTMEYMYYEQKSQQL 83

Query: 80  AQASSYIGKNIT--NADGSIS-GVVNAIQVSSTGLTAITVDN 118
              S  IGK++   N    +    V  ++ S +G   + +D+
Sbjct: 84  MALSELIGKSVEWLNEKEKVEQATVTGVKYSESGDLLVQIDD 125


>gi|326389476|ref|ZP_08211043.1| flagellar hook capping protein [Thermoanaerobacter ethanolicus JW
           200]
 gi|325994481|gb|EGD52906.1| flagellar hook capping protein [Thermoanaerobacter ethanolicus JW
           200]
          Length = 131

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 75/131 (57%), Gaps = 16/131 (12%)

Query: 1   MEINTEVNPTQQEFSK-SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           M+INT  N T    ++ + SK  LG+D FLKLL+TQ+K+QDP  PM   E +AQLA FS 
Sbjct: 1   MDINTNYNITTVYTNRVTTSKDQLGKDDFLKLLVTQLKNQDPLNPMDDREFIAQLAQFST 60

Query: 60  MEQSVQMNSTLQELLKSNNLAQASSYIGKN----ITNADG---SISGVVNAIQVSSTGLT 112
           +EQ   MNS+        N  +A + IGKN    IT+ +G   +++G V+ +     G  
Sbjct: 61  LEQMQNMNSSF-------NAVRAINLIGKNIYATITDNNGNSQTVTGKVDVV-YKQNGEY 112

Query: 113 AITVDNTEIPI 123
            + V+  ++P+
Sbjct: 113 FLQVNGIDVPV 123


>gi|269836574|ref|YP_003318802.1| flagellar hook capping protein [Sphaerobacter thermophilus DSM
           20745]
 gi|269785837|gb|ACZ37980.1| flagellar hook capping protein [Sphaerobacter thermophilus DSM
           20745]
          Length = 150

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 64/105 (60%), Gaps = 5/105 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           LG+  FL LL  Q+++QDP  PM+ +E +AQLA  + +EQ  QMN TL  L++ + LAQ 
Sbjct: 28  LGKQEFLMLLTAQLRNQDPLRPMEDTEFIAQLAQLNSLEQMQQMNETLSTLVEMSVLAQT 87

Query: 83  SSYIGKNITNAD----GSISGVVNAIQVSSTGLTAITVDNTEIPI 123
           +S IG+++T  D    G I GVV+ + +   G   + V  T +P+
Sbjct: 88  ASLIGRHVTALDPSGGGVIKGVVSDVTIHE-GTPVLNVGGTAVPL 131


>gi|317129202|ref|YP_004095484.1| flagellar hook capping protein [Bacillus cellulosilyticus DSM 2522]
 gi|315474150|gb|ADU30753.1| flagellar hook capping protein [Bacillus cellulosilyticus DSM 2522]
          Length = 149

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 72/127 (56%), Gaps = 14/127 (11%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK 75
           K+++   L +DAFL++LITQ+++QDP  PM+  E +AQ+A F+ +EQ   MN+ LQ+ L 
Sbjct: 19  KARNTGDLDKDAFLRILITQLQNQDPLNPMEDKEFIAQMAQFTSLEQMTNMNTNLQKFLD 78

Query: 76  S--NNLAQASSYIGKNI------TNADGS-----ISGVVNAIQVSSTGLTAITVDNTEIP 122
           S  N     S  IGK +       N DGS     + GVV +++  + G  ++ +D+    
Sbjct: 79  SHQNQFVSHSELIGKEVQWERERVNEDGSKRMEVVEGVVTSVKFQN-GSASLVIDDQHTV 137

Query: 123 ITTGIRI 129
            T  I++
Sbjct: 138 STKDIQV 144


>gi|332298238|ref|YP_004440160.1| flagellar hook capping protein [Treponema brennaborense DSM 12168]
 gi|332181341|gb|AEE17029.1| flagellar hook capping protein [Treponema brennaborense DSM 12168]
          Length = 146

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 58/84 (69%), Gaps = 2/84 (2%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           LG+D FLKLL+TQ+ +QDPT PM+ +E +AQ+A FS +EQ   M+S   +L    N  +A
Sbjct: 37  LGKDDFLKLLLTQLSNQDPTSPMENTEFIAQMAQFSSLEQMTNMSSEFTKLANMLNSNEA 96

Query: 83  SSYIGKNI-TNA-DGSISGVVNAI 104
            S +GKN+  NA D ++SGVV ++
Sbjct: 97  VSLLGKNVELNAGDAAVSGVVESV 120


>gi|315186382|gb|EFU20142.1| flagellar hook capping protein [Spirochaeta thermophila DSM 6578]
          Length = 145

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 55/88 (62%), Gaps = 2/88 (2%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K+ LG+D FLKLL+ Q+ HQDPT+P++  E +AQ+A FS +EQ   M+    +L      
Sbjct: 33  KQELGKDDFLKLLVAQLTHQDPTQPLEDKEFIAQMAQFSTLEQMTNMSQEFSKLALRLQS 92

Query: 80  AQASSYIGKN--ITNADGSISGVVNAIQ 105
           +QA S +GK   I N D  ISGVV  ++
Sbjct: 93  SQAFSLLGKTVVIKNGDEEISGVVEEVR 120


>gi|309388824|gb|ADO76704.1| flagellar hook capping protein [Halanaerobium praevalens DSM 2228]
          Length = 168

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 64/106 (60%), Gaps = 5/106 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           LGQDAF KLLITQ+++QDP  PM+  E V+Q+A FS +E++ ++ S L++ L SN +   
Sbjct: 36  LGQDAFFKLLITQLQNQDPLNPMEDREFVSQMAEFSSLEKTEKLYSLLEDKLSSNQVINN 95

Query: 83  SSYIGKNIT-NADG----SISGVVNAIQVSSTGLTAITVDNTEIPI 123
           S  IGK IT N D      + GVV +I+     + A   +  E+ I
Sbjct: 96  SHLIGKEITANVDEGNSTGVKGVVESIKSQGDQIFAALDNGLEVDI 141


>gi|15639715|ref|NP_219165.1| flagellar basal body rod modification protein [Treponema pallidum
           subsp. pallidum str. Nichols]
 gi|189025953|ref|YP_001933725.1| flagellar basal body rod modification protein [Treponema pallidum
           subsp. pallidum SS14]
 gi|2196902|gb|AAB61259.1| FlgD [Treponema pallidum]
 gi|3323034|gb|AAC65697.1| flagellar hook assembly scaffolding protein (flgD) [Treponema
           pallidum subsp. pallidum str. Nichols]
 gi|189018528|gb|ACD71146.1| flagellar hook assembly scaffolding protein [Treponema pallidum
           subsp. pallidum SS14]
 gi|291060092|gb|ADD72827.1| flagellar hook capping protein [Treponema pallidum subsp. pallidum
           str. Chicago]
          Length = 153

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 65/106 (61%), Gaps = 2/106 (1%)

Query: 1   MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
           +E++  V   Q E     +K+ LG+D FL LLI Q+ HQDPT PM+ ++ +AQ+A FS +
Sbjct: 19  LEMDVRVINKQLEAGARSAKRELGKDDFLHLLIAQLTHQDPTAPMQDTQFIAQMAQFSSL 78

Query: 61  EQSVQMNSTLQELLKSNNLAQASSYIGK--NITNADGSISGVVNAI 104
           EQ   M++ +++L       +A   +GK   +T AD ++ G+++A+
Sbjct: 79  EQMANMSAQVEKLGTLFGNTEALQAVGKMVEVTEADNTVRGLISAV 124


>gi|303326941|ref|ZP_07357383.1| basal-body rod modification protein FlgD [Desulfovibrio sp.
           3_1_syn3]
 gi|302862929|gb|EFL85861.1| basal-body rod modification protein FlgD [Desulfovibrio sp.
           3_1_syn3]
          Length = 282

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 67/104 (64%), Gaps = 13/104 (12%)

Query: 7   VNPTQQEFSKSKSKK---TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           +N T  EF+ + SK+    + +D+F+ LL+TQ K+QDP  PM+  E +AQLA FS +EQ 
Sbjct: 8   LNQTNNEFNSALSKQKGSNMDKDSFMLLLVTQFKYQDPLNPMEDKEFIAQLAQFSSLEQL 67

Query: 64  VQMNSTLQELLKSNN---LAQASSYIGKNITNADGSISGVVNAI 104
           + +N++++ L  + N   +  A+SYIGKN+     S+SG  NAI
Sbjct: 68  MNLNTSMEGLTDATNNQQMINATSYIGKNV-----SVSG--NAI 104


>gi|206889592|ref|YP_002248122.1| flagellar hook capping protein [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206741530|gb|ACI20587.1| flagellar hook capping protein [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 137

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 59/95 (62%), Gaps = 6/95 (6%)

Query: 8   NP--TQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQ 65
           NP  T QE + +     + ++AFLKLL  Q+K+QDP  PM  +E V QLA+FS +EQ + 
Sbjct: 10  NPLYTVQEKTTATGNSQIDKEAFLKLLTAQLKYQDPLNPMDNTEFVGQLAMFSALEQVIN 69

Query: 66  MNSTLQEL----LKSNNLAQASSYIGKNITNADGS 96
           +N+TL++L    + SN L   S+ IGK I   DG+
Sbjct: 70  INNTLEQLANSQVYSNALMIGSTIIGKTIVTTDGT 104


>gi|220904529|ref|YP_002479841.1| flagellar hook capping protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219868828|gb|ACL49163.1| flagellar hook capping protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 284

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 67/109 (61%), Gaps = 6/109 (5%)

Query: 7   VNPTQQEFSKSKSKK---TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           +N T  EF+ + SK+    L +D+F+ LL+TQ K+QDP  PM+  E +AQ+A FS +EQ 
Sbjct: 8   LNRTNNEFNTALSKQKGSNLDKDSFMLLLVTQFKYQDPLNPMEDKEFIAQMAQFSSLEQL 67

Query: 64  VQMNSTLQELLKSNN---LAQASSYIGKNITNADGSISGVVNAIQVSST 109
           + +N++++ L  + N   +  A+SYIGK +T +  +I  V +     ST
Sbjct: 68  MNLNTSMEGLTNATNNQQMINATSYIGKQVTVSGNTIGKVTDETTKEST 116


>gi|167037662|ref|YP_001665240.1| flagellar hook capping protein [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|167040323|ref|YP_001663308.1| flagellar hook capping protein [Thermoanaerobacter sp. X514]
 gi|300914407|ref|ZP_07131723.1| flagellar hook capping protein [Thermoanaerobacter sp. X561]
 gi|307724357|ref|YP_003904108.1| flagellar hook capping protein [Thermoanaerobacter sp. X513]
 gi|320116077|ref|YP_004186236.1| flagellar hook capping protein [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|166854563|gb|ABY92972.1| flagellar hook capping protein [Thermoanaerobacter sp. X514]
 gi|166856496|gb|ABY94904.1| flagellar hook capping protein [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|300889342|gb|EFK84488.1| flagellar hook capping protein [Thermoanaerobacter sp. X561]
 gi|307581418|gb|ADN54817.1| flagellar hook capping protein [Thermoanaerobacter sp. X513]
 gi|319929168|gb|ADV79853.1| flagellar hook capping protein [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
          Length = 131

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 72/130 (55%), Gaps = 14/130 (10%)

Query: 1   MEINTEVNPTQQEFSK-SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           M+INT  N T    ++ S     LG+D FLKLL+TQ+K+QDP  PM   E +AQLA FS 
Sbjct: 1   MDINTNYNVTSIYNNRVSTLNSQLGKDDFLKLLVTQLKNQDPLNPMDDREFIAQLAQFST 60

Query: 60  MEQSVQMNSTLQELLKSNNLAQASSYIGKN----ITNADGSISGVVNAIQV--SSTGLTA 113
           +EQ   MNS++       N  +A + IGKN    IT+ +G+   V+  + V     G   
Sbjct: 61  LEQMQNMNSSI-------NAIRAINLIGKNIYATITDNNGNSRTVIGKVDVVYKQNGEYF 113

Query: 114 ITVDNTEIPI 123
           + V+  +IP+
Sbjct: 114 LEVNGIDIPL 123


>gi|269792938|ref|YP_003317842.1| flagellar hook capping protein [Thermanaerovibrio acidaminovorans
           DSM 6589]
 gi|269100573|gb|ACZ19560.1| flagellar hook capping protein [Thermanaerovibrio acidaminovorans
           DSM 6589]
          Length = 134

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 69/127 (54%), Gaps = 9/127 (7%)

Query: 5   TEVNPTQQEFSKSKS-----KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
            EVN   Q  S  +      KK LG+D FLK+LI Q+ HQDP +P+K  + +AQ+A FS 
Sbjct: 2   AEVNGVTQAASGGQEATRAVKKELGKDDFLKILIAQLTHQDPLDPLKDRDFIAQMAQFSA 61

Query: 60  MEQSVQMNSTLQELLKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLTAITV 116
           +EQ + +   ++ L K  ++A A +Y+G+ +   D      +GVV  +++    +T    
Sbjct: 62  LEQQMNIAKGIEGLSKL-SMASAVNYVGRTVGYTDDQGQEAAGVVKFVEMKDGSVTLHLA 120

Query: 117 DNTEIPI 123
           D   IP+
Sbjct: 121 DGNSIPM 127


>gi|329929292|ref|ZP_08283045.1| flagellar hook capping protein [Paenibacillus sp. HGF5]
 gi|328936661|gb|EGG33104.1| flagellar hook capping protein [Paenibacillus sp. HGF5]
          Length = 186

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 76/125 (60%), Gaps = 11/125 (8%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           +K+ + + LG+D FL +LITQ++HQDP +PM+  E +AQ+A F+ +EQ + +N+ L  + 
Sbjct: 22  TKNGNGQELGKDQFLSILITQLRHQDPLQPMQDREFIAQMAQFTSLEQLMNINTQLTAM- 80

Query: 75  KSNNLAQASSYIGKNIT----NADGSI----SGVVNAIQVSSTGLTAITVDNTEIPITTG 126
            S +L  ASS IGK I+      DGS     SG+V++I V   G+    V  +E+ +   
Sbjct: 81  -SQSLGAASSLIGKQISWMFKPEDGSDSVMKSGLVDSIIVRE-GVHYAKVGESEVSLDQI 138

Query: 127 IRISN 131
           ++I N
Sbjct: 139 VKIEN 143


>gi|302392389|ref|YP_003828209.1| flagellar hook capping protein [Acetohalobium arabaticum DSM 5501]
 gi|302204466|gb|ADL13144.1| flagellar hook capping protein [Acetohalobium arabaticum DSM 5501]
          Length = 138

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 55/92 (59%), Gaps = 4/92 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           +G+D FL+L +TQ+K+Q+P EPM   E +AQ A F+ MEQ   MN  L++ L    L Q 
Sbjct: 27  MGKDEFLELFVTQLKNQNPLEPMDNKEFIAQTAQFTSMEQMKNMNQNLEKFLGMQKLTQV 86

Query: 83  SSYIGKNITNADGS----ISGVVNAIQVSSTG 110
           SS IGK +   D      I+G V  ++++ +G
Sbjct: 87  SSLIGKEVKALDSDSGEEITGEVEKVKMADSG 118


>gi|312126826|ref|YP_003991700.1| flagellar hook capping protein [Caldicellulosiruptor hydrothermalis
           108]
 gi|311776845|gb|ADQ06331.1| flagellar hook capping protein [Caldicellulosiruptor hydrothermalis
           108]
          Length = 164

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 73/123 (59%), Gaps = 13/123 (10%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           NT V+ + Q  + S +K  LG+  FL LL+TQ+++QDP +PM+  E VAQLA FS +EQ 
Sbjct: 9   NTNVSNSTQSLAASSAKNVLGKQEFLNLLVTQLRYQDPLKPMEDKEFVAQLAQFSALEQM 68

Query: 64  VQMNSTLQELLKSNNLAQASSYIGKNIT-----NADGSISGVVNAIQVSSTGLTAITVDN 118
             +N ++ ELLK      A S IG+ +      +A   I G V++I++  + +  + V+ 
Sbjct: 69  QNLNESV-ELLK------AQSMIGRYVVATSPQDASKLIEGRVDSIKIDGSKVY-LKVNG 120

Query: 119 TEI 121
           TE+
Sbjct: 121 TEV 123


>gi|261407977|ref|YP_003244218.1| flagellar hook capping protein [Paenibacillus sp. Y412MC10]
 gi|261284440|gb|ACX66411.1| flagellar hook capping protein [Paenibacillus sp. Y412MC10]
          Length = 186

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 75/125 (60%), Gaps = 11/125 (8%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           +K+ + + LG+D FL +LITQ++HQDP +PM+  E +AQ+A F+ +EQ + +N+ L  + 
Sbjct: 22  TKNGNGQELGKDQFLSILITQLRHQDPLQPMQDREFIAQMAQFTSLEQLMNINTQLTAM- 80

Query: 75  KSNNLAQASSYIGKNIT----NADGSI----SGVVNAIQVSSTGLTAITVDNTEIPITTG 126
            S +L  ASS IGK I+      DGS     SG+V++I V   G+    V   E+ +   
Sbjct: 81  -SQSLGAASSLIGKQISWMFKPEDGSDSVMKSGLVDSIIVRD-GVHYAKVGENEVSLDQI 138

Query: 127 IRISN 131
           ++I N
Sbjct: 139 VKIEN 143


>gi|315648131|ref|ZP_07901232.1| flagellar hook capping protein [Paenibacillus vortex V453]
 gi|315276777|gb|EFU40120.1| flagellar hook capping protein [Paenibacillus vortex V453]
          Length = 188

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 75/125 (60%), Gaps = 12/125 (9%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK 75
           K+ + + LG+D FL +LITQ++HQDP +PM+  E +AQ+A F+ +EQ + +N+ L  +  
Sbjct: 23  KNGNGQELGKDQFLSILITQLRHQDPLQPMQDREFIAQMAQFTSLEQLMNINTQLTAM-- 80

Query: 76  SNNLAQASSYIGKNIT----NADGS-----ISGVVNAIQVSSTGLTAITVDNTEIPITTG 126
           S +L  ASS IGK I+      DGS      SG+V++I V   G+    +  +E+ +   
Sbjct: 81  SQSLGAASSLIGKQISWMFKPEDGSENTVMKSGIVDSIIVRD-GIHYAKIGESEVALDQI 139

Query: 127 IRISN 131
           ++I N
Sbjct: 140 LKIEN 144


>gi|312876504|ref|ZP_07736487.1| flagellar hook capping protein [Caldicellulosiruptor lactoaceticus
           6A]
 gi|311796715|gb|EFR13061.1| flagellar hook capping protein [Caldicellulosiruptor lactoaceticus
           6A]
          Length = 164

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 72/122 (59%), Gaps = 13/122 (10%)

Query: 5   TEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSV 64
           T V  + Q  + S +K  LG+  FL LL+TQ+++QDP +PM+  E VAQLA FS +EQ  
Sbjct: 10  TNVPSSTQGLATSSTKNVLGKQEFLNLLVTQLRYQDPLKPMEDKEFVAQLAQFSALEQMQ 69

Query: 65  QMNSTLQELLKSNNLAQASSYIGKNI--TNADGS---ISGVVNAIQVSSTGLTAITVDNT 119
            +N +  ELLK+ N+      IG+ I  TN   S   I G V +++V  + +  + V+NT
Sbjct: 70  NLNESF-ELLKAQNM------IGRYIVATNPQDSSKQIEGRVESVKVDGSKVY-LKVNNT 121

Query: 120 EI 121
           EI
Sbjct: 122 EI 123


>gi|242280468|ref|YP_002992597.1| flagellar hook capping protein [Desulfovibrio salexigens DSM 2638]
 gi|242123362|gb|ACS81058.1| flagellar hook capping protein [Desulfovibrio salexigens DSM 2638]
          Length = 242

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 3/84 (3%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           K K  LGQD FLKLL+TQ+++QDP  PM+  E +AQ+A FS +EQ  Q+NS ++ ++ +N
Sbjct: 24  KHKNQLGQDDFLKLLLTQMQNQDPANPMEDKEYMAQMAQFSSLEQLTQVNSNIKTMIDNN 83

Query: 78  ---NLAQASSYIGKNITNADGSIS 98
               +  A  +IGK +     SIS
Sbjct: 84  AQDQMVSAVGFIGKEVKAEGYSIS 107


>gi|308273520|emb|CBX30122.1| hypothetical protein N47_D29310 [uncultured Desulfobacterium sp.]
          Length = 113

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 59/107 (55%), Gaps = 14/107 (13%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL------LKS 76
           +G+D FL LL+TQ+K+QDP  PM+  E  AQLA FS +EQ   MN+TL  +       K 
Sbjct: 1   MGKDEFLNLLVTQLKYQDPLNPMEGQEFSAQLAQFSSLEQLTNMNTTLTGIKDSVGEKKQ 60

Query: 77  NNLAQASSYIGKNITNAD---GSISGVV--NAIQVSSTGLTAITVDN 118
           +NL     YIGKNI  +D   G ++GV   N I     G   I  DN
Sbjct: 61  DNLL---DYIGKNIKTSDDETGEVTGVTYQNGIGYLMVGENKILPDN 104


>gi|91204390|emb|CAJ70890.1| similar to flagellar hook assembly protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 137

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 64/115 (55%), Gaps = 11/115 (9%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL-------LKSNN 78
           D+FL L  TQ+++QDP +P   SE ++QLA F+ +EQ+ Q    L +L       L+ + 
Sbjct: 16  DSFLTLFTTQMRYQDPLDPQDNSEFLSQLAQFTTLEQTSQQTEYLADLSSLDTASLQLDQ 75

Query: 79  LAQASSYIGKNITNAD----GSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
           +  AS +IGK IT +D    G  SGVV  +++   G  +  +D   + I+  I++
Sbjct: 76  IGIASGFIGKTITYSDDDGEGEYSGVVEGVKLEEDGTVSFVIDGESVSISNFIQV 130


>gi|320538207|ref|ZP_08038102.1| flagellar hook capping protein [Treponema phagedenis F0421]
 gi|2196891|gb|AAB61250.1| FlgD [Treponema phagedenis]
 gi|320145024|gb|EFW36745.1| flagellar hook capping protein [Treponema phagedenis F0421]
          Length = 163

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 65/108 (60%), Gaps = 8/108 (7%)

Query: 1   MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
           +E++      Q E    K K+ LG++ FL+LLI Q+ HQDPT PM+ ++ VAQ+A F+ +
Sbjct: 26  LELDVNAFNKQIEIDGRKPKQELGKNDFLQLLIAQLSHQDPTAPMEDTQFVAQMAQFTSL 85

Query: 61  EQSVQMNSTLQELLKSNNL---AQASSYIGKNITNADGSI--SGVVNA 103
           E   QM +  Q   K NNL   ++A + +GK +   DGSI  SGV+ A
Sbjct: 86  E---QMTNVSQSFEKLNNLLSGSEAVNAVGKQVNIEDGSIKVSGVITA 130


>gi|297617145|ref|YP_003702304.1| flagellar hook capping protein [Syntrophothermus lipocalidus DSM
           12680]
 gi|297144982|gb|ADI01739.1| flagellar hook capping protein [Syntrophothermus lipocalidus DSM
           12680]
          Length = 171

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 66/114 (57%), Gaps = 14/114 (12%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL--------- 73
           LG+D F KLLIT++K+QDP EPMK  E +AQ+A FS +EQ   MN+ LQ L         
Sbjct: 24  LGKDDFFKLLITELKYQDPLEPMKDREFIAQMASFSSLEQMYNMNTNLQSLSTALNSYVS 83

Query: 74  -LKSN-NLAQASSYIGKNI--TNADGSISGVVNAIQVSSTGLTAITVDNTEIPI 123
            L SN +  +A + +G+ I    A G+  G V +I V   G+  +TV+  ++ +
Sbjct: 84  TLSSNLSWQEALALLGQEIEFETAAGTACGRVESI-VLKDGVPYLTVNGEQVSL 136


>gi|289523566|ref|ZP_06440420.1| flagellar hook capping protein [Anaerobaculum hydrogeniformans
          ATCC BAA-1850]
 gi|289503258|gb|EFD24422.1| flagellar hook capping protein [Anaerobaculum hydrogeniformans
          ATCC BAA-1850]
          Length = 142

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 52/88 (59%), Gaps = 1/88 (1%)

Query: 7  VNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQM 66
          VN +     K + K  LG+D FLKLLITQ+ HQDP EP+  +E +AQ+A FS +EQ   +
Sbjct: 9  VNQSYYNEGKREIKNELGKDDFLKLLITQLTHQDPLEPVSDTEFIAQMAQFSTLEQMTNV 68

Query: 67 NSTLQELLKSNNLAQASSYIGKNITNAD 94
             ++ LL    L  A SYIGK +   D
Sbjct: 69 AKGVESLLSVTKL-NAQSYIGKEVIYYD 95


>gi|307718605|ref|YP_003874137.1| flagellar hook assembly protein [Spirochaeta thermophila DSM 6192]
 gi|306532330|gb|ADN01864.1| flagellar hook assembly protein [Spirochaeta thermophila DSM 6192]
          Length = 145

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 2/88 (2%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K+ LG+D FLKLL+ Q+ HQDPT+P++  E +AQ+A FS +EQ   M+    +L      
Sbjct: 33  KQELGKDDFLKLLVAQLTHQDPTQPLEDKEFIAQMAQFSTLEQMTNMSQEFSKLALRLQS 92

Query: 80  AQASSYIGKN--ITNADGSISGVVNAIQ 105
           +QA S +GK   I N    ISGVV  ++
Sbjct: 93  SQAFSLLGKTVVIKNGGQEISGVVEEVR 120


>gi|134300241|ref|YP_001113737.1| flagellar hook capping protein [Desulfotomaculum reducens MI-1]
 gi|134052941|gb|ABO50912.1| flagellar hook capping protein [Desulfotomaculum reducens MI-1]
          Length = 185

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 60/93 (64%), Gaps = 4/93 (4%)

Query: 1  MEINTEVNPTQQEFSKSKSK---KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVF 57
          ME+N + N +   +   K+K   KTL +DAFL+++I Q+++QDP+ PM +S+ + Q+A+F
Sbjct: 1  MEVN-QTNNSDLYYENRKTKESVKTLDKDAFLQIMIAQLRYQDPSSPMDSSKFIEQMAMF 59

Query: 58 SQMEQSVQMNSTLQELLKSNNLAQASSYIGKNI 90
          + +EQ   +N+ ++ L     L  ASS IGK +
Sbjct: 60 TTLEQMTNLNTNMERLYHLQELNHASSLIGKRV 92


>gi|319649560|ref|ZP_08003716.1| flagellar basal body rod modification protein D [Bacillus sp.
          2_A_57_CT2]
 gi|317398722|gb|EFV79404.1| flagellar basal body rod modification protein D [Bacillus sp.
          2_A_57_CT2]
          Length = 150

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 59/83 (71%), Gaps = 7/83 (8%)

Query: 16 KSKSKKT----LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          +S+++KT    LG+D FLK+L+TQ+++QDP  PM+  + +AQ+A FS +EQ   MN T++
Sbjct: 15 QSQTRKTGSDILGKDDFLKILMTQLQNQDPMNPMQDKDFIAQMATFSSLEQMTNMNKTME 74

Query: 72 ELL---KSNNLAQASSYIGKNIT 91
          +L+   + N L   ++++GKN+T
Sbjct: 75 KLVAFQEQNQLMTYNNFLGKNVT 97


>gi|94987009|ref|YP_594942.1| flagellar hook capping protein [Lawsonia intracellularis
          PHE/MN1-00]
 gi|94731258|emb|CAJ54621.1| Flagellar hook capping protein [Lawsonia intracellularis
          PHE/MN1-00]
          Length = 279

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 50/80 (62%), Gaps = 3/80 (3%)

Query: 14 FSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          FS+   K  LG++ FLKLL+TQ K+QDP  PM+  E +AQLA FS +EQ +  N  ++ L
Sbjct: 16 FSQQAGKSELGKEDFLKLLVTQFKYQDPLNPMEDKEFIAQLAQFSALEQQMSTNEKMESL 75

Query: 74 LK---SNNLAQASSYIGKNI 90
          L       +  A+S+IGK +
Sbjct: 76 LNLQTQQQMISAASFIGKEV 95


>gi|317154734|ref|YP_004122782.1| flagellar hook capping protein [Desulfovibrio aespoeensis Aspo-2]
 gi|316944985|gb|ADU64036.1| flagellar hook capping protein [Desulfovibrio aespoeensis Aspo-2]
          Length = 247

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LK 75
           SK +LGQ  FL LL+ Q+ HQDP  PM+ ++  +QLA FS +EQ  ++N  +Q L   + 
Sbjct: 26  SKASLGQADFLTLLVAQLTHQDPLNPMQDTDMTSQLAQFSSLEQLTKINDGVQSLNTVMG 85

Query: 76  SNNLAQASSYIGKNI 90
            ++L  A+SYIGK+I
Sbjct: 86  KSDLLSAASYIGKDI 100


>gi|15615014|ref|NP_243317.1| flagellar basal body rod modification protein [Bacillus
          halodurans C-125]
 gi|10175071|dbj|BAB06170.1| flagellar hook assembly protein [Bacillus halodurans C-125]
          Length = 171

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 3/72 (4%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK---SNNL 79
          LG+D FL++LI Q+++QDP  PM   E +AQ+A FS +EQ   MNS +Q+ +K   S  L
Sbjct: 26 LGKDDFLRILIAQLQYQDPLNPMDDREFIAQMAQFSSLEQMTNMNSAIQQFVKQQTSQTL 85

Query: 80 AQASSYIGKNIT 91
           Q S  IGK +T
Sbjct: 86 VQHSELIGKRVT 97


>gi|224534247|ref|ZP_03674825.1| flagellar hook capping protein [Borrelia spielmanii A14S]
 gi|224514349|gb|EEF84665.1| flagellar hook capping protein [Borrelia spielmanii A14S]
          Length = 147

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/93 (41%), Positives = 58/93 (62%), Gaps = 3/93 (3%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           +K  LG+D FLKLLITQ+++QDPT PMK  E +AQ+A FS +EQ   M+ + ++L  S  
Sbjct: 32  NKVNLGKDDFLKLLITQLRYQDPTNPMKDKEFIAQMAQFSALEQMANMSKSFEKLSSSLE 91

Query: 79  LAQASSYIGKNIT--NADGSI-SGVVNAIQVSS 108
           + +    +GK I   + DG I  G V +I+  +
Sbjct: 92  IRKDLDLLGKVIKFQHGDGEIVKGRVTSIKTGA 124


>gi|111115109|ref|YP_709727.1| flagellar basal body rod modification protein [Borrelia afzelii
           PKo]
 gi|110890383|gb|ABH01551.1| flagellar hook assembly protein [Borrelia afzelii PKo]
          Length = 147

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 57/90 (63%), Gaps = 3/90 (3%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           +K  LG+D FLKLLITQ+++QDPT PMK  E +AQ+A FS +EQ   M+ + ++L  S  
Sbjct: 32  NKVNLGKDDFLKLLITQLRYQDPTNPMKDKEFIAQMAQFSALEQMANMSKSFEKLSSSLE 91

Query: 79  LAQASSYIGKNIT--NADGSI-SGVVNAIQ 105
           + +    +GK I   + DG I  G V +I+
Sbjct: 92  IRKDLDLLGKVIKFQHGDGEIVEGRVTSIK 121


>gi|78043304|ref|YP_359846.1| flagellar hook assembly protein [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77995419|gb|ABB14318.1| flagellar hook assembly protein [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 135

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 60/96 (62%), Gaps = 3/96 (3%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           + S++K  L +DAFLK+ + Q+++QDP  P   +E +A+LA F  +EQ   +   L +LL
Sbjct: 18  AASQTKLNLDKDAFLKIFLAQLQYQDPLNPADGTEFIAELAQFGMLEQLTNLTDALTKLL 77

Query: 75  KSNNLAQASSYIGKNI---TNADGSISGVVNAIQVS 107
           +    AQA++ IGK +   T A+  + GVV+A++ S
Sbjct: 78  QFEQKAQAAALIGKTVKIATAAETLVEGVVSAVRWS 113


>gi|216264944|ref|ZP_03436936.1| flagellar hook capping protein [Borrelia burgdorferi 156a]
 gi|224533148|ref|ZP_03673748.1| flagellar hook capping protein [Borrelia burgdorferi WI91-23]
 gi|215981417|gb|EEC22224.1| flagellar hook capping protein [Borrelia burgdorferi 156a]
 gi|224511875|gb|EEF82276.1| flagellar hook capping protein [Borrelia burgdorferi WI91-23]
 gi|312148217|gb|ADQ30876.1| flagellar hook capping protein [Borrelia burgdorferi JD1]
 gi|312149592|gb|ADQ29663.1| flagellar hook capping protein [Borrelia burgdorferi N40]
          Length = 147

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 2/81 (2%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           +K  LG+D FLKLLITQ+++QDPT PMK  E +AQ+A FS +EQ   M+ + ++L  S  
Sbjct: 32  NKVNLGKDDFLKLLITQLRYQDPTNPMKDKEFIAQMAQFSALEQMANMSRSFEKLSSSLE 91

Query: 79  LAQASSYIGKNIT--NADGSI 97
           + +    +GK I   + DG I
Sbjct: 92  IRKDLDLLGKVIKFQHGDGEI 112


>gi|224531754|ref|ZP_03672386.1| flagellar hook capping protein [Borrelia valaisiana VS116]
 gi|224511219|gb|EEF81625.1| flagellar hook capping protein [Borrelia valaisiana VS116]
          Length = 147

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 2/81 (2%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           +K  LG+D FLKLLITQ+++QDPT PMK  E +AQ+A FS +EQ   M+ + ++L  S  
Sbjct: 32  NKVNLGKDDFLKLLITQLRYQDPTNPMKDKEFIAQMAQFSSLEQMANMSKSFEKLSSSLE 91

Query: 79  LAQASSYIGKNIT--NADGSI 97
           + +    +GK I   + DG I
Sbjct: 92  IRKDLDLLGKVIKFQHGDGEI 112


>gi|15594629|ref|NP_212418.1| flagellar basal body rod modification protein [Borrelia burgdorferi
           B31]
 gi|195941362|ref|ZP_03086744.1| flagellar basal body rod modification protein [Borrelia burgdorferi
           80a]
 gi|218249522|ref|YP_002374807.1| flagellar hook capping protein [Borrelia burgdorferi ZS7]
 gi|221217794|ref|ZP_03589262.1| flagellar hook capping protein [Borrelia burgdorferi 72a]
 gi|223888939|ref|ZP_03623530.1| flagellar hook capping protein [Borrelia burgdorferi 64b]
 gi|224533832|ref|ZP_03674420.1| flagellar hook capping protein [Borrelia burgdorferi CA-11.2a]
 gi|225549019|ref|ZP_03769994.1| flagellar hook capping protein [Borrelia burgdorferi 94a]
 gi|225550075|ref|ZP_03771035.1| flagellar hook capping protein [Borrelia burgdorferi 118a]
 gi|226320585|ref|ZP_03796145.1| flagellar hook capping protein [Borrelia burgdorferi 29805]
 gi|226321602|ref|ZP_03797128.1| flagellar hook capping protein [Borrelia burgdorferi Bol26]
 gi|1165268|gb|AAA85607.1| YlxG [Borrelia burgdorferi]
 gi|1196325|gb|AAB51417.1| flagellar hook assembly protein [Borrelia burgdorferi]
 gi|2688182|gb|AAC66664.1| flagellar hook assembly protein (flgD) [Borrelia burgdorferi B31]
 gi|218164710|gb|ACK74771.1| flagellar hook capping protein [Borrelia burgdorferi ZS7]
 gi|221192471|gb|EEE18690.1| flagellar hook capping protein [Borrelia burgdorferi 72a]
 gi|223885755|gb|EEF56854.1| flagellar hook capping protein [Borrelia burgdorferi 64b]
 gi|224513125|gb|EEF83488.1| flagellar hook capping protein [Borrelia burgdorferi CA-11.2a]
 gi|225369187|gb|EEG98640.1| flagellar hook capping protein [Borrelia burgdorferi 118a]
 gi|225370245|gb|EEG99683.1| flagellar hook capping protein [Borrelia burgdorferi 94a]
 gi|226232791|gb|EEH31544.1| flagellar hook capping protein [Borrelia burgdorferi Bol26]
 gi|226234004|gb|EEH32725.1| flagellar hook capping protein [Borrelia burgdorferi 29805]
          Length = 147

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 2/81 (2%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           +K  LG+D FLKLLITQ+++QDPT PMK  E +AQ+A FS +EQ   M+ + ++L  S  
Sbjct: 32  NKVNLGKDDFLKLLITQLRYQDPTNPMKDKEFIAQMAQFSALEQMANMSRSFEKLSSSLE 91

Query: 79  LAQASSYIGKNIT--NADGSI 97
           + +    +GK I   + DG I
Sbjct: 92  IRKDLDLLGKVIKFQHGDGEI 112


>gi|288553058|ref|YP_003424993.1| flagellar basal body rod modification protein [Bacillus
          pseudofirmus OF4]
 gi|288544218|gb|ADC48101.1| flagellar basal body rod modification protein [Bacillus
          pseudofirmus OF4]
          Length = 169

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK---SNNL 79
          LG+D FLKLLITQ+++QDP+ PM   E +AQ+A FS +EQ   MN+T+Q+ +    S +L
Sbjct: 25 LGKDDFLKLLITQLQNQDPSNPMDDREFIAQMAQFSSLEQMTNMNNTIQKFVDVQTSQSL 84

Query: 80 AQASSYIGKNI 90
           Q S  IGK +
Sbjct: 85 VQFSELIGKEV 95


>gi|225552001|ref|ZP_03772941.1| flagellar hook capping protein [Borrelia sp. SV1]
 gi|225370999|gb|EEH00429.1| flagellar hook capping protein [Borrelia sp. SV1]
          Length = 147

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 2/81 (2%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           +K  LG+D FLKLLITQ+++QDPT PMK  E +AQ+A FS +EQ   M+ + ++L  S  
Sbjct: 32  NKVNLGKDDFLKLLITQLRYQDPTNPMKDKEFIAQMAQFSALEQMANMSRSFEKLSSSLE 91

Query: 79  LAQASSYIGKNIT--NADGSI 97
           + +    +GK I   + DG I
Sbjct: 92  IRKDLDLLGKVIKFQHGDGEI 112


>gi|257457612|ref|ZP_05622779.1| flagellar hook capping protein [Treponema vincentii ATCC 35580]
 gi|257444998|gb|EEV20074.1| flagellar hook capping protein [Treponema vincentii ATCC 35580]
          Length = 159

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 67/106 (63%), Gaps = 6/106 (5%)

Query: 1   MEINTEVNPTQQEFSKS-KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           ME++T +N  +Q F +  K K+ LG+D FL+LL+ Q+ HQDPT PM+ ++ VAQ+A F+ 
Sbjct: 29  MEVDT-IN--KQNFPEGRKPKQELGKDDFLQLLVAQLTHQDPTSPMEDTQFVAQMAQFTS 85

Query: 60  MEQSVQMNSTLQELLKSNNLAQASSYIGK--NITNADGSISGVVNA 103
           +EQ   MN +   L +    + A + +GK  +I  + G++SG + A
Sbjct: 86  LEQLTNMNQSFGTLNRLIGDSSAVNVVGKQVDIEQSGGTVSGTITA 131


>gi|296330842|ref|ZP_06873317.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305674360|ref|YP_003866032.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. spizizenii str. W23]
 gi|296151847|gb|EFG92721.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305412604|gb|ADM37723.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 140

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 62/104 (59%), Gaps = 5/104 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN-LAQ 81
           LG+D FLK+L+TQ+++QDP  P+   E ++Q+A FS +EQ + MN T+ + +++ +    
Sbjct: 24  LGKDEFLKILMTQVQNQDPLNPVDDKEFISQMATFSSLEQMMNMNKTMTQFVENQDPFTS 83

Query: 82  ASSYIGKNITNADG----SISGVVNAIQVSSTGLTAITVDNTEI 121
              ++GK ++  DG      +G V++++ S      I  D TEI
Sbjct: 84  YVDWLGKEVSWTDGQSTTDKTGTVSSVKHSKGSYYLILDDGTEI 127


>gi|258514009|ref|YP_003190231.1| flagellar hook capping protein [Desulfotomaculum acetoxidans DSM
           771]
 gi|257777714|gb|ACV61608.1| flagellar hook capping protein [Desulfotomaculum acetoxidans DSM
           771]
          Length = 134

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 61/95 (64%), Gaps = 3/95 (3%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           S + S   L ++AFLKL I Q+K+QDP  P   +  + Q+A FS MEQ + +N+++ +L+
Sbjct: 17  STNASGMVLDKEAFLKLFIEQLKNQDPLSPQDPNAFMNQMAQFSVMEQLMNLNTSITQLI 76

Query: 75  KSNNLAQASSYIGKN--ITNADGS-ISGVVNAIQV 106
              NL +A+S +G+   +T ADG+ ISG V  +Q+
Sbjct: 77  DLQNLTEAASLVGRTVMVTGADGTEISGTVEKVQI 111


>gi|312792654|ref|YP_004025577.1| flagellar hook capping protein [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312179794|gb|ADQ39964.1| flagellar hook capping protein [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 164

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 68/115 (59%), Gaps = 13/115 (11%)

Query: 12  QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
           Q  + S +K  LG+  FL LL+TQ+++QDP +PM+  E VAQLA FS +EQ   +N +  
Sbjct: 17  QGLATSSTKNVLGKQEFLNLLVTQLRYQDPLKPMEDKEFVAQLAQFSALEQMQNLNESF- 75

Query: 72  ELLKSNNLAQASSYIGKNI--TNADGS---ISGVVNAIQVSSTGLTAITVDNTEI 121
           ELLK      A S IG+ +  TN   S   I G V +++V  + +  + V+NTEI
Sbjct: 76  ELLK------AQSMIGRYVVATNPQDSSKQIEGRVESVKVDGSKVY-LKVNNTEI 123


>gi|51598544|ref|YP_072732.1| flagellar basal body rod modification protein [Borrelia garinii
           PBi]
 gi|51573115|gb|AAU07140.1| flagellar hook assembly protein [Borrelia garinii PBi]
          Length = 147

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 52/81 (64%), Gaps = 2/81 (2%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           SK  LG+D FLKLLITQ+++QDPT PMK  E ++Q+A FS +EQ   M+ + ++L  S  
Sbjct: 32  SKVNLGKDDFLKLLITQLRYQDPTNPMKDKEFISQMAQFSALEQMTNMSKSFEKLSSSLG 91

Query: 79  LAQASSYIGKNIT--NADGSI 97
           + +    +GK I   + DG +
Sbjct: 92  IRRDLDLLGKVIKFQHGDGEV 112


>gi|182412239|ref|YP_001817305.1| flagellar hook capping protein [Opitutus terrae PB90-1]
 gi|177839453|gb|ACB73705.1| flagellar hook capping protein [Opitutus terrae PB90-1]
          Length = 155

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 61/96 (63%), Gaps = 3/96 (3%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           + +  K TL Q+ FLKLL  Q + QDP  PM+ +E +AQ+A F+ ++QS  + + +++  
Sbjct: 25  TPAPKKTTLDQNDFLKLLTVQFQQQDPMSPMEDTEFIAQMAQFTALDQSKALLTQMKQFS 84

Query: 75  KSNNLAQASSYIGKNITNAD---GSISGVVNAIQVS 107
              + A A+SYIG+ +T AD    + +GVV+ ++++
Sbjct: 85  TMQDAATANSYIGRQVTFADENGATATGVVSGVEIT 120


>gi|312135847|ref|YP_004003185.1| flagellar hook capping protein [Caldicellulosiruptor owensensis OL]
 gi|311775898|gb|ADQ05385.1| flagellar hook capping protein [Caldicellulosiruptor owensensis OL]
          Length = 170

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/110 (41%), Positives = 70/110 (63%), Gaps = 13/110 (11%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           S +K  LG+  FL LL+TQ+++QDP +PM+  E VAQLA FS +EQ   +N++  E LK 
Sbjct: 22  SANKNILGKQEFLNLLVTQLRYQDPLKPMEDKEFVAQLAQFSALEQMQNLNNSF-EFLK- 79

Query: 77  NNLAQASSYIGKNI--TNA-DGS--ISGVVNAIQVSSTGLTAITVDNTEI 121
                A S IG+ +  TNA DG+  I G V++I+V  + +  + V++TE+
Sbjct: 80  -----AQSMIGRYVIATNAQDGARQIEGRVDSIRVDGSKVF-LKVNDTEV 123


>gi|304404251|ref|ZP_07385913.1| flagellar hook capping protein [Paenibacillus curdlanolyticus YK9]
 gi|304347229|gb|EFM13061.1| flagellar hook capping protein [Paenibacillus curdlanolyticus YK9]
          Length = 163

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 70/120 (58%), Gaps = 15/120 (12%)

Query: 12  QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
           Q+ + +K   TLG+D FLK+L+TQ+++QDP++P++  + +AQ+A FS +EQ + M+  + 
Sbjct: 21  QKAAATKKDTTLGKDDFLKILVTQLRNQDPSQPLQDRDFIAQMAQFSSVEQLMNMSEEMT 80

Query: 72  ELLKSNNLAQASSYIGKNI-------TNADGSISGVVNAI------QVSSTGLTAITVDN 118
           +L +  NL  ASS IG  +       T    + SG+V AI      Q +  G   + VD+
Sbjct: 81  KLRQ--NLGSASSMIGMTVEWNGMSDTGIGTTYSGLVEAISIKDGVQYAKVGDKTVKVDD 138


>gi|157692307|ref|YP_001486769.1| flagellar basal body rod modification protein [Bacillus pumilus
           SAFR-032]
 gi|157681065|gb|ABV62209.1| flagellar basal body rod modification protein [Bacillus pumilus
           SAFR-032]
          Length = 148

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 62/108 (57%), Gaps = 12/108 (11%)

Query: 10  TQQEFSKSKSKKT--LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN 67
           TQ + S    KKT  LG+D FLK+L+TQ+++QDPT P+   E V QLA FS +EQ   MN
Sbjct: 12  TQTDTSSKAEKKTDTLGKDQFLKILLTQLQNQDPTNPLDDREFVTQLATFSSLEQQTNMN 71

Query: 68  STLQEL--LKSNNLAQAS------SYIGKNITNA--DGSISGVVNAIQ 105
            ++ +L  L S  +A          +IGK ++    D  ISG V +++
Sbjct: 72  DSITKLNQLMSTFVAHQDPFTTYVGWIGKEVSGKLDDKDISGTVKSVK 119


>gi|295399816|ref|ZP_06809797.1| flagellar hook capping protein [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312111672|ref|YP_003989988.1| flagellar hook capping protein [Geobacillus sp. Y4.1MC1]
 gi|294978219|gb|EFG53816.1| flagellar hook capping protein [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311216773|gb|ADP75377.1| flagellar hook capping protein [Geobacillus sp. Y4.1MC1]
          Length = 140

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 58/87 (66%), Gaps = 5/87 (5%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN---L 79
           LG+D FLK+L+ Q+++QDP  PM+  E +AQ+A FS +EQ + ++S  + L+++ N   L
Sbjct: 26  LGKDDFLKILLVQLQNQDPLNPMEDKEFIAQMANFSTLEQMINISSMFERLMQTQNNQAL 85

Query: 80  AQASSYIGKNIT--NADGSISGVVNAI 104
            + S +IGKN+     + + SGVV ++
Sbjct: 86  LRYSEWIGKNVYWQEEENTKSGVVKSV 112


>gi|216263922|ref|ZP_03435916.1| flagellar hook capping protein [Borrelia afzelii ACA-1]
 gi|215979966|gb|EEC20788.1| flagellar hook capping protein [Borrelia afzelii ACA-1]
          Length = 147

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 3/90 (3%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           +K  LG+D FLKLLITQ+++QDPT PMK  E +AQ+A FS +EQ   M+ + ++L  S  
Sbjct: 32  NKVNLGKDDFLKLLITQLRYQDPTNPMKDKEFIAQMAQFSALEQMANMSKSFEKLSSSLE 91

Query: 79  LAQASSYIGKNITNADGS---ISGVVNAIQ 105
           + +    +GK I    G+   + G V +I+
Sbjct: 92  IRKDLDLLGKVIKFQHGNGEIVEGRVTSIK 121


>gi|203287744|ref|YP_002222759.1| flagellar hook assembly protein [Borrelia recurrentis A1]
 gi|201084964|gb|ACH94538.1| flagellar hook assembly protein [Borrelia recurrentis A1]
          Length = 146

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 39/51 (76%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          LG+D FLKLL+TQ+K+QDPTEPMK  E ++Q+A FS +EQ   MN + + L
Sbjct: 35 LGRDDFLKLLLTQLKYQDPTEPMKDKEFISQMAQFSALEQMTNMNKSFENL 85


>gi|114566391|ref|YP_753545.1| flagellar hook capping protein-like protein [Syntrophomonas wolfei
           subsp. wolfei str. Goettingen]
 gi|114337326|gb|ABI68174.1| Flagellar hook capping protein-like protein [Syntrophomonas wolfei
           subsp. wolfei str. Goettingen]
          Length = 180

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 72/126 (57%), Gaps = 13/126 (10%)

Query: 8   NPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN 67
           N  Q   S  +  K L ++AFLKLL+T++K+QDP EP+K  E ++Q+A FS +EQ   +N
Sbjct: 16  NEPQSSKSSKEINKGLDKEAFLKLLLTELKYQDPIEPVKDKEFISQMANFSSLEQMTNLN 75

Query: 68  STLQELLKSNN--------LAQASSYIGKNITNAD----GSISGVVNAIQVSSTGLTAIT 115
           S+  +L  + N        + Q+S+ +G+ +   D     S +G+++++ V   G+    
Sbjct: 76  SSFNKLSATLNSGILPGLVMQQSSTMVGREVFYTDPDSGASSNGIISSV-VFREGIPYYV 134

Query: 116 VDNTEI 121
           +D+ EI
Sbjct: 135 IDDKEI 140


>gi|194014528|ref|ZP_03053145.1| flagellar hook capping protein [Bacillus pumilus ATCC 7061]
 gi|194013554|gb|EDW23119.1| flagellar hook capping protein [Bacillus pumilus ATCC 7061]
          Length = 148

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 57/98 (58%), Gaps = 10/98 (10%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL--LK 75
           K   TLG+D FLK+L+TQ+++QDPT P+   E V QLA FS +EQ   MN ++ +L  L 
Sbjct: 22  KKTDTLGKDQFLKILLTQLQNQDPTNPLDDREFVTQLATFSSLEQQTNMNDSITKLNQLM 81

Query: 76  SNNLAQAS------SYIGKNITNA--DGSISGVVNAIQ 105
           S  +A          +IGK ++    D  ISG V +++
Sbjct: 82  STFVAHQDPFTTYVGWIGKEVSGKLDDKDISGTVKSVK 119


>gi|94264100|ref|ZP_01287899.1| Flagellar hook capping protein [delta proteobacterium MLMS-1]
 gi|93455516|gb|EAT05706.1| Flagellar hook capping protein [delta proteobacterium MLMS-1]
          Length = 223

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 60/108 (55%), Gaps = 8/108 (7%)

Query: 1   MEINTEVNPTQQEFSKSKSKKTLGQDA-----FLKLLITQIKHQDPTEPMKASEQVAQLA 55
           M I++ + P           K +G D+     F+KL ITQ+++QDP EPM + E  +QLA
Sbjct: 1   MAIDSMMGPGVPMAEPPNPNKPVGSDSLDRADFMKLFITQLQYQDPMEPMDSYEMASQLA 60

Query: 56  VFSQMEQSVQMNSTLQELL---KSNNLAQASSYIGKNITNADGSISGV 100
            FS ME +++M+  +++LL   KS N  Q    IGKNI  A   IS V
Sbjct: 61  QFSNMEATMKMSDNMEKLLDYQKSQNNLQLLGLIGKNIETAGNEISMV 108


>gi|254446081|ref|ZP_05059557.1| flagellar hook capping protein [Verrucomicrobiae bacterium DG1235]
 gi|198260389|gb|EDY84697.1| flagellar hook capping protein [Verrucomicrobiae bacterium DG1235]
          Length = 205

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 1/86 (1%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           +K LGQD F KLL TQ+  QDP EPM+ +  +AQ+A FS++E +  +  +      +   
Sbjct: 31  QKALGQDEFFKLLTTQLASQDPLEPMEDTAFIAQMASFSELEMTSNLTKSFDNFNSTQQF 90

Query: 80  AQASSYIGKNITNADGSISGVVNAIQ 105
           A A  YIGK ++ + G + G V +++
Sbjct: 91  ASAHGYIGKTVSLSSGEV-GEVTSVE 115


>gi|297584042|ref|YP_003699822.1| flagellar hook capping protein [Bacillus selenitireducens MLS10]
 gi|297142499|gb|ADH99256.1| flagellar hook capping protein [Bacillus selenitireducens MLS10]
          Length = 161

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 68/123 (55%), Gaps = 14/123 (11%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           +K      +G+DAFLKLLITQ+++QDP +PM+  E ++Q+A FS +EQ   MN  + + L
Sbjct: 23  AKGTGDSEMGKDAFLKLLITQLQNQDPLDPMEDKEFISQMANFSSLEQMTNMNENMNKFL 82

Query: 75  KSNNLAQASSY---IGKNI------TNADG-----SISGVVNAIQVSSTGLTAITVDNTE 120
           +S   +Q  S+   IGK I       N +G     ++S +V A++      T +T    E
Sbjct: 83  ESQQQSQFFSHSDMIGKQIEWQEEVKNENGDKRMETMSAIVQAVKFKDGIATILTESGKE 142

Query: 121 IPI 123
           + +
Sbjct: 143 LSV 145


>gi|330809243|ref|YP_004353705.1| flagellar hook capping protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327377351|gb|AEA68701.1| Putative flagellar hook capping protein [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 140

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 72/131 (54%), Gaps = 8/131 (6%)

Query: 3   INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           I  E++ T  E ++S+    LGQ+ F+KL +T++  QDP EP+   E +AQ+A F+ +EQ
Sbjct: 6   IGNELSSTTSELAQSR----LGQEDFIKLFLTELTFQDPLEPINNREFLAQMAQFANLEQ 61

Query: 63  SVQMNSTLQELLKSNNLAQASSYIGKNI---TNADGSISGVVNAIQVSSTGLTAITVDNT 119
           +   N     L+  N  +Q+   +G+ +       G+  G V AI  SSTG   ++V  T
Sbjct: 62  TRITNENTDNLVSMNATSQSLGLLGRQVEVSITTGGTAIGSVTAIAFSSTG-PVLSVKRT 120

Query: 120 EIPITTGIRIS 130
           +  + T +R+S
Sbjct: 121 DGTVLTDVRLS 131


>gi|119953083|ref|YP_945292.1| flagellar basal body rod modification protein [Borrelia turicatae
           91E135]
 gi|119861854|gb|AAX17622.1| basal-body rod modification protein FlgD [Borrelia turicatae
           91E135]
          Length = 144

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 55/93 (59%), Gaps = 7/93 (7%)

Query: 12  QEFSKSKSKK-----TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQM 66
           +E S SK ++      LG+D FLKLLITQ+K+QDPT+PMK  E +AQ+A FS +EQ   M
Sbjct: 17  KEISNSKVQRGVKGNNLGRDDFLKLLITQLKYQDPTDPMKDKEFIAQMAQFSALEQMTNM 76

Query: 67  NSTLQELLKSNNLAQASSYIGK--NITNADGSI 97
           + + + L     + +    +GK     + DG I
Sbjct: 77  SKSFESLSSVLGINKDLDLLGKIVEFEHVDGEI 109


>gi|90422629|ref|YP_530999.1| flagellar basal body rod modification protein [Rhodopseudomonas
           palustris BisB18]
 gi|90104643|gb|ABD86680.1| flagellar hook capping protein [Rhodopseudomonas palustris BisB18]
          Length = 135

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 65/111 (58%), Gaps = 3/111 (2%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           +G + FL+LLI Q+++QDPT P   S+ ++Q A  S +EQ++Q N  L  LL ++ L+QA
Sbjct: 25  IGYNDFLQLLIAQMRNQDPTSPTDMSQYMSQFAQLSSVEQAIQTNLKLDALLSTSALSQA 84

Query: 83  SSYIGK--NITNADG-SISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
              IG+  + T  DG S +G + A+ +   G  A   +  ++ +  GI IS
Sbjct: 85  EGLIGRTASFTAEDGQSSTGKITAVHIIQGGAVATLDNGVQVQLGPGITIS 135


>gi|119477954|ref|ZP_01618054.1| Flagellar hook capping protein [marine gamma proteobacterium
           HTCC2143]
 gi|119448867|gb|EAW30109.1| Flagellar hook capping protein [marine gamma proteobacterium
           HTCC2143]
          Length = 224

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 67/110 (60%), Gaps = 12/110 (10%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKS 76
           K+ LGQD FL+L++TQ+++Q+P +P   SE VAQLA FS +E   ++N+T++      +S
Sbjct: 26  KQELGQDVFLELMVTQMRNQNPLDPQDNSEFVAQLAQFSSVEGLDKLNNTMEGFVGSFQS 85

Query: 77  NNLAQASSYIGKNIT--------NADGSISGVVNAIQVSSTGLTAITVDN 118
           N   QAS+ +G+++          ADG ++G +   Q S+  L+ I  D+
Sbjct: 86  NQALQASALVGRSVKVDSDTSYLAADGRVAGTIELPQ-STDDLSVIVYDS 134


>gi|225620906|ref|YP_002722164.1| flagellar hook capping protein [Brachyspira hyodysenteriae WA1]
 gi|225215726|gb|ACN84460.1| flagellar hook capping protein [Brachyspira hyodysenteriae WA1]
          Length = 264

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 61/117 (52%), Gaps = 4/117 (3%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           Q  F +  ++ +LG+DAFLKLL  Q+ HQDP  PM   + +AQLA FS +EQ  ++N  L
Sbjct: 27  QHNFQRDPTQNSLGKDAFLKLLTVQMSHQDPLSPMDNRDMIAQLAQFSSVEQMTEVNKNL 86

Query: 71  QELLKSNNLAQASSYIGKNI---TNADGSISGVVNAIQVSSTGLT-AITVDNTEIPI 123
             +    +     S +GK++     A     G V  +  + TG+  A+  DN  I +
Sbjct: 87  DSMKTFYSSQTGYSMLGKSVEVMDEAGNRFLGPVEMVMENDTGVALAVRTDNGLITV 143


>gi|219684639|ref|ZP_03539582.1| flagellar hook capping protein [Borrelia garinii PBr]
 gi|219672001|gb|EED29055.1| flagellar hook capping protein [Borrelia garinii PBr]
          Length = 147

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 51/81 (62%), Gaps = 2/81 (2%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           +K  LG+D FLKLLITQ+++QDPT PMK  E ++Q+A FS +EQ   M+ + + L  S  
Sbjct: 32  NKVNLGKDDFLKLLITQLRYQDPTNPMKDKEFISQMAQFSALEQMTNMSKSFERLSSSLG 91

Query: 79  LAQASSYIGKNIT--NADGSI 97
           + +    +GK I   + DG +
Sbjct: 92  IRRDLDLLGKVIKFQHGDGEV 112


>gi|154686044|ref|YP_001421205.1| flagellar basal body rod modification protein [Bacillus
           amyloliquefaciens FZB42]
 gi|154351895|gb|ABS73974.1| YlxG [Bacillus amyloliquefaciens FZB42]
          Length = 146

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 53/77 (68%), Gaps = 1/77 (1%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           S   LG+D FLK+L+TQ+++QDP  P+   E ++Q+A FS +EQ + MN+T+ + +++ +
Sbjct: 27  SSTNLGKDEFLKILMTQVQNQDPLNPVDDKEFISQMATFSSLEQMMNMNTTMTKFVENQD 86

Query: 79  -LAQASSYIGKNITNAD 94
                 ++IGKN+T +D
Sbjct: 87  PFTMYVNWIGKNVTFSD 103


>gi|219685744|ref|ZP_03540555.1| flagellar hook capping protein [Borrelia garinii Far04]
 gi|219672683|gb|EED29711.1| flagellar hook capping protein [Borrelia garinii Far04]
          Length = 147

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 52/81 (64%), Gaps = 2/81 (2%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           +K  LG+D FLKLLITQ+++QDPT PMK  E ++Q+A FS +EQ   M+ + ++L  S  
Sbjct: 32  NKVNLGKDDFLKLLITQLRYQDPTNPMKDKEFISQMAQFSALEQMTNMSKSFEKLSSSLG 91

Query: 79  LAQASSYIGKNIT--NADGSI 97
           + +    +GK I   + DG +
Sbjct: 92  IRRDLDLLGKVIKFQHGDGEV 112


>gi|323700160|ref|ZP_08112072.1| flagellar hook capping protein [Desulfovibrio sp. ND132]
 gi|323460092|gb|EGB15957.1| flagellar hook capping protein [Desulfovibrio desulfuricans ND132]
          Length = 250

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 10/85 (11%)

Query: 9   PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN- 67
           PT+ E S       L QDAFL +L+ Q+ HQDP  PM+ +E  +QLA FS +EQ   +N 
Sbjct: 24  PTEHETS-------LDQDAFLSILVAQLTHQDPLNPMEDTEMTSQLAEFSSLEQLTNIND 76

Query: 68  --STLQELLKSNNLAQASSYIGKNI 90
             STL E +  +++  A S+IGK +
Sbjct: 77  GISTLNETMSQSDILTAVSFIGKEV 101


>gi|212639560|ref|YP_002316080.1| flagellar basal body rod modification protein [Anoxybacillus
           flavithermus WK1]
 gi|212561040|gb|ACJ34095.1| Flagellar hook capping protein [Anoxybacillus flavithermus WK1]
          Length = 163

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 68/129 (52%), Gaps = 31/129 (24%)

Query: 5   TEVNPT-----QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           T ++P+     +Q   +   K +LG+D FLK+LI Q++HQDP  PM+  E ++Q+A FS 
Sbjct: 10  TAIDPSLLLSQRQVAQRETGKSSLGKDDFLKILIAQLQHQDPLNPMEDREFISQMANFSS 69

Query: 60  MEQSVQMNSTLQELLKSN------------------------NLAQASSYIGKNITNADG 95
           +EQ V M++ L + +++                         +LAQ S +IGK +T  + 
Sbjct: 70  LEQMVNMSNMLSKFIETQTGTSEKLVGTLDALQKLIQQQSAPSLAQYSEWIGKTVTWDEQ 129

Query: 96  SISGVVNAI 104
             SGVV A+
Sbjct: 130 --SGVVRAV 136


>gi|288573022|ref|ZP_06391379.1| flagellar hook capping protein [Dethiosulfovibrio peptidovorans
          DSM 11002]
 gi|288568763|gb|EFC90320.1| flagellar hook capping protein [Dethiosulfovibrio peptidovorans
          DSM 11002]
          Length = 150

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 48/72 (66%), Gaps = 1/72 (1%)

Query: 20 KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
          K  + +D FLKL I Q+K+QDP EPM  +E  AQ + F+ +EQ + MNS+++E+L S  L
Sbjct: 23 KSAMDKDDFLKLYIEQLKNQDPLEPMDTNEMAAQFSQFTTVEQLMNMNSSMEEML-SLQL 81

Query: 80 AQASSYIGKNIT 91
            A SYIG  +T
Sbjct: 82 GNAVSYIGFEVT 93


>gi|303248691|ref|ZP_07334945.1| flagellar hook capping protein [Desulfovibrio fructosovorans JJ]
 gi|302489947|gb|EFL49873.1| flagellar hook capping protein [Desulfovibrio fructosovorans JJ]
          Length = 245

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 50/72 (69%), Gaps = 3/72 (4%)

Query: 22 TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
          +LGQDAFL+LL+TQ+++QDP  PM   + VA+LA FS +EQ  ++N+ + +L   N  +Q
Sbjct: 25 SLGQDAFLQLLVTQLQYQDPLSPMDDKDFVAELAQFSSLEQLTEINTGIDKLADLNTQSQ 84

Query: 82 ---ASSYIGKNI 90
             A ++IGK I
Sbjct: 85 VMGAVNFIGKTI 96


>gi|302338084|ref|YP_003803290.1| flagellar hook capping protein [Spirochaeta smaragdinae DSM 11293]
 gi|301635269|gb|ADK80696.1| flagellar hook capping protein [Spirochaeta smaragdinae DSM 11293]
          Length = 149

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 59/89 (66%), Gaps = 8/89 (8%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK-SNNL 79
           ++LG+D FLKLL+TQ+++QDPT+PM+  E +AQ+A FS +E   QMN+  Q+ +   N L
Sbjct: 34  QSLGKDDFLKLLLTQLQYQDPTKPMEDKEFIAQMAQFSSLE---QMNNLSQQFVSVKNTL 90

Query: 80  AQASSY--IGK--NITNADGSISGVVNAI 104
            + ++Y  IG+  +I   D  I G V A+
Sbjct: 91  GRNAAYDLIGRQVDILQGDQKIHGTVEAV 119


>gi|330953720|gb|EGH53980.1| flagellar basal body rod modification protein [Pseudomonas syringae
           Cit 7]
          Length = 229

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 60/91 (65%), Gaps = 6/91 (6%)

Query: 3   INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           +NT  NPT    +K+ S  TLG+D+FL+LL+TQ+K+Q+P +P   ++ VAQLA FS +E 
Sbjct: 16  LNTLQNPTP---TKTDSTGTLGKDSFLQLLVTQMKNQNPLDPQDNTQFVAQLAQFSSLES 72

Query: 63  SVQMNSTLQEL---LKSNNLAQASSYIGKNI 90
              + ST+  +    KS+   QASS +G+++
Sbjct: 73  MQNLTSTVDTIASSYKSSQALQASSLVGRSV 103


>gi|302872564|ref|YP_003841200.1| flagellar hook capping protein [Caldicellulosiruptor obsidiansis
           OB47]
 gi|302575423|gb|ADL43214.1| flagellar hook capping protein [Caldicellulosiruptor obsidiansis
           OB47]
          Length = 171

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 68/116 (58%), Gaps = 13/116 (11%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           +Q  + S  K  LG+  FL LL+TQ+++QDP +PM+  E VAQLA FS +EQ   +N + 
Sbjct: 17  KQGLAVSSEKNILGKQEFLNLLVTQLRYQDPLKPMEDKEFVAQLAQFSALEQMQNLNQSF 76

Query: 71  QELLKSNNLAQASSYIGKNI---TNADG--SISGVVNAIQVSSTGLTAITVDNTEI 121
            ELLK      A S IG+ I   +  DG   I G V++I+V  + +  + V+ TE+
Sbjct: 77  -ELLK------AQSMIGRYIVATSTQDGLKQIEGRVDSIRVDGSKV-FLKVNGTEV 124


>gi|94267502|ref|ZP_01290901.1| Flagellar hook capping protein [delta proteobacterium MLMS-1]
 gi|93451979|gb|EAT02689.1| Flagellar hook capping protein [delta proteobacterium MLMS-1]
          Length = 223

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 62/108 (57%), Gaps = 8/108 (7%)

Query: 1   MEINTEVNPTQQEFSKSKSKKTLGQDA-----FLKLLITQIKHQDPTEPMKASEQVAQLA 55
           M I++ + P       + + K +G D+     F+KL ITQ+++QDP +PM + E  +QLA
Sbjct: 1   MAIDSMMGPGVPMAEPAGAIKPVGSDSLDRADFMKLFITQLQYQDPMQPMDSYEMASQLA 60

Query: 56  VFSQMEQSVQMNSTLQELL---KSNNLAQASSYIGKNITNADGSISGV 100
            FS ME +++M+  +++LL   KS N  Q    IGKNI  A   IS V
Sbjct: 61  QFSNMEATMKMSDNMEKLLDYQKSQNNLQLLGLIGKNIETAGNEISMV 108


>gi|239826620|ref|YP_002949244.1| flagellar basal body rod modification protein [Geobacillus sp.
           WCH70]
 gi|239806913|gb|ACS23978.1| flagellar hook capping protein [Geobacillus sp. WCH70]
          Length = 140

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 59/87 (67%), Gaps = 5/87 (5%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN---L 79
           LG+D FLK+L+ Q+++QDP  PM+  E +AQ+A FS +EQ + ++S +++ +K+ +   L
Sbjct: 26  LGKDDFLKILLVQLQNQDPLNPMEDKEFIAQMASFSSLEQMINISSMIEQFIKTQHDHAL 85

Query: 80  AQASSYIGKNIT--NADGSISGVVNAI 104
            + S +IGKN+     + + SG+V ++
Sbjct: 86  LRYSEWIGKNVYWQEDENTKSGIVQSV 112


>gi|114320056|ref|YP_741739.1| flagellar hook capping protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226450|gb|ABI56249.1| flagellar hook capping protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 222

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 63/108 (58%), Gaps = 16/108 (14%)

Query: 5   TEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVF---SQME 61
           +   PTQ+E         LGQD FLKL+ITQ+++QDP  PM++ E ++Q+A F   S M+
Sbjct: 12  SRAQPTQRE-----PAGELGQDDFLKLMITQLQNQDPMNPMESGEFMSQIASFTTASGMD 66

Query: 62  QSVQMNSTLQELLKSNNLAQASSYIGKNI--------TNADGSISGVV 101
           Q  +  S  Q+ +++N   QA+S +G+ +          ADG ++G+V
Sbjct: 67  QLQKSFSEFQQDMRANQALQAASLVGREVLVETDAGRLPADGEMTGIV 114


>gi|222530132|ref|YP_002574014.1| flagellar hook capping protein [Caldicellulosiruptor bescii DSM
           6725]
 gi|222456979|gb|ACM61241.1| flagellar hook capping protein [Caldicellulosiruptor bescii DSM
           6725]
          Length = 164

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 73/123 (59%), Gaps = 13/123 (10%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           NT ++ + Q  + S  K  LG+  FL LL+TQ+++QDP +PM+  E VAQLA FS +EQ 
Sbjct: 9   NTNISNSTQGSATSLGKNVLGKQEFLNLLVTQLRYQDPLKPMEDKEFVAQLAQFSALEQM 68

Query: 64  VQMNSTLQELLKSNNLAQASSYIGKNI--TN-ADGS--ISGVVNAIQVSSTGLTAITVDN 118
             +N +  E LK      A S IG+ +  TN AD S  I G +++I+V  + +  + V+ 
Sbjct: 69  QNLNESF-EFLK------AQSMIGRYVVATNPADTSKTIEGRIDSIRVDGSKV-YLKVNG 120

Query: 119 TEI 121
           TE+
Sbjct: 121 TEV 123


>gi|15022423|dbj|BAB62244.1| flagellar protein [Treponema medium]
          Length = 159

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 66/106 (62%), Gaps = 6/106 (5%)

Query: 1   MEINTEVNPTQQEFSKS-KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           ME++T +N  +Q F +  K K+ LG+D FL+LL+ Q+ HQDPT P++ ++ VAQ+A F+ 
Sbjct: 29  MEVDT-IN--KQNFPEGRKPKQELGKDDFLQLLVAQLTHQDPTSPLEDTQFVAQMAQFTS 85

Query: 60  MEQSVQMNSTLQELLKSNNLAQASSYIGK--NITNADGSISGVVNA 103
           +EQ   MN     L +    + A + +GK  +I  + G++SG + A
Sbjct: 86  LEQLTNMNQNFGMLNRLIGDSSAVNVVGKQVDIEQSSGTVSGTITA 131


>gi|187918158|ref|YP_001883721.1| flagellar basal body rod modification protein [Borrelia hermsii
          DAH]
 gi|119861006|gb|AAX16801.1| basal-body rod modification protein FlgD [Borrelia hermsii DAH]
          Length = 144

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 39/51 (76%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          LG+D FLKLLITQ+K+QDPT+PMK  E +AQ+A FS +EQ   M+ + + L
Sbjct: 33 LGRDDFLKLLITQLKYQDPTDPMKDKEFIAQMAQFSALEQMTNMSKSFESL 83


>gi|77460470|ref|YP_349977.1| flagellar basal body rod modification protein [Pseudomonas
           fluorescens Pf0-1]
 gi|77384473|gb|ABA75986.1| flagellar biosynthesis protein, initiation of hook assembly
           [Pseudomonas fluorescens Pf0-1]
          Length = 242

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA-- 80
           LG+DAFL+LL+TQ+K+Q+P +P   S  VAQLA FS +E    +NST+  L  + N +  
Sbjct: 44  LGKDAFLQLLVTQLKNQNPLDPQDNSAFVAQLAQFSSLEGITTLNSTVSSLAGNYNSSQA 103

Query: 81  -QASSYIGKNI 90
            QASS +G+N+
Sbjct: 104 LQASSLVGRNV 114


>gi|71737896|ref|YP_275564.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|289627762|ref|ZP_06460716.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. aesculi str. NCPPB3681]
 gi|289651648|ref|ZP_06482991.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. aesculi str. 2250]
 gi|298487858|ref|ZP_07005898.1| Flagellar basal-body rod modification protein flgD [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|71558449|gb|AAZ37660.1| flagellar basal-body rod modification protein FlgD [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|298157583|gb|EFH98663.1| Flagellar basal-body rod modification protein flgD [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|320325092|gb|EFW81161.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. glycinea str. B076]
 gi|320329351|gb|EFW85344.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. glycinea str. race 4]
 gi|330866421|gb|EGH01130.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. aesculi str. 0893_23]
 gi|330880521|gb|EGH14670.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. glycinea str. race 4]
 gi|330889086|gb|EGH21747.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. mori str. 301020]
 gi|330986467|gb|EGH84570.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. lachrymans str. M301315]
          Length = 228

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 59/91 (64%), Gaps = 6/91 (6%)

Query: 3   INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           +NT  NPT    + + S  TLG+DAFL+LL+TQ+K+Q+P +P   ++ VAQLA FS +E 
Sbjct: 15  LNTLQNPTP---TATNSTGTLGKDAFLQLLVTQMKNQNPLDPQDNTQFVAQLAQFSSLES 71

Query: 63  SVQMNSTLQEL---LKSNNLAQASSYIGKNI 90
              + ST+  +    KS+   QASS +G+++
Sbjct: 72  MQNLTSTVDTIATSYKSSQALQASSLVGRSV 102


>gi|126653742|ref|ZP_01725660.1| flagellar basal body rod modification protein D [Bacillus sp.
           B14905]
 gi|126589706|gb|EAZ83842.1| flagellar basal body rod modification protein D [Bacillus sp.
           B14905]
          Length = 229

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           LG+DAFL+LLITQ++HQDPT PM   E ++Q+A FS +EQ   M   ++ LL S    Q 
Sbjct: 35  LGKDAFLQLLITQLQHQDPTNPMNDREFISQMAQFSSLEQMQNMTKAVESLLASQQQTQM 94

Query: 83  SSY---IGKNI 90
            +Y   +GK +
Sbjct: 95  MNYATFVGKEV 105


>gi|257484950|ref|ZP_05638991.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|331011041|gb|EGH91097.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. tabaci ATCC 11528]
          Length = 228

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 59/91 (64%), Gaps = 6/91 (6%)

Query: 3   INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           +NT  NPT    + + S  TLG+DAFL+LL+TQ+K+Q+P +P   ++ VAQLA FS +E 
Sbjct: 15  LNTLQNPTP---TATNSTGTLGKDAFLQLLVTQMKNQNPLDPQDNTQFVAQLAQFSSLES 71

Query: 63  SVQMNSTLQEL---LKSNNLAQASSYIGKNI 90
              + ST+  +    KS+   QASS +G+++
Sbjct: 72  MQNLTSTVDTIATSYKSSQALQASSLVGRSV 102


>gi|312621575|ref|YP_004023188.1| flagellar hook capping protein [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202042|gb|ADQ45369.1| flagellar hook capping protein [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 164

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 73/123 (59%), Gaps = 13/123 (10%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           NT ++ + Q  + S  K  LG+  FL LL+TQ+++QDP +PM+  E VAQLA FS +EQ 
Sbjct: 9   NTNISNSTQGSATSLGKNVLGKQEFLNLLVTQLRYQDPLKPMEDKEFVAQLAQFSALEQM 68

Query: 64  VQMNSTLQELLKSNNLAQASSYIGKNI--TN-ADGS--ISGVVNAIQVSSTGLTAITVDN 118
             +N +  E LK      A S IG+ +  TN AD S  I G +++I+V  + +  + V+ 
Sbjct: 69  QNLNESF-EFLK------AQSMIGRYVVATNPADTSKTIEGRIDSIRVDGSKV-YLKVNG 120

Query: 119 TEI 121
           TE+
Sbjct: 121 TEV 123


>gi|169827127|ref|YP_001697285.1| hypothetical protein Bsph_1557 [Lysinibacillus sphaericus C3-41]
 gi|168991615|gb|ACA39155.1| Hypothetical ylxG protein [Lysinibacillus sphaericus C3-41]
          Length = 228

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           LG+DAFL+LLITQ++HQDPT PM   E ++Q+A FS +EQ   M   ++ LL S    Q 
Sbjct: 34  LGKDAFLQLLITQLQHQDPTNPMNDREFISQMAQFSSLEQMQNMTKAVESLLASQQQTQM 93

Query: 83  SSY---IGKNI 90
            +Y   +GK +
Sbjct: 94  MNYATFVGKEV 104


>gi|203284205|ref|YP_002221945.1| flagellar hook assembly protein [Borrelia duttonii Ly]
 gi|201083648|gb|ACH93239.1| flagellar hook assembly protein [Borrelia duttonii Ly]
          Length = 146

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/51 (54%), Positives = 39/51 (76%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          LG+D FLKLL+TQ+K+QDPTEPMK  E ++Q+A FS +EQ   M+ + + L
Sbjct: 35 LGRDDFLKLLLTQLKYQDPTEPMKDKEFISQMAQFSALEQMTNMSKSFENL 85


>gi|45657071|ref|YP_001157.1| flagellar hook assembly scaffolding protein [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
 gi|45600308|gb|AAS69794.1| flagellar hook assembly scaffolding protein [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
          Length = 264

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 62/107 (57%), Gaps = 8/107 (7%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA 80
           K+LG+D FLKLLITQ+  QDPT P+K  + +AQ+A FS +E   QMN+    + K  N  
Sbjct: 50  KSLGKDDFLKLLITQLSSQDPTNPVKDQDFIAQMAQFSSLE---QMNNISNGIQKMGN-R 105

Query: 81  QASSYIGKNITNAD----GSISGVVNAIQVSSTGLTAITVDNTEIPI 123
           Q+ S +GK ++  D     +I+G+  A+     G T + V+   I +
Sbjct: 106 QSFSLVGKLVSGPDFVNGENIAGIAGALFFDGEGKTFVRVNGRSIDV 152


>gi|300870372|ref|YP_003785243.1| flagellar hook capping protein FlgD [Brachyspira pilosicoli
           95/1000]
 gi|300688071|gb|ADK30742.1| flagellar hook capping protein, FlgD [Brachyspira pilosicoli
           95/1000]
          Length = 233

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 55/104 (52%), Gaps = 3/104 (2%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           Q  F +  +K +LG+D FLKLL  Q+ HQDP  PM   + +AQLA FS +EQ  ++N  L
Sbjct: 27  QHNFERDPAKNSLGKDDFLKLLTVQMSHQDPLSPMDNRDMIAQLAQFSSVEQMTEVNKNL 86

Query: 71  QELLKSNNLAQASSYIGKNI---TNADGSISGVVNAIQVSSTGL 111
           + +    +     S +GK++     A     G V  +  + TG+
Sbjct: 87  ESMKTFYSSQSGYSMLGKSVEVMDEAGNRFLGPVEMVMENDTGV 130


>gi|24215549|ref|NP_713030.1| flagellar hook assembly scaffolding protein [Leptospira interrogans
           serovar Lai str. 56601]
 gi|24196694|gb|AAN50048.1| flagellar hook assembly scaffolding protein [Leptospira interrogans
           serovar Lai str. 56601]
          Length = 264

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 62/107 (57%), Gaps = 8/107 (7%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA 80
           K+LG+D FLKLLITQ+  QDPT P+K  + +AQ+A FS +E   QMN+    + K  N  
Sbjct: 50  KSLGKDDFLKLLITQLSSQDPTNPVKDQDFIAQMAQFSSLE---QMNNISNGIQKMGN-R 105

Query: 81  QASSYIGKNITNAD----GSISGVVNAIQVSSTGLTAITVDNTEIPI 123
           Q+ S +GK ++  D     +I+G+  A+     G T + V+   I +
Sbjct: 106 QSFSLVGKLVSGPDFVNGENIAGIAGALFFDGEGKTFVRVNGRSIDV 152


>gi|158320519|ref|YP_001513026.1| flagellar hook capping protein [Alkaliphilus oremlandii OhILAs]
 gi|158140718|gb|ABW19030.1| flagellar hook capping protein [Alkaliphilus oremlandii OhILAs]
          Length = 141

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (58%), Gaps = 8/114 (7%)

Query: 12  QEFSKSKSKK---TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
           +++S ++ KK    LG+DAFL LL+TQ+K+QDP  PM   + +AQ+A FS +EQ   +N+
Sbjct: 15  RDYSGNQEKKQTDALGKDAFLNLLVTQLKNQDPLNPMDDRDFIAQMAQFSSLEQMQNLNT 74

Query: 69  TLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIP 122
           TL     +N  +    +I +   N   S + +V+ +   + GL  +T +N E+P
Sbjct: 75  TL-----TNTQSSIMEHITQMNNNFVKSQTNIVDQLVKINEGLRKLTGENPEVP 123


>gi|308068659|ref|YP_003870264.1| flagellar hook capping protein [Paenibacillus polymyxa E681]
 gi|305857938|gb|ADM69726.1| Flagellar hook capping protein [Paenibacillus polymyxa E681]
          Length = 177

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 54/77 (70%), Gaps = 2/77 (2%)

Query: 15 SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
          + +K  KT+G+D FLK+LITQ+++QDP +P++  E +AQ+A FS +EQ + +++ L  L 
Sbjct: 25 ASAKDTKTMGKDQFLKILITQLQNQDPMQPLEDKEFIAQMAQFSSVEQLMNISTQLNALG 84

Query: 75 KSNNLAQASSYIGKNIT 91
          +S  L  AS  IGK ++
Sbjct: 85 QS--LGTASGLIGKEVS 99


>gi|310641550|ref|YP_003946308.1| flagellar hook capping protein [Paenibacillus polymyxa SC2]
 gi|309246500|gb|ADO56067.1| Flagellar hook capping protein [Paenibacillus polymyxa SC2]
          Length = 177

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 54/77 (70%), Gaps = 2/77 (2%)

Query: 15 SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
          + +K  KT+G+D FLK+LITQ+++QDP +P++  E +AQ+A FS +EQ + +++ L  L 
Sbjct: 25 ASAKDTKTMGKDQFLKILITQLQNQDPMQPLEDKEFIAQMAQFSSVEQLMNISTQLNALG 84

Query: 75 KSNNLAQASSYIGKNIT 91
          +S  L  AS  IGK ++
Sbjct: 85 QS--LGTASGLIGKEVS 99


>gi|167464162|ref|ZP_02329251.1| Flagellar hook capping protein [Paenibacillus larvae subsp. larvae
           BRL-230010]
          Length = 197

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 69/123 (56%), Gaps = 10/123 (8%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK 75
           +S    +LG+D FLK+LI Q+ +Q+P +PM   E +AQ+A F+ +EQ   M   + +L +
Sbjct: 34  RSGGNSSLGKDDFLKILIAQLVNQNPMDPMNDKEFIAQMAQFTAVEQMTFMAEQMYDLRQ 93

Query: 76  SNNLAQASSYIGKNIT----NADGSI---SGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
           S  L  AS+ IGK+++    N    +    GVV+AI +   G+  + +   EIPI    R
Sbjct: 94  S--LGGASTLIGKHVSYLTVNEKQEVITKQGVVDAI-IMKNGMAHVVIGKEEIPIDLITR 150

Query: 129 ISN 131
           + +
Sbjct: 151 VGD 153


>gi|297544703|ref|YP_003677005.1| flagellar hook capping protein [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296842478|gb|ADH60994.1| flagellar hook capping protein [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 131

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 74/131 (56%), Gaps = 16/131 (12%)

Query: 1   MEINTEVNPTQ-QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           ME+NT  + +     S++ S   LG+D FL+LL+ Q+++QDP +PM   E +AQLA FS 
Sbjct: 1   MEVNTNYSFSNVYNTSETTSNDQLGKDDFLQLLVVQLENQDPLDPMDDKELIAQLAQFSI 60

Query: 60  MEQSVQMNSTLQELLKSNNLAQASSYIGKN----ITNADG---SISGVVNAIQVSSTGLT 112
           +EQ       +Q L  S N  +A + IGKN    IT+ +G   S+ G V+A+     G  
Sbjct: 61  LEQ-------MQNLNVSFNAVRAINLIGKNVYATITDDNGNSTSVVGNVDAV-YKQNGEY 112

Query: 113 AITVDNTEIPI 123
            + V+  ++P+
Sbjct: 113 YLEVNGIDVPL 123


>gi|330811236|ref|YP_004355698.1| basal-body rod modification protein [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327379344|gb|AEA70694.1| Putative basal-body rod modification protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 240

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 50/74 (67%), Gaps = 3/74 (4%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           KK LG+DAFL+LL+TQ+K+Q+P EP    E VAQLA FS +E    +N T+  +  + N 
Sbjct: 40  KKELGKDAFLQLLVTQLKNQNPLEPQDNGEFVAQLAQFSSLEGITTLNETVSGIAGNYNS 99

Query: 80  A---QASSYIGKNI 90
           +   QASS +G+++
Sbjct: 100 SQALQASSLVGRSV 113


>gi|42524756|ref|NP_970136.1| basal-body rod modification protein flgD [Bdellovibrio
           bacteriovorus HD100]
 gi|39576966|emb|CAE78195.1| basal-body rod modification protein flgD [Bdellovibrio
           bacteriovorus HD100]
          Length = 334

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 52/83 (62%), Gaps = 6/83 (7%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KSNN 78
           +L +DAF KL++TQ+K+QDPT P+K+ E  AQLA FS +EQ   MN +L E+    K + 
Sbjct: 67  SLDKDAFFKLMLTQMKNQDPTNPLKSHEMAAQLASFSSLEQMQNMNKSLDEMKNGQKPSE 126

Query: 79  LAQASSYIGKNITNADGSISGVV 101
             QA + IGK +    G  S VV
Sbjct: 127 NFQALNLIGKAVA---GDSSKVV 146


>gi|146296287|ref|YP_001180058.1| flagellar hook capping protein [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145409863|gb|ABP66867.1| flagellar hook capping protein [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 169

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 56/88 (63%), Gaps = 2/88 (2%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
           TLG+  FL LL+TQ+++QDP +PM+  E VAQLA FS +EQ   +N +  EL+K+ N+  
Sbjct: 29  TLGKQEFLNLLVTQLRYQDPLKPMEDKEFVAQLAQFSALEQMQNLNESF-ELIKAQNMI- 86

Query: 82  ASSYIGKNITNADGSISGVVNAIQVSST 109
               +  N ++   ++ G V++I+V  +
Sbjct: 87  GRYVVATNPSDTSKTVEGRVDSIRVDGS 114


>gi|239815262|ref|YP_002944172.1| flagellar hook capping protein [Variovorax paradoxus S110]
 gi|239801839|gb|ACS18906.1| flagellar hook capping protein [Variovorax paradoxus S110]
          Length = 133

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 59/88 (67%), Gaps = 2/88 (2%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
           +LG + FLK+L+TQ+ +QDP +PM   E +AQ+A F+ +EQ+ Q+N+ ++ L+ +    Q
Sbjct: 18  SLGMEDFLKILLTQLTYQDPLKPMDNQEFMAQMAQFTSLEQTQQLNNKIETLITNQAALQ 77

Query: 82  ASSYIGK--NITNADGSISGVVNAIQVS 107
           +   IGK  ++    G+++G V+A+ +S
Sbjct: 78  SVGLIGKTVDVNTPTGAVTGTVSALSLS 105


>gi|239906012|ref|YP_002952751.1| flagellar basal-body rod modification protein FlgD [Desulfovibrio
          magneticus RS-1]
 gi|239795876|dbj|BAH74865.1| flagellar basal-body rod modification protein FlgD [Desulfovibrio
          magneticus RS-1]
          Length = 232

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 3/71 (4%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS---TLQELLKSNNL 79
          LG DAFL+LL+TQ+++QDP +PM   E VA+LA FS +EQ  ++NS    L  L +   +
Sbjct: 27 LGMDAFLQLLVTQLQYQDPLDPMDDKEFVAELAQFSSLEQLTEINSGIEGLSTLTQEQQM 86

Query: 80 AQASSYIGKNI 90
            A ++IGK I
Sbjct: 87 IGAVNFIGKTI 97


>gi|242277988|ref|YP_002990117.1| flagellar hook capping protein [Desulfovibrio salexigens DSM
          2638]
 gi|242120882|gb|ACS78578.1| flagellar hook capping protein [Desulfovibrio salexigens DSM
          2638]
          Length = 220

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 3/73 (4%)

Query: 21 KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA 80
          K L +DAFLKL +TQ+K+QDP  PM   EQ+AQLA FS +E+   ++  +  L K+ N  
Sbjct: 22 KDLNKDAFLKLFVTQLKNQDPVNPMDNKEQLAQLAQFSTVERLTNISKAMDGLTKTVNAM 81

Query: 81 ---QASSYIGKNI 90
              A+ YIGK +
Sbjct: 82 MGLNATGYIGKTV 94


>gi|160880842|ref|YP_001559810.1| flagellar hook capping protein [Clostridium phytofermentans ISDg]
 gi|160429508|gb|ABX43071.1| flagellar hook capping protein [Clostridium phytofermentans ISDg]
          Length = 275

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 59/92 (64%), Gaps = 14/92 (15%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           LG+DAFL+LL+ Q+++QDP  P   +E V+QLA FSQ+E+       LQ L  S + +QA
Sbjct: 33  LGKDAFLQLLVCQMQNQDPLNPSTDTEFVSQLATFSQLEE-------LQNLTASTDKSQA 85

Query: 83  SSYIGKNI----TNADGS---ISGVVNAIQVS 107
            S +GK++    T+++G    ISG V+ I +S
Sbjct: 86  FSLVGKDVILNATDSNGRTTYISGTVDFINMS 117


>gi|70731824|ref|YP_261566.1| flagellar basal body rod modification protein [Pseudomonas
           fluorescens Pf-5]
 gi|68346123|gb|AAY93729.1| basal-body rod modification protein FlgD [Pseudomonas fluorescens
           Pf-5]
          Length = 242

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 56/90 (62%), Gaps = 3/90 (3%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           NT  +      + +  K++LG+DAFLKLL+TQ+ +Q+P +P   S  VAQLA FS +E  
Sbjct: 25  NTSADGLAAATNSATGKQSLGKDAFLKLLVTQLNNQNPLDPQDNSAFVAQLAQFSTLEGI 84

Query: 64  VQMNSTLQEL---LKSNNLAQASSYIGKNI 90
             +NS++  +    KS+   QASS +G+++
Sbjct: 85  TTLNSSVNAITGNYKSSQALQASSLVGRSV 114


>gi|16078691|ref|NP_389510.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221309505|ref|ZP_03591352.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221313829|ref|ZP_03595634.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. subtilis str. NCIB 3610]
 gi|221318752|ref|ZP_03600046.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. subtilis str. JH642]
 gi|221323024|ref|ZP_03604318.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. subtilis str. SMY]
 gi|321315394|ref|YP_004207681.1| flagellar basal body rod modification protein [Bacillus subtilis
           BSn5]
 gi|140659|sp|P23455|YLXG_BACSU RecName: Full=FlaA locus uncharacterized protein ylxG; AltName:
           Full=ORF 8
 gi|39911|emb|CAA39527.1| unnamed protein product [Bacillus subtilis subsp. subtilis str.
           168]
 gi|2634000|emb|CAB13501.1| flagellar hook assembly protein [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|320021668|gb|ADV96654.1| flagellar basal body rod modification protein [Bacillus subtilis
           BSn5]
          Length = 140

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 65/110 (59%), Gaps = 5/110 (4%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           S +  +LG+D FLK+L+TQ+++QDP  P+   E ++Q+A FS +EQ + +N+T+ + +++
Sbjct: 18  STNNSSLGKDEFLKILMTQVQNQDPLNPIDDKEFISQMATFSSLEQMMNLNTTMTQFVEN 77

Query: 77  NN-LAQASSYIGKNITNADG----SISGVVNAIQVSSTGLTAITVDNTEI 121
            +       ++GK ++  DG      +G V++++        +  D TEI
Sbjct: 78  QDPFTTYVDWMGKEVSWTDGKSATDKTGTVSSVKHFKGNYYLVLDDGTEI 127


>gi|289679030|ref|ZP_06499920.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. syringae FF5]
 gi|330899400|gb|EGH30819.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. japonica str. M301072PT]
 gi|330943206|gb|EGH45613.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. pisi str. 1704B]
 gi|330975975|gb|EGH76041.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. aptata str. DSM 50252]
          Length = 229

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 59/91 (64%), Gaps = 6/91 (6%)

Query: 3   INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           +NT  NPT    + + S  TLG+D+FL+LL+TQ+K+Q+P +P   ++ VAQLA FS +E 
Sbjct: 16  LNTLQNPTP---TATNSTGTLGKDSFLQLLVTQMKNQNPLDPQDNTQFVAQLAQFSSLES 72

Query: 63  SVQMNSTLQEL---LKSNNLAQASSYIGKNI 90
              + ST+  +    KS+   QASS +G+++
Sbjct: 73  MQNLTSTVDTIASSYKSSQALQASSLVGRSV 103


>gi|301168106|emb|CBW27692.1| putative basal-body rod modification protein [Bacteriovorax marinus
           SJ]
          Length = 281

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 50/82 (60%), Gaps = 3/82 (3%)

Query: 12  QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
           Q+F  +K    LG+D FLKLL  Q+ +QDP +PM   +  A LA FSQ+EQ   MN+ + 
Sbjct: 44  QKFVDAKEHNKLGKDGFLKLLSHQMANQDPMKPMDQKQFAADLAQFSQLEQLTNMNTKMD 103

Query: 72  ELLKSN---NLAQASSYIGKNI 90
            + K++   N   A+S+IGK I
Sbjct: 104 GMQKNDTTENKFMAASFIGKEI 125


>gi|302389665|ref|YP_003825486.1| flagellar hook capping protein [Thermosediminibacter oceani DSM
           16646]
 gi|302200293|gb|ADL07863.1| flagellar hook capping protein [Thermosediminibacter oceani DSM
           16646]
          Length = 129

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 57/105 (54%), Gaps = 9/105 (8%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
            +  LG+D FLKLLITQ+K+Q+P EP+ + E +AQLA FS +EQ   +NS +  +     
Sbjct: 22  GRAQLGKDDFLKLLITQLKYQNPLEPLDSKEYIAQLATFSSLEQLQNLNSQISAM----- 76

Query: 79  LAQASSYIGK--NITNADGSISGVVNAIQVSSTGLTAITVDNTEI 121
              A S+IGK       +  +SG++  +      L  I  D  ++
Sbjct: 77  --SAVSFIGKTGKARIEEEYVSGIIKGVTFDKGNLNLIIGDEEKL 119


>gi|160901598|ref|YP_001567179.1| flagellar hook capping protein [Petrotoga mobilis SJ95]
 gi|160359242|gb|ABX30856.1| flagellar hook capping protein [Petrotoga mobilis SJ95]
          Length = 220

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 58/91 (63%), Gaps = 6/91 (6%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN-- 77
           KK L ++AFL+LL+T++++QDPT+PM+  + VAQL+  S  EQ   M+  +QE++ S   
Sbjct: 24  KKELDKEAFLELLVTELQNQDPTQPMENKDLVAQLSQLSSTEQITNMSQAIQEMVNSQMS 83

Query: 78  -NLAQASSYIGKNITNADGSI---SGVVNAI 104
            N  QA+S IGK +   D +I   SGV   +
Sbjct: 84  LNKLQAASLIGKTVVVNDNTIDLQSGVAEGL 114


>gi|183220586|ref|YP_001838582.1| basal-body rod modification protein FlgD [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
 gi|189910694|ref|YP_001962249.1| endoflagellar hook capping protein [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167775370|gb|ABZ93671.1| Endoflagellar hook capping protein [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167779008|gb|ABZ97306.1| Basal-body rod modification protein FlgD [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
          Length = 194

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 63/109 (57%), Gaps = 8/109 (7%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           +K LG+D FLKLL+TQ+ HQDPT P++  + +AQ+A FS +EQ   ++S +  +      
Sbjct: 51  QKELGKDDFLKLLLTQLSHQDPTNPVQDKDFIAQMAQFSSLEQMKNISSGIARM----ES 106

Query: 80  AQASSYIGKNITNAD----GSISGVVNAIQVSSTGLTAITVDNTEIPIT 124
            Q+ S +GK ++  D      ++G+  AI   + G T + V+   + ++
Sbjct: 107 KQSYSVVGKIVSGPDLVTGEDVTGLAGAILFDNEGKTYVRVNGRMLDVS 155


>gi|291484180|dbj|BAI85255.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. natto BEST195]
          Length = 140

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 65/110 (59%), Gaps = 5/110 (4%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           S +  +LG+D FLK+L+TQ+++QDP  P+   E ++Q+A FS +EQ + +N+T+ + +++
Sbjct: 18  STNNSSLGKDEFLKILMTQVQNQDPLNPVDDKEFISQMATFSSLEQMMNLNTTMTQFVEN 77

Query: 77  NN-LAQASSYIGKNITNADG----SISGVVNAIQVSSTGLTAITVDNTEI 121
            +       ++GK ++  DG      +G V++++        +  D TEI
Sbjct: 78  QDPFTTYVDWMGKEVSWTDGKSATDKTGTVSSVKHFKGNYYLVLDDGTEI 127


>gi|66046708|ref|YP_236549.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. syringae B728a]
 gi|63257415|gb|AAY38511.1| Flagellar hook capping protein [Pseudomonas syringae pv. syringae
           B728a]
 gi|330972412|gb|EGH72478.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. aceris str. M302273PT]
          Length = 229

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 59/91 (64%), Gaps = 6/91 (6%)

Query: 3   INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           +NT  NPT    + + S  TLG+D+FL+LL+TQ+K+Q+P +P   ++ VAQLA FS +E 
Sbjct: 16  LNTLQNPTP---TATNSTGTLGKDSFLQLLVTQMKNQNPLDPQDNTQFVAQLAQFSSLES 72

Query: 63  SVQMNSTLQEL---LKSNNLAQASSYIGKNI 90
              + ST+  +    KS+   QASS +G+++
Sbjct: 73  MQNLTSTVDTIASSYKSSQALQASSLVGRSV 103


>gi|52080230|ref|YP_079021.1| flagellar basal body rod modification protein [Bacillus
           licheniformis ATCC 14580]
 gi|52785607|ref|YP_091436.1| flagellar basal body rod modification protein [Bacillus
           licheniformis ATCC 14580]
 gi|319645991|ref|ZP_08000221.1| YlxG protein [Bacillus sp. BT1B_CT2]
 gi|52003441|gb|AAU23383.1| Flagellar hook capping protein [Bacillus licheniformis ATCC 14580]
 gi|52348109|gb|AAU40743.1| YlxG [Bacillus licheniformis ATCC 14580]
 gi|317391741|gb|EFV72538.1| YlxG protein [Bacillus sp. BT1B_CT2]
          Length = 155

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (63%), Gaps = 1/77 (1%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK 75
           K+ S   LG+D FLKLL+ Q+++QDP  PM+  E +AQ+A FS +EQ   +N+T+   + 
Sbjct: 33  KAGSGSNLGKDEFLKLLMKQLQYQDPLNPMEDREFIAQMATFSSLEQLTNLNTTMSTFVG 92

Query: 76  -SNNLAQASSYIGKNIT 91
             + +    S+IGK +T
Sbjct: 93  LQDPMTMYVSWIGKEVT 109


>gi|116328902|ref|YP_798622.1| endoflagellar hook capping protein [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116330491|ref|YP_800209.1| endoflagellar hook capping protein [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
 gi|116121646|gb|ABJ79689.1| Endoflagellar hook capping protein [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116124180|gb|ABJ75451.1| Endoflagellar hook capping protein [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
          Length = 271

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 62/107 (57%), Gaps = 8/107 (7%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA 80
           K+LG+D FLKLLITQ+  QDPT P+K  + +AQ+A FS +E   QMN+    + K  N  
Sbjct: 50  KSLGKDDFLKLLITQLSSQDPTNPVKDQDFIAQMAQFSSLE---QMNNISTGIQKMGN-R 105

Query: 81  QASSYIGKNITNAD----GSISGVVNAIQVSSTGLTAITVDNTEIPI 123
           Q+ S +GK ++  D     +++G+  A+     G T + V+   I +
Sbjct: 106 QSFSLVGKLVSGPDFVTGENVAGIAGALFFDGEGKTFVRVNGRSIDV 152


>gi|261856361|ref|YP_003263644.1| flagellar hook capping protein [Halothiobacillus neapolitanus c2]
 gi|261836830|gb|ACX96597.1| flagellar hook capping protein [Halothiobacillus neapolitanus c2]
          Length = 245

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 75/135 (55%), Gaps = 28/135 (20%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST---LQELLKSN 77
           ++L  ++F+KLL TQ+++QDPT P   S+ +AQLA FS ++   Q+N+T    Q  L+S+
Sbjct: 38  ESLDMNSFMKLLTTQLQNQDPTNPTDNSQMIAQLAQFSSLQGISQLNTTVNGFQSTLQSS 97

Query: 78  NLAQASSYIGK------------NITNADGSI--SGVVNAIQVSSTGLTAIT-------- 115
            + QA++ +GK            N T ADG+   SG++ A+ +  TG T+++        
Sbjct: 98  QIMQAAALVGKAAIVKGDTAHMYNSTAADGTTKASGILGAVDI-PTGATSVSVSITNASG 156

Query: 116 --VDNTEIPITTGIR 128
             VD   +P++   R
Sbjct: 157 QVVDTQSVPVSGSAR 171


>gi|259417403|ref|ZP_05741322.1| flagellar basal body rod modification protein [Silicibacter sp.
           TrichCH4B]
 gi|259346309|gb|EEW58123.1| flagellar basal body rod modification protein [Silicibacter sp.
           TrichCH4B]
          Length = 231

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 46/68 (67%), Gaps = 3/68 (4%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS---NNLAQA 82
           + FL+L+ TQ K+QDP EPM +S+  AQLA FS +EQ V  N TL  +L +   +N++Q 
Sbjct: 34  ETFLRLMTTQAKYQDPLEPMDSSDYTAQLAQFSSVEQQVLTNETLTSMLTALSLSNMSQL 93

Query: 83  SSYIGKNI 90
           + ++GK +
Sbjct: 94  TGWVGKEV 101


>gi|157364670|ref|YP_001471437.1| flagellar hook capping protein [Thermotoga lettingae TMO]
 gi|157315274|gb|ABV34373.1| flagellar hook capping protein [Thermotoga lettingae TMO]
          Length = 219

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 22 TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL--LKSNNL 79
          TL +DAFL LLITQ+K+QDP EPM   + +AQL  FS +EQ   M +++QE   L+   L
Sbjct: 22 TLDKDAFLLLLITQLKNQDPLEPMDNKDFIAQLTQFSTLEQITNMTNSIQEFLTLQEGAL 81

Query: 80 -AQASSYIGKNIT 91
           AQ++S IGK  T
Sbjct: 82 QAQSASLIGKYAT 94


>gi|154252633|ref|YP_001413457.1| flagellar hook capping protein [Parvibaculum lavamentivorans DS-1]
 gi|154156583|gb|ABS63800.1| flagellar hook capping protein [Parvibaculum lavamentivorans DS-1]
          Length = 226

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 10/81 (12%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN---NLAQA 82
           D FLKLL TQ++HQDPT PM + +   QL   S +EQS+Q N  L+ L+ +N   N +Q+
Sbjct: 31  DTFLKLLTTQLQHQDPTNPMSSDQFTQQLVQMSGVEQSIQTNRYLETLITANAIQNASQS 90

Query: 83  SSYIGKNITN-------ADGS 96
            S +GK +T        ADGS
Sbjct: 91  VSLLGKEVTGSGTGTLLADGS 111


>gi|148546705|ref|YP_001266807.1| flagellar basal body rod modification protein [Pseudomonas putida
           F1]
 gi|148510763|gb|ABQ77623.1| flagellar hook capping protein [Pseudomonas putida F1]
          Length = 234

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 50/72 (69%), Gaps = 3/72 (4%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQELLKSNN 78
           +LG+DAFL+LL+TQ++HQ+P +P   SE VAQLA FS +E    +N   S++   + S+ 
Sbjct: 37  SLGKDAFLQLLVTQMQHQNPLDPQDNSEFVAQLAQFSSLEGITSLNDSVSSITSAMASSQ 96

Query: 79  LAQASSYIGKNI 90
             QASS +G+++
Sbjct: 97  ALQASSLVGRSV 108


>gi|302185584|ref|ZP_07262257.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. syringae 642]
          Length = 229

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 62/99 (62%), Gaps = 6/99 (6%)

Query: 3   INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           +N+  NPT    + + S  TLG+D+FL+LL+TQ+K+Q+P +P   ++ VAQLA FS +E 
Sbjct: 16  LNSLQNPTP---TATNSTGTLGKDSFLQLLVTQMKNQNPLDPQDNTQFVAQLAQFSSLES 72

Query: 63  SVQMNSTLQEL---LKSNNLAQASSYIGKNITNADGSIS 98
              + ST+  +    KS+   QASS +G+++    GS S
Sbjct: 73  MQNLTSTVDTIATSYKSSQALQASSLVGRSVIIDSGSTS 111


>gi|217077694|ref|YP_002335412.1| basal-body rod modification protein FlgD [Thermosipho africanus
          TCF52B]
 gi|217037549|gb|ACJ76071.1| basal-body rod modification protein FlgD [Thermosipho africanus
          TCF52B]
          Length = 222

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 53/76 (69%), Gaps = 3/76 (3%)

Query: 16 KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK 75
          K + KK L ++AFL+LL+TQ+K+QDP EP+K  E +AQ+   S +EQ   M+ ++Q+ ++
Sbjct: 19 KQEIKKELDKEAFLELLVTQLKNQDPLEPLKDREFIAQMTQLSTLEQITNMSESVQKFVE 78

Query: 76 SN---NLAQASSYIGK 88
          S+     AQASS +GK
Sbjct: 79 SSASLYRAQASSMVGK 94


>gi|78356755|ref|YP_388204.1| basal-body rod modification protein FlgD [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
 gi|78219160|gb|ABB38509.1| basal-body rod modification protein FlgD [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
          Length = 263

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 52/92 (56%), Gaps = 4/92 (4%)

Query: 10  TQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST 69
           T   ++K K    LG++ FL LL+TQ+ HQDP  PM   E VAQLA FS +EQ   ++  
Sbjct: 16  TNDPYAKRKGAD-LGKEDFLTLLVTQLSHQDPLNPMDDKEFVAQLAQFSSLEQLTNISGG 74

Query: 70  LQELLKSNNLAQ---ASSYIGKNITNADGSIS 98
           +  L  ++N  Q   A  +IGK +  A  S+S
Sbjct: 75  IDNLNDASNQGQMISAVGFIGKEVRAAGNSLS 106


>gi|89098637|ref|ZP_01171519.1| flagellar basal body rod modification protein D [Bacillus sp. NRRL
           B-14911]
 gi|89086599|gb|EAR65718.1| flagellar basal body rod modification protein D [Bacillus sp. NRRL
           B-14911]
          Length = 211

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 71/126 (56%), Gaps = 20/126 (15%)

Query: 16  KSKSKKT----LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
           K   +KT    LG+D FLK+L+ Q+++QDP+ P++  + +AQ+A FS +EQ   MN+++Q
Sbjct: 15  KKDERKTGSDILGKDDFLKILMVQLQNQDPSNPLQDKDFIAQMATFSSLEQMTNMNTSIQ 74

Query: 72  ELL---KSNNLAQASSYIGKNIT----------NADGSI---SGVVNAIQVSSTGLTAIT 115
           +L+   + ++L   S + GK I           NA  SI   +G V++IQ  +     I 
Sbjct: 75  KLVQMQEQDSLIAYSEFAGKEIKWHKVAESDDPNAQPSIEEGTGRVSSIQFKNGNAVFIL 134

Query: 116 VDNTEI 121
            D TE+
Sbjct: 135 EDGTEL 140


>gi|330875982|gb|EGH10131.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. morsprunorum str. M302280PT]
 gi|330967089|gb|EGH67349.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. actinidiae str. M302091]
          Length = 229

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 56/86 (65%), Gaps = 6/86 (6%)

Query: 8   NPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN 67
           NPT    + + S  TLG+DAFL+LL+TQ+K+Q+P +P   ++ VAQLA FS +E    + 
Sbjct: 21  NPTP---TATNSTGTLGKDAFLQLLVTQMKNQNPLDPQDNTQFVAQLAQFSSLESMQNLT 77

Query: 68  STLQEL---LKSNNLAQASSYIGKNI 90
           ST+  +    KS+   QASS +G+++
Sbjct: 78  STVDTIATSYKSSQALQASSLVGRSV 103


>gi|283850851|ref|ZP_06368137.1| flagellar hook capping protein [Desulfovibrio sp. FW1012B]
 gi|283573774|gb|EFC21748.1| flagellar hook capping protein [Desulfovibrio sp. FW1012B]
          Length = 235

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KSNNL 79
          LGQDAFL+LL+TQ+++QDP  PM   E VA+LA FS +EQ  ++N+ +  L        L
Sbjct: 28 LGQDAFLQLLVTQLQYQDPLNPMDDKEFVAELAQFSSLEQLTEINTGIDNLAIQGTQQQL 87

Query: 80 AQASSYIGKNI 90
            A ++IGK I
Sbjct: 88 LGAVNFIGKTI 98


>gi|219670135|ref|YP_002460570.1| flagellar hook capping protein [Desulfitobacterium hafniense DCB-2]
 gi|219540395|gb|ACL22134.1| flagellar hook capping protein [Desulfitobacterium hafniense DCB-2]
          Length = 184

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 57/93 (61%), Gaps = 7/93 (7%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE------ 72
           +K+ LG+D FLKLL+ ++ +QDP  PM   + + Q+A FS +EQ   M+ +++       
Sbjct: 28  TKEVLGKDDFLKLLVAELTNQDPLSPMDNKDMITQMAQFSSLEQMNNMSKSMENLVGAFG 87

Query: 73  -LLKSNNLAQASSYIGKNITNADGSISGVVNAI 104
            L +++ L+Q ++ IGK++  A+   SG VN I
Sbjct: 88  ALFQNSLLSQGAALIGKHVEGANIDGSGFVNGI 120


>gi|20807882|ref|NP_623053.1| flagellar hook capping protein [Thermoanaerobacter tengcongensis
           MB4]
 gi|20516447|gb|AAM24657.1| Flagellar hook capping protein [Thermoanaerobacter tengcongensis
           MB4]
          Length = 131

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 73/133 (54%), Gaps = 20/133 (15%)

Query: 1   MEINTEVN---PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVF 57
           M +NT  +   P+ Q    +KSK  LG+D FL LL+TQ+K+QDP  P+   E +AQLA F
Sbjct: 1   MNVNTNYSVLPPSNQNKVTTKSK--LGKDDFLMLLVTQLKNQDPLNPVDDKEFLAQLAQF 58

Query: 58  SQMEQSVQMNSTLQELLKSNNLAQASSYIGKNI--TNADGS-----ISGVVNAIQVSSTG 110
           S +EQ       +Q L +S N  +A + IGKN+  T  DG+     + G V+A+     G
Sbjct: 59  SALEQ-------MQNLNESFNSVKAIALIGKNVYATINDGNGNYKEVFGKVDAV-YRENG 110

Query: 111 LTAITVDNTEIPI 123
              + V   +IP+
Sbjct: 111 QYFLKVKGLDIPL 123


>gi|296123338|ref|YP_003631116.1| flagellar hook capping protein [Planctomyces limnophilus DSM 3776]
 gi|296015678|gb|ADG68917.1| flagellar hook capping protein [Planctomyces limnophilus DSM 3776]
          Length = 139

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 68/112 (60%), Gaps = 4/112 (3%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           L  +AF+KLLITQ+++QDP+ PM   E ++Q++    +   +++   L+ L  S  L  +
Sbjct: 27  LDTEAFMKLLITQLQNQDPSNPMSNEELLSQISQMRNLTSDIELTDALEGLTLSQQLNSS 86

Query: 83  SSYIGKNI--TNADGS-ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           ++++GK I  T A+G+ +SGVV+ + V     + + V + E+P+T    ++N
Sbjct: 87  TAFLGKEIKGTTANGTEVSGVVDRVYVKDKA-SFLVVGDKEVPLTNVTDVTN 137


>gi|218778869|ref|YP_002430187.1| flagellar hook capping protein [Desulfatibacillum alkenivorans
           AK-01]
 gi|218760253|gb|ACL02719.1| Flagellar basal body rod modification protein [Desulfatibacillum
           alkenivorans AK-01]
          Length = 230

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (59%), Gaps = 8/94 (8%)

Query: 8   NPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN 67
           NPT +      +   LGQ+ FL+LLI Q+K+QDP  PM+ ++  AQLA FS +EQ   + 
Sbjct: 17  NPTTE-----STGTGLGQEDFLQLLIAQLKNQDPLNPMEGTDFTAQLAQFSSLEQLFGIG 71

Query: 68  STLQELL--KSNNLAQASSY-IGKNITNADGSIS 98
            +L+E+L  +SNN      Y +GK I   D S++
Sbjct: 72  DSLEEMLSIQSNNGTGDVGYLLGKVIVAEDDSLT 105


>gi|251797438|ref|YP_003012169.1| flagellar hook capping protein [Paenibacillus sp. JDR-2]
 gi|247545064|gb|ACT02083.1| flagellar hook capping protein [Paenibacillus sp. JDR-2]
          Length = 182

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 67/123 (54%), Gaps = 9/123 (7%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK 75
           K   K  LG+DAFL+LL+TQ+K+QDP +P   +  + Q+A F+ +EQ + M+  L   L 
Sbjct: 23  KDTDKNALGKDAFLELLVTQLKNQDPLQPQDNAAFITQMAQFTSVEQLMNMSDQLS--LL 80

Query: 76  SNNLAQASSYIGKNITNADGSISG-------VVNAIQVSSTGLTAITVDNTEIPITTGIR 128
           + NL  ASS IGK ++  +   +G        VN+I      L A   D T I ++  + 
Sbjct: 81  NQNLGTASSIIGKTVSWYELDDAGQTKLMYDAVNSIVSQDGTLYAKFADETMIKLSDVVT 140

Query: 129 ISN 131
           +S+
Sbjct: 141 VSD 143


>gi|237799205|ref|ZP_04587666.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. oryzae str. 1_6]
 gi|237806224|ref|ZP_04592928.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. oryzae str. 1_6]
 gi|331022060|gb|EGI02117.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. oryzae str. 1_6]
 gi|331027337|gb|EGI07392.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. oryzae str. 1_6]
          Length = 229

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 61/99 (61%), Gaps = 6/99 (6%)

Query: 3   INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           +NT  NPT    + + S  TLG+D+FL+LL+TQ+K+Q+P +P   ++ VAQLA FS +E 
Sbjct: 16  LNTLQNPTP---TATNSTGTLGKDSFLQLLVTQMKNQNPLDPQDNTQFVAQLAQFSSLES 72

Query: 63  SVQMNSTLQEL---LKSNNLAQASSYIGKNITNADGSIS 98
              +  T+  +    KS+   QASS +G+++    GS S
Sbjct: 73  MQNLTKTVDTIAGSYKSSQALQASSLVGRSVIIDSGSTS 111


>gi|296133042|ref|YP_003640289.1| flagellar hook capping protein [Thermincola sp. JR]
 gi|296031620|gb|ADG82388.1| flagellar hook capping protein [Thermincola potens JR]
          Length = 146

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 66/121 (54%), Gaps = 12/121 (9%)

Query: 12  QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST-- 69
           QE      K  LG+D FLKLL+TQ+K+QDP EP    + +AQ+A FS +EQ   M+    
Sbjct: 16  QEAVSRTVKNVLGKDDFLKLLLTQLKYQDPLEPTDNKDFIAQMAQFSALEQMTNMSDGFT 75

Query: 70  ----LQE-LLKSNNLAQASSYIGKNI----TNADGSISGVVNAIQVSSTGLTAITVDNTE 120
               +QE L + + ++QA   IGK +     + +  ++G V A+++   G   + V+  E
Sbjct: 76  KLVQMQETLFRESTVSQAVGLIGKKVEATLPDQNEPLTGFVTAMKIVD-GEPRVVVNGKE 134

Query: 121 I 121
           I
Sbjct: 135 I 135


>gi|99082818|ref|YP_614972.1| flagellar basal body rod modification protein [Ruegeria sp. TM1040]
 gi|99039098|gb|ABF65710.1| flagellar basal-body rod modification protein FlgD [Ruegeria sp.
           TM1040]
          Length = 231

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 4/76 (5%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS---NNLAQASS 84
           FL+L+ TQ K+QDP EPM +S+  AQLA FS +EQ V  N TL  +L +   +N++Q + 
Sbjct: 36  FLRLMTTQAKYQDPLEPMDSSDYTAQLAQFSSVEQQVLTNETLTSMLTALSLSNMSQLTG 95

Query: 85  YIGKNI-TNADGSISG 99
           ++G+ +   A G   G
Sbjct: 96  WVGREVRAQAAGYFDG 111


>gi|78224297|ref|YP_386044.1| flagellar hook capping protein [Geobacter metallireducens GS-15]
 gi|78195552|gb|ABB33319.1| Flagellar hook capping protein [Geobacter metallireducens GS-15]
          Length = 218

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 6/81 (7%)

Query: 20 KKTLG--QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
          KK+ G  +D FLKL +TQ++HQDP  P  +SE + QLA  +Q+EQ+   NS L +++   
Sbjct: 17 KKSTGMNKDDFLKLFVTQLQHQDPLNPADSSEFIGQLAQLTQVEQAYNTNSNLTKIIDLF 76

Query: 78 NLA---QASSYIGKNIT-NAD 94
          N A    + SYIGK++T N D
Sbjct: 77 NGATSLSSVSYIGKSVTANGD 97


>gi|167034945|ref|YP_001670176.1| flagellar basal body rod modification protein [Pseudomonas putida
           GB-1]
 gi|166861433|gb|ABY99840.1| flagellar hook capping protein [Pseudomonas putida GB-1]
          Length = 233

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNL 79
           LG+DAFL+LL+TQ+K+Q+P +P +  E VAQLA FS +E    +N ++  +   L+S+  
Sbjct: 36  LGKDAFLQLLVTQMKNQNPLDPQENGEFVAQLAQFSSLESMQSLNDSVTYIAAGLQSSQA 95

Query: 80  AQASSYIGKNI 90
            QASS +G+N+
Sbjct: 96  LQASSLVGRNV 106


>gi|325289232|ref|YP_004265413.1| flagellar hook capping protein [Syntrophobotulus glycolicus DSM
           8271]
 gi|324964633|gb|ADY55412.1| flagellar hook capping protein [Syntrophobotulus glycolicus DSM
           8271]
          Length = 263

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 69/125 (55%), Gaps = 7/125 (5%)

Query: 3   INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           +N+    T    S   +  +L ++ FL LL+TQ+K+QDP  P  ++E V+QLA FS +EQ
Sbjct: 6   VNSTSYTTAGTASSRDTSTSLDKEDFLNLLVTQLKYQDPLNPSDSTEYVSQLAQFSLLEQ 65

Query: 63  SVQMNSTLQELLKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLTAITVDNT 119
              MN++L+ L     L     YI  ++T + G   ++ G V+++ +S+ G  A+ V   
Sbjct: 66  MTNMNTSLEAL---EALTMTGKYITASVTGSSGETTTVEGTVDSVTMSN-GEAALVVGGK 121

Query: 120 EIPIT 124
            I ++
Sbjct: 122 SIELS 126


>gi|296126536|ref|YP_003633788.1| flagellar hook capping protein [Brachyspira murdochii DSM 12563]
 gi|296018352|gb|ADG71589.1| flagellar hook capping protein [Brachyspira murdochii DSM 12563]
          Length = 263

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 55/104 (52%), Gaps = 3/104 (2%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           Q  F +  ++ +LG+DAFLKLL  Q+ HQDP  PM   + +AQLA FS +EQ  ++N  L
Sbjct: 27  QNNFQRDPTQNSLGKDAFLKLLTVQMSHQDPLSPMDNRDMIAQLAQFSSVEQMTEVNKNL 86

Query: 71  QELLKSNNLAQASSYIGKNI---TNADGSISGVVNAIQVSSTGL 111
             +    +     S +GK++     A     G V  +  + TG+
Sbjct: 87  DSMKTFYSSQTGYSMLGKSVEVMDEAGNRFLGPVEMVMENDTGV 130


>gi|149178722|ref|ZP_01857305.1| probable basal-body rod modification protein FlgD [Planctomyces
           maris DSM 8797]
 gi|148842420|gb|EDL56800.1| probable basal-body rod modification protein FlgD [Planctomyces
           maris DSM 8797]
          Length = 145

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 66/102 (64%), Gaps = 4/102 (3%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSY 85
           ++F+KLLIT++++QDPTEP+   + +AQ++   +++ +++++ TL+E+    +L QA++ 
Sbjct: 34  ESFMKLLITELQNQDPTEPLGNEQLLAQISSMRELQSNIELSDTLKEITTGQSLTQAAAL 93

Query: 86  IGKNITNADG---SISGVVNAIQVSSTGLTAITVDNTEIPIT 124
           IGK +   +G    ++GVV    V   G + + +   E+P++
Sbjct: 94  IGKEVEGQEGQQNPVAGVVERAFVRD-GKSYVGIGAFELPVS 134


>gi|42528269|ref|NP_973367.1| flagellar basal body rod modification protein [Treponema denticola
           ATCC 35405]
 gi|4580017|gb|AAD24205.1|AF049342_3 flagellar hook assembly protein FlgD [Treponema denticola ATCC
           33520]
 gi|4426942|gb|AAD20616.1| flagellar hook assembly scaffolding protein FlgD [Treponema
           denticola]
 gi|41819539|gb|AAS13286.1| flagellar hook assembly scaffolding protein [Treponema denticola
           ATCC 35405]
 gi|325474541|gb|EGC77727.1| flagellar hook assembly protein FlgD [Treponema denticola F0402]
          Length = 169

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 62/99 (62%), Gaps = 9/99 (9%)

Query: 11  QQEFSKSK-SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN-- 67
           +Q F++++  K+ LG+D FL+LLI Q+ HQDPT PM+ ++ + Q+A FS +EQ   MN  
Sbjct: 45  KQNFAETRVPKQQLGKDDFLQLLIAQLTHQDPTSPMEDTQFIGQMAQFSSLEQMTNMNKN 104

Query: 68  -STLQELLKSNNLAQASSYIGKNITNADGS--ISGVVNA 103
            + L EL+  ++   A   +GK +    GS  +SG ++A
Sbjct: 105 FAALNELMTGSSAVNA---VGKKVDLDLGSSQVSGYISA 140


>gi|56419761|ref|YP_147079.1| flagellar basal body rod modification protein [Geobacillus
           kaustophilus HTA426]
 gi|297530599|ref|YP_003671874.1| flagellar hook capping protein [Geobacillus sp. C56-T3]
 gi|56379603|dbj|BAD75511.1| flagellar hook capping protein [Geobacillus kaustophilus HTA426]
 gi|297253851|gb|ADI27297.1| flagellar hook capping protein [Geobacillus sp. C56-T3]
          Length = 142

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 64/101 (63%), Gaps = 6/101 (5%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN---L 79
           LG+D FLK+L+ Q+++QDP  PM+  + +AQ+A FS +EQ + + + +Q+ +++++   L
Sbjct: 27  LGKDDFLKILLAQLENQDPLNPMEDKDFIAQMASFSSLEQMMNIANLMQQWMQASSRDAL 86

Query: 80  AQASSYIGKNITNADGS--ISGVVNAIQVSSTGLTAITVDN 118
            + S +IGK +   DG   +S VV ++ +   G   + +DN
Sbjct: 87  LRYSEWIGKTVHWQDGETMMSAVVQSV-MQKDGQVTLGLDN 126


>gi|315281357|ref|ZP_07869997.1| flagellar hook capping protein [Listeria marthii FSL S4-120]
 gi|313614996|gb|EFR88500.1| flagellar hook capping protein [Listeria marthii FSL S4-120]
          Length = 140

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 68/111 (61%), Gaps = 7/111 (6%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
           KTLG+D F+KL +T +++QDP+ P+  +E ++Q+A  S MEQ   M + + +L    +++
Sbjct: 24  KTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQAQNS 83

Query: 78  NLAQASSYIGKNITNA--DGS-ISGVVNAIQVSSTGLTAITVDNTE-IPIT 124
            L  A ++IGK+I     +G  ISG V ++Q ++ G+     DN   +P+T
Sbjct: 84  ALQSAVNFIGKDIKGVSLNGEVISGKVESVQQTTNGVMLKLKDNDSLVPMT 134


>gi|16802738|ref|NP_464223.1| flagellar basal body rod modification protein [Listeria
           monocytogenes EGD-e]
 gi|47095262|ref|ZP_00232873.1| flagellar hook assembly protein FlgD [Listeria monocytogenes str.
           1/2a F6854]
 gi|116872085|ref|YP_848866.1| flagellar basal body rod modification protein [Listeria welshimeri
           serovar 6b str. SLCC5334]
 gi|224498778|ref|ZP_03667127.1| flagellar basal body rod modification protein [Listeria
           monocytogenes Finland 1988]
 gi|224501999|ref|ZP_03670306.1| flagellar basal body rod modification protein [Listeria
           monocytogenes FSL R2-561]
 gi|254829353|ref|ZP_05234040.1| flgD [Listeria monocytogenes FSL N3-165]
 gi|254830313|ref|ZP_05234968.1| flagellar basal body rod modification protein [Listeria
           monocytogenes 10403S]
 gi|254900068|ref|ZP_05259992.1| flagellar basal body rod modification protein [Listeria
           monocytogenes J0161]
 gi|254911379|ref|ZP_05261391.1| flagellar hook assembly protein FlgD [Listeria monocytogenes J2818]
 gi|254935706|ref|ZP_05267403.1| flgD [Listeria monocytogenes F6900]
 gi|255028842|ref|ZP_05300793.1| flagellar basal body rod modification protein [Listeria
           monocytogenes LO28]
 gi|284801026|ref|YP_003412891.1| flagellar basal body rod modification protein [Listeria
           monocytogenes 08-5578]
 gi|284994168|ref|YP_003415936.1| flagellar basal body rod modification protein [Listeria
           monocytogenes 08-5923]
 gi|16410085|emb|CAC98774.1| lmo0696 [Listeria monocytogenes EGD-e]
 gi|47016333|gb|EAL07255.1| flagellar hook assembly protein FlgD [Listeria monocytogenes str.
           1/2a F6854]
 gi|116740963|emb|CAK20083.1| flagellar hook assembly protein FlgD [Listeria welshimeri serovar
           6b str. SLCC5334]
 gi|258601766|gb|EEW15091.1| flgD [Listeria monocytogenes FSL N3-165]
 gi|258608289|gb|EEW20897.1| flgD [Listeria monocytogenes F6900]
 gi|284056588|gb|ADB67529.1| flagellar basal body rod modification protein [Listeria
           monocytogenes 08-5578]
 gi|284059635|gb|ADB70574.1| flagellar basal body rod modification protein [Listeria
           monocytogenes 08-5923]
 gi|293589316|gb|EFF97650.1| flagellar hook assembly protein FlgD [Listeria monocytogenes J2818]
          Length = 140

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 68/111 (61%), Gaps = 7/111 (6%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
           KTLG+D F+KL +T +++QDP+ P+  +E ++Q+A  S MEQ   M + + +L    +++
Sbjct: 24  KTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQAQNS 83

Query: 78  NLAQASSYIGKNITNA--DGS-ISGVVNAIQVSSTGLTAITVDNTE-IPIT 124
            L  A ++IGK+I     +G  ISG V ++Q ++ G+     DN   +P+T
Sbjct: 84  ALQSAVNFIGKDIKGVSLNGEVISGKVESVQQTTNGVMLKLKDNDSLVPMT 134


>gi|260893869|ref|YP_003239966.1| flagellar hook capping protein [Ammonifex degensii KC4]
 gi|260866010|gb|ACX53116.1| flagellar hook capping protein [Ammonifex degensii KC4]
          Length = 136

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 70/130 (53%), Gaps = 8/130 (6%)

Query: 1   MEINTEVNPTQQEFSKSKSKKT-----LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLA 55
           M+++T + PT    + S ++         +D FLK+L+ Q+ H DP  P K    +++++
Sbjct: 1   MDVSTLMAPTAGTSAASTTEAASSLFRWSKDTFLKILVAQLSHPDPFSPPKPETIISEMS 60

Query: 56  VFSQMEQSVQMNSTLQELLKSNNLAQASSYIGKNIT-NADGS-ISGVVNAIQVSSTGLTA 113
             + +EQ +++ S+L    +   L Q +S +GK +T  ADGS ++G V  +++   G   
Sbjct: 61  NLALLEQMMRLTSSLDSFSRWLELGQGASLVGKRVTVEADGSAVTGTVEKVRLED-GKIR 119

Query: 114 ITVDNTEIPI 123
           + +D  E P+
Sbjct: 120 LVIDGREYPL 129


>gi|46906947|ref|YP_013336.1| flagellar basal body rod modification protein [Listeria
           monocytogenes serotype 4b str. F2365]
 gi|47091658|ref|ZP_00229454.1| flagellar hook assembly protein FlgD [Listeria monocytogenes str.
           4b H7858]
 gi|217965206|ref|YP_002350884.1| flagellar hook capping protein [Listeria monocytogenes HCC23]
 gi|226223327|ref|YP_002757434.1| flagellar hook assembly protein [Listeria monocytogenes Clip81459]
 gi|254824024|ref|ZP_05229025.1| flagellar hook assembly protein FlgD [Listeria monocytogenes FSL
           J1-194]
 gi|254853100|ref|ZP_05242448.1| flagellar hook assembly protein FlgD [Listeria monocytogenes FSL
           R2-503]
 gi|254932024|ref|ZP_05265383.1| flagellar hook assembly protein FlgD [Listeria monocytogenes
           HPB2262]
 gi|254994098|ref|ZP_05276288.1| flagellar basal body rod modification protein [Listeria
           monocytogenes FSL J2-064]
 gi|255521909|ref|ZP_05389146.1| flagellar basal body rod modification protein [Listeria
           monocytogenes FSL J1-175]
 gi|290893993|ref|ZP_06556968.1| flagellar hook assembly protein FlgD [Listeria monocytogenes FSL
           J2-071]
 gi|300764508|ref|ZP_07074501.1| flagellar hook assembly protein FlgD [Listeria monocytogenes FSL
           N1-017]
 gi|46880213|gb|AAT03513.1| flagellar hook assembly protein FlgD [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|47019977|gb|EAL10714.1| flagellar hook assembly protein FlgD [Listeria monocytogenes str.
           4b H7858]
 gi|217334476|gb|ACK40270.1| flagellar hook capping protein [Listeria monocytogenes HCC23]
 gi|225875789|emb|CAS04492.1| Putative flagellar hook assembly protein [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|258606449|gb|EEW19057.1| flagellar hook assembly protein FlgD [Listeria monocytogenes FSL
           R2-503]
 gi|290556439|gb|EFD89978.1| flagellar hook assembly protein FlgD [Listeria monocytogenes FSL
           J2-071]
 gi|293583576|gb|EFF95608.1| flagellar hook assembly protein FlgD [Listeria monocytogenes
           HPB2262]
 gi|293593252|gb|EFG01013.1| flagellar hook assembly protein FlgD [Listeria monocytogenes FSL
           J1-194]
 gi|300514862|gb|EFK41916.1| flagellar hook assembly protein FlgD [Listeria monocytogenes FSL
           N1-017]
 gi|307570235|emb|CAR83414.1| flagellar hook assembly protein [Listeria monocytogenes L99]
 gi|313610130|gb|EFR85449.1| flagellar hook capping protein [Listeria monocytogenes FSL F2-208]
 gi|328467263|gb|EGF38343.1| flagellar basal body rod modification protein [Listeria
           monocytogenes 1816]
 gi|328475659|gb|EGF46408.1| flagellar basal body rod modification protein [Listeria
           monocytogenes 220]
 gi|332311121|gb|EGJ24216.1| Flagellar hook assembly protein FlgD [Listeria monocytogenes str.
           Scott A]
          Length = 140

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 68/111 (61%), Gaps = 7/111 (6%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
           KTLG+D F+KL +T +++QDP+ P+  +E ++Q+A  S MEQ   M + + +L    +++
Sbjct: 24  KTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQAQNS 83

Query: 78  NLAQASSYIGKNITNA--DGS-ISGVVNAIQVSSTGLTAITVDNTE-IPIT 124
            L  A ++IGK+I     +G  ISG V ++Q ++ G+     DN   +P+T
Sbjct: 84  ALQSAVNFIGKDIKGVSLNGEVISGKVESVQQTTNGVMLKLKDNDSLVPMT 134


>gi|115523198|ref|YP_780109.1| flagellar basal body rod modification protein [Rhodopseudomonas
           palustris BisA53]
 gi|115517145|gb|ABJ05129.1| flagellar hook capping protein [Rhodopseudomonas palustris BisA53]
          Length = 135

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 64/112 (57%), Gaps = 3/112 (2%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
           T+G + FL+LLI Q+K+QDP+ P   ++ ++Q A  S +EQ++Q N+ L  LL ++ L+Q
Sbjct: 24  TVGYNEFLQLLIAQMKNQDPSNPTDMAQYMSQFAQLSSVEQAIQTNAKLDTLLSTSALSQ 83

Query: 82  ASSYIGKNITNAD---GSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           A   IG+  +  D    S +G + ++ +   G  A      ++ +  GI IS
Sbjct: 84  AEGLIGRTASFTDEAGHSATGKIASVSIIQGGAVATLDTGVQVLLGPGITIS 135


>gi|330961195|gb|EGH61455.1| flagellar basal body rod modification protein [Pseudomonas
          syringae pv. maculicola str. ES4326]
          Length = 214

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 59/91 (64%), Gaps = 6/91 (6%)

Query: 3  INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
          +NT  NPT    + + S  TLG+D+FL+LL+TQ+K+Q+P +P   ++ VAQLA FS +E 
Sbjct: 1  MNTLQNPTP---TATNSTGTLGKDSFLQLLVTQMKNQNPLDPQDNTQFVAQLAQFSSLES 57

Query: 63 SVQMNSTLQEL---LKSNNLAQASSYIGKNI 90
             + +T+  +    KS+   QASS +G+++
Sbjct: 58 MQNLTTTVDTIASSYKSSQALQASSLVGRSV 88


>gi|121533755|ref|ZP_01665582.1| flagellar hook capping protein [Thermosinus carboxydivorans Nor1]
 gi|121307746|gb|EAX48661.1| flagellar hook capping protein [Thermosinus carboxydivorans Nor1]
          Length = 136

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 60/105 (57%), Gaps = 10/105 (9%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           K    LG+D FLKLL+ Q+++QDP +PM+  E +AQ+A FS +EQ   +NST+  +    
Sbjct: 22  KKNDQLGKDDFLKLLVAQLRYQDPMKPMEDKEFIAQMAQFSSLEQIQNLNSTMVTM---- 77

Query: 78  NLAQASSYIGKNIT--NADGS-ISGVVNAIQVSSTGLTAITVDNT 119
              QA   IGK +   N +G+  +G V A+++S      +  D T
Sbjct: 78  ---QAMGLIGKTVRWQNENGAEQAGNVRAVKISDRQPYIVVGDTT 119


>gi|225181605|ref|ZP_03735046.1| flagellar hook capping protein [Dethiobacter alkaliphilus AHT 1]
 gi|225167713|gb|EEG76523.1| flagellar hook capping protein [Dethiobacter alkaliphilus AHT 1]
          Length = 141

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 67/101 (66%), Gaps = 5/101 (4%)

Query: 10  TQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST 69
           TQQ    + + + + +D FL+LL+TQ+++QDP +P   SE VAQ+A F+ +EQ   +N+T
Sbjct: 13  TQQSNKATGAMQEMDKDMFLQLLVTQLRYQDPLDPQDNSEFVAQMAQFTSLEQMQNLNNT 72

Query: 70  LQELL--KSNNLAQASSYIGKNITNADGS---ISGVVNAIQ 105
           + +LL  +S+    A +++G ++T  D +   ++G+V+A++
Sbjct: 73  MAKLLDIQSSLHNSAPAFLGLSVTVKDDNGLPLTGIVSAVE 113


>gi|149182510|ref|ZP_01860983.1| flagellar basal body rod modification protein D [Bacillus sp.
          SG-1]
 gi|148849770|gb|EDL63947.1| flagellar basal body rod modification protein D [Bacillus sp.
          SG-1]
          Length = 211

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 54/83 (65%), Gaps = 3/83 (3%)

Query: 12 QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          Q+  +   K  LG+D F+K+L+TQ+++QDP  PM+  + +AQ+A FS +EQ   ++ +++
Sbjct: 15 QQKQREGGKDVLGKDDFMKILMTQLQNQDPLNPMQDKDFIAQMATFSTLEQITNLSKSME 74

Query: 72 ELLKS---NNLAQASSYIGKNIT 91
            +++   NNL   + ++GK IT
Sbjct: 75 TFIEAQGQNNLIAYNQFVGKEIT 97


>gi|295696120|ref|YP_003589358.1| flagellar hook capping protein [Bacillus tusciae DSM 2912]
 gi|295411722|gb|ADG06214.1| flagellar hook capping protein [Bacillus tusciae DSM 2912]
          Length = 151

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 68/112 (60%), Gaps = 4/112 (3%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           L +++FL+LL+ Q+K+QDP +PM +++ ++QLA FS +EQ   +    ++   +  +  A
Sbjct: 30  LDKNSFLQLLVAQLKNQDPLQPMDSTQFISQLAQFSALEQMTNVAEGQEKAATATEMQAA 89

Query: 83  SSYIGKNITNAD--GSI-SGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           + +IGK I+  D  G+I SGV  A+QV   GL  + +    +P ++ + + +
Sbjct: 90  AEWIGKRISYLDDKGNIQSGVAQAMQVKE-GLVYLDLGGLSVPWSSILEVGD 140


>gi|261419426|ref|YP_003253108.1| flagellar basal body rod modification protein [Geobacillus sp.
           Y412MC61]
 gi|319766241|ref|YP_004131742.1| flagellar hook capping protein [Geobacillus sp. Y412MC52]
 gi|261375883|gb|ACX78626.1| flagellar hook capping protein [Geobacillus sp. Y412MC61]
 gi|317111107|gb|ADU93599.1| flagellar hook capping protein [Geobacillus sp. Y412MC52]
          Length = 142

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 66/108 (61%), Gaps = 6/108 (5%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK 75
           +    + LG+D FLK+L+ Q+++QDP  PM+  + +AQ+A FS +EQ + + + +Q+ ++
Sbjct: 20  RKTGNQILGKDDFLKILLAQLENQDPLNPMEDKDFIAQMANFSSLEQMMNIANLMQQWMQ 79

Query: 76  SNN---LAQASSYIGKNITNADGS--ISGVVNAIQVSSTGLTAITVDN 118
           +++   L + S +IGK +   DG   +S VV ++ +   G   + +DN
Sbjct: 80  ASSRDALLRYSEWIGKTVHWQDGETMMSAVVQSV-MQKDGQVTLGLDN 126


>gi|170722893|ref|YP_001750581.1| flagellar basal body rod modification protein [Pseudomonas putida
           W619]
 gi|169760896|gb|ACA74212.1| flagellar hook capping protein [Pseudomonas putida W619]
          Length = 235

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQELLKSNNL 79
           LG+DAFL+LL+TQ++HQ+P +P +  E VAQLA FS +E    +N   S++   + S+  
Sbjct: 39  LGKDAFLQLLVTQMQHQNPLDPQENGEFVAQLAQFSSLEGITSLNESVSSITNAMASSQA 98

Query: 80  AQASSYIGKNI 90
            QASS +G+++
Sbjct: 99  LQASSLVGRSV 109


>gi|260432283|ref|ZP_05786254.1| flagellar basal body rod modification protein [Silicibacter
          lacuscaerulensis ITI-1157]
 gi|260416111|gb|EEX09370.1| flagellar basal body rod modification protein [Silicibacter
          lacuscaerulensis ITI-1157]
          Length = 221

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 49/78 (62%), Gaps = 7/78 (8%)

Query: 20 KKTLGQ----DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL-- 73
          KKT G     + FLK+L  Q ++QDP EP+ +SE  AQLA FS +EQ VQ N  L  L  
Sbjct: 21 KKTSGLASDFETFLKMLTAQARNQDPLEPLDSSEYAAQLAQFSMVEQQVQTNELLDGLAG 80

Query: 74 -LKSNNLAQASSYIGKNI 90
           L + NL + +++IGK++
Sbjct: 81 TLSAANLTEMAAWIGKDV 98


>gi|297569154|ref|YP_003690498.1| flagellar hook capping protein [Desulfurivibrio alkaliphilus AHT2]
 gi|296925069|gb|ADH85879.1| flagellar hook capping protein [Desulfurivibrio alkaliphilus AHT2]
          Length = 251

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 57/91 (62%), Gaps = 5/91 (5%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK---SNN 78
           +L +  F+ L ITQ++HQDP +PM++ E  +QLA FS ME ++QM+  +++LL    S N
Sbjct: 28  SLDRQDFMTLFITQLQHQDPMKPMESYEMASQLAQFSSMEATMQMSDNMEKLLSYQMSQN 87

Query: 79  LAQASSYIGKNITNADGSISGVVNAIQVSST 109
             Q  S IGK I   DG+  GV +  QV+ T
Sbjct: 88  NLQLLSLIGKTI-ETDGNEIGVTDG-QVART 116


>gi|299534780|ref|ZP_07048110.1| hypothetical protein BFZC1_02077 [Lysinibacillus fusiformis ZC1]
 gi|298729868|gb|EFI70413.1| hypothetical protein BFZC1_02077 [Lysinibacillus fusiformis ZC1]
          Length = 230

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ---ELLKSNNL 79
           LG+DAFLKLLITQ++HQDPT PM   E ++Q+A FS +EQ   M   ++      + + +
Sbjct: 34  LGKDAFLKLLITQLQHQDPTNPMDDREFISQMAQFSSLEQMQNMTKAMESLLSSQQQSQM 93

Query: 80  AQASSYIGKNI 90
              +++IGK +
Sbjct: 94  MNYATFIGKEV 104


>gi|295110894|emb|CBL27644.1| Flagellar hook capping protein [Synergistetes bacterium SGP1]
          Length = 145

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 47/69 (68%), Gaps = 1/69 (1%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
          L ++AFLKLLI ++ +QDP  PM+  E +AQ+A FS +EQ   MN TL+ + +++    A
Sbjct: 26 LDKNAFLKLLIAELSNQDPLNPMEDREFIAQMAQFSSLEQMQNMNKTLESMAQASKF-DA 84

Query: 83 SSYIGKNIT 91
           SYIGK I+
Sbjct: 85 VSYIGKAIS 93


>gi|229544400|ref|ZP_04433458.1| flagellar hook capping protein [Bacillus coagulans 36D1]
 gi|229324885|gb|EEN90562.1| flagellar hook capping protein [Bacillus coagulans 36D1]
          Length = 215

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 62/112 (55%), Gaps = 14/112 (12%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA 80
           KTL +DAFLK+LI Q+++QDPT+PM  ++ V+Q+A FS +EQ   + + +  L+K +  +
Sbjct: 27  KTLDKDAFLKILIAQLQNQDPTKPMDDTQFVSQMAQFSSLEQMTNLKNDIDNLIKLSQQS 86

Query: 81  Q---ASSYIGKNI------TNADGSIS-----GVVNAIQVSSTGLTAITVDN 118
           Q    + YIG+ +      T  DG+ S     G +  I          T+D+
Sbjct: 87  QQIAYTQYIGRTVSWEKTETADDGTASVKSGTGTITGISFGDDNAVTFTLDD 138


>gi|56698286|ref|YP_168659.1| flagellar basal body rod modification protein [Ruegeria pomeroyi
           DSS-3]
 gi|56680023|gb|AAV96689.1| basal-body rod modification protein FlgD [Ruegeria pomeroyi DSS-3]
          Length = 222

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 50/79 (63%), Gaps = 8/79 (10%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQA 82
           D F+++L TQ K+Q+P EP+ +SE  AQLA FS +EQ  + N TL  L   L + ++A+ 
Sbjct: 32  DTFIRMLTTQAKYQNPLEPLDSSEYAAQLAQFSMVEQQTKTNDTLTALVEKLGATDMAKL 91

Query: 83  SSYIGKNI-----TNADGS 96
           S++IGK +      N DG+
Sbjct: 92  SNWIGKEVRAVAPANFDGT 110


>gi|308173590|ref|YP_003920295.1| flagellar hook assembly protein [Bacillus amyloliquefaciens DSM 7]
 gi|307606454|emb|CBI42825.1| flagellar hook assembly protein [Bacillus amyloliquefaciens DSM 7]
 gi|328553478|gb|AEB23970.1| flagellar basal body rod modification protein [Bacillus
           amyloliquefaciens TA208]
 gi|328911731|gb|AEB63327.1| flagellar hook assembly protein [Bacillus amyloliquefaciens LL3]
          Length = 143

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 53/77 (68%), Gaps = 1/77 (1%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           S   LG+D FLK+L+TQ+++QDP  P+   E ++Q+A FS +EQ + +N+T+ + +++ +
Sbjct: 24  SSTNLGKDEFLKILMTQVQNQDPLNPVDDKEFISQMATFSSLEQMMNLNTTMTKYVENQD 83

Query: 79  -LAQASSYIGKNITNAD 94
                 ++IGK++T +D
Sbjct: 84  PFTMYVNWIGKSVTFSD 100


>gi|289578427|ref|YP_003477054.1| flagellar hook capping protein [Thermoanaerobacter italicus Ab9]
 gi|289528140|gb|ADD02492.1| flagellar hook capping protein [Thermoanaerobacter italicus Ab9]
          Length = 131

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 66/112 (58%), Gaps = 15/112 (13%)

Query: 1   MEINTEVNPTQ-QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           ME+NT  + +     S+  SKK LG+D FLKLL+ Q+K+Q+P  PM   E +AQLA FS 
Sbjct: 1   MEVNTNYSFSNVYNNSEITSKKQLGKDDFLKLLVAQLKNQNPLNPMDDKEFIAQLAQFST 60

Query: 60  MEQSVQMNSTLQELLKSNNLAQASSYIGKNI----TNADG---SISGVVNAI 104
           +EQ   +N++   +       +A + +GKNI    T+ +G   ++ G V+A+
Sbjct: 61  LEQMQNLNTSFSAV-------RAINLLGKNIYATVTDNNGESKAVEGKVDAV 105


>gi|256830200|ref|YP_003158928.1| flagellar hook capping protein [Desulfomicrobium baculatum DSM
           4028]
 gi|256579376|gb|ACU90512.1| flagellar hook capping protein [Desulfomicrobium baculatum DSM
           4028]
          Length = 226

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 52/79 (65%), Gaps = 8/79 (10%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ- 81
           LG+DAFLKLL+TQ+++QDP  P+   E +AQLA FS +EQ   ++  ++ L  S+  AQ 
Sbjct: 24  LGKDAFLKLLVTQLQNQDPLNPLDDKEFIAQLAQFSSLEQMTNISEGIKGL--SDKTAQQ 81

Query: 82  ----ASSYIGKNIT-NADG 95
               A +YIGK +T + DG
Sbjct: 82  DMLSAVNYIGKEVTASGDG 100


>gi|150021172|ref|YP_001306526.1| flagellar hook capping protein [Thermosipho melanesiensis BI429]
 gi|149793693|gb|ABR31141.1| flagellar hook capping protein [Thermosipho melanesiensis BI429]
          Length = 221

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 50/72 (69%), Gaps = 3/72 (4%)

Query: 20 KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN-- 77
          KK L ++AFL+LL+TQ+K+QDP EP+K  E +AQ+   S +EQ   M+ ++Q+ ++S+  
Sbjct: 22 KKELDKEAFLELLVTQLKNQDPLEPLKDREFIAQMTQLSTLEQITNMSESVQKFVESSAS 81

Query: 78 -NLAQASSYIGK 88
             AQ SS +GK
Sbjct: 82 LYRAQVSSMVGK 93


>gi|238916753|ref|YP_002930270.1| flagellar basal-body rod modification protein FlgD [Eubacterium
           eligens ATCC 27750]
 gi|238872113|gb|ACR71823.1| flagellar basal-body rod modification protein FlgD [Eubacterium
           eligens ATCC 27750]
          Length = 185

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 66/110 (60%), Gaps = 15/110 (13%)

Query: 2   EINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME 61
           ++NT ++ T +  S S +K TL  + FL+L++ ++++QDP EP   S+ +AQLA F+Q+E
Sbjct: 22  DVNTNISSTGKNNS-SGNKTTLDVNEFLQLMVAEMQNQDPLEPTDNSDYMAQLATFTQVE 80

Query: 62  QSVQMNS-TLQELLKSNNLAQASSYIGKNIT-----NADGSISGVVNAIQ 105
            + +MN+ TLQ +        AS  +GK +      N+DG I G V+  +
Sbjct: 81  ATKEMNTNTLQGM--------ASDLVGKQVIMTTNQNSDGFIGGTVDYWE 122


>gi|154250213|ref|YP_001411038.1| flagellar hook capping protein [Fervidobacterium nodosum Rt17-B1]
 gi|154154149|gb|ABS61381.1| flagellar hook capping protein [Fervidobacterium nodosum Rt17-B1]
          Length = 218

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 53/88 (60%), Gaps = 6/88 (6%)

Query: 7  VNPTQQEFSKSK---SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
          VN     FS S    +KK L ++AFLKLLITQ+K QDP EPMK  + +AQ++  S +EQ 
Sbjct: 5  VNSMSNLFSTSTDRTTKKDLDKEAFLKLLITQLKSQDPLEPMKDRDFIAQMSQLSSLEQV 64

Query: 64 VQMNSTLQELLKSN---NLAQASSYIGK 88
          + M+ ++Q  + +       QA S IGK
Sbjct: 65 MNMSKSVQSFVDTAAQLYRTQAVSMIGK 92


>gi|15895425|ref|NP_348774.1| flagellar hook assembly protein FlgD [Clostridium acetobutylicum
          ATCC 824]
 gi|15025149|gb|AAK80114.1|AE007716_3 Flagellar hook assembly protein FlgD [Clostridium acetobutylicum
          ATCC 824]
 gi|325509571|gb|ADZ21207.1| Flagellar hook assembly protein FlgD [Clostridium acetobutylicum
          EA 2018]
          Length = 239

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (62%), Gaps = 7/70 (10%)

Query: 22 TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
          TLGQDAFLK+LI ++ HQDPT    +++ +AQLA FS +EQ   +N T+         + 
Sbjct: 35 TLGQDAFLKILIAEMSHQDPTSQQDSTQYIAQLAQFSNLEQMTNLNRTM-------TFSG 87

Query: 82 ASSYIGKNIT 91
          ASS +G  +T
Sbjct: 88 ASSLMGGTVT 97


>gi|254510795|ref|ZP_05122862.1| basal-body rod modification protein FlgD [Rhodobacteraceae
          bacterium KLH11]
 gi|221534506|gb|EEE37494.1| basal-body rod modification protein FlgD [Rhodobacteraceae
          bacterium KLH11]
          Length = 221

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQASS 84
          FL++L  Q ++QDP EP+ +SE  +QLA FS +EQ VQ N+ L +L   L S NL Q +S
Sbjct: 33 FLRMLTVQARNQDPLEPLDSSEYASQLAQFSMVEQQVQANALLSDLSLTLGSVNLNQLAS 92

Query: 85 YIGKNI 90
          ++G ++
Sbjct: 93 WVGMDV 98


>gi|163793270|ref|ZP_02187245.1| Flagellar hook capping protein [alpha proteobacterium BAL199]
 gi|159181072|gb|EDP65587.1| Flagellar hook capping protein [alpha proteobacterium BAL199]
          Length = 222

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE---LLKSNNLAQA 82
          D FL LL TQ+K+QDP +PM  SE V QL  FS +EQ +  N  L++   LL S + A +
Sbjct: 26 DMFLTLLTTQLKNQDPLDPMDNSEMVNQLVQFSNVEQQIAQNKNLEQMILLLNSQSAASS 85

Query: 83 SSYIGKNI 90
           SYIG+++
Sbjct: 86 VSYIGRDV 93


>gi|104782844|ref|YP_609342.1| flagellar basal body rod modification protein [Pseudomonas
           entomophila L48]
 gi|95111831|emb|CAK16555.1| flagellar Basal-body rod modification protein FlgD [Pseudomonas
           entomophila L48]
          Length = 234

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNL 79
           LG+DAFL+LL+TQ++HQ+P +P    E VAQLA FS +E    +NS++  +   + S+  
Sbjct: 38  LGKDAFLQLLVTQMQHQNPLDPQDNGEFVAQLAQFSSLEGIQTLNSSVNSIITGMGSSQA 97

Query: 80  AQASSYIGKNI 90
            QASS +G+++
Sbjct: 98  LQASSLVGRSV 108


>gi|146277709|ref|YP_001167868.1| flagellar hook capping protein [Rhodobacter sphaeroides ATCC
          17025]
 gi|145555950|gb|ABP70563.1| flagellar hook capping protein [Rhodobacter sphaeroides ATCC
          17025]
          Length = 225

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 51/79 (64%), Gaps = 3/79 (3%)

Query: 15 SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ--- 71
          +++K    LGQ+ FLKLL TQ+++QDP +PM+  E +AQ+A FS +    Q+N TL    
Sbjct: 21 TQAKGSSNLGQEDFLKLLTTQLQNQDPFQPMENGEFLAQMAQFSTVSGIEQLNGTLSGIG 80

Query: 72 ELLKSNNLAQASSYIGKNI 90
          E L S   A A+S IG+++
Sbjct: 81 EGLGSFRTATAASLIGRSV 99


>gi|138894747|ref|YP_001125200.1| flagellar basal body rod modification protein [Geobacillus
           thermodenitrificans NG80-2]
 gi|196247631|ref|ZP_03146333.1| flagellar hook capping protein [Geobacillus sp. G11MC16]
 gi|134266260|gb|ABO66455.1| Flagellar hook assembly protein [Geobacillus thermodenitrificans
           NG80-2]
 gi|196212415|gb|EDY07172.1| flagellar hook capping protein [Geobacillus sp. G11MC16]
          Length = 142

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 59/94 (62%), Gaps = 5/94 (5%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK 75
           +    + LG+D FLK+L+ Q+++QDP  PM+  E +AQ+A FS +EQ + + + +Q+ ++
Sbjct: 20  RKTGDQILGKDDFLKILLAQLQNQDPLNPMEDREFIAQMASFSSLEQMMNIANLMQQWMQ 79

Query: 76  S---NNLAQASSYIGKNIT--NADGSISGVVNAI 104
           +   + L + S +IGK +     D ++S VV ++
Sbjct: 80  ASGRDALLRYSEWIGKTVHWQEDDSTMSAVVQSV 113


>gi|296283233|ref|ZP_06861231.1| flagellar hook capping protein [Citromicrobium bathyomarinum JL354]
          Length = 215

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 54/78 (69%), Gaps = 4/78 (5%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS---NNLAQA 82
           D FLKLL TQ+++QDP +PM+ SE   QL  +SQ+EQS+Q  + L+++L +    ++AQ+
Sbjct: 23  DMFLKLLTTQMQNQDPLDPMETSEYTQQLTQYSQVEQSIQQTAALKDILSALSTQDIAQS 82

Query: 83  SSYIGKNITNADGSISGV 100
           ++++G+     D S +G+
Sbjct: 83  ANFLGQR-AELDSSTAGL 99


>gi|310816816|ref|YP_003964780.1| flagellar hook capping protein, putative [Ketogulonicigenium
          vulgare Y25]
 gi|308755551|gb|ADO43480.1| flagellar hook capping protein, putative [Ketogulonicigenium
          vulgare Y25]
          Length = 217

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS---NNLAQASS 84
          FLK+L+ Q+++QDP  P+ ++E  AQLA FS +EQ VQ N  L +L+      NL   S 
Sbjct: 31 FLKMLVAQVQNQDPLNPIDSNEYAAQLATFSGVEQQVQTNQLLNQLIAQTGIGNLGAMSG 90

Query: 85 YIGKNI 90
          +IGK++
Sbjct: 91 WIGKDV 96


>gi|307944134|ref|ZP_07659475.1| flagellar hook capping protein [Roseibium sp. TrichSKD4]
 gi|307772480|gb|EFO31700.1| flagellar hook capping protein [Roseibium sp. TrichSKD4]
          Length = 219

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 48/72 (66%), Gaps = 3/72 (4%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASS--- 84
           FL LL TQI++QDP +P+ ++E   QL  +S +EQ++Q N  L +++++    QASS   
Sbjct: 29  FLSLLTTQIQYQDPLDPLDSAEYTKQLVQYSSVEQAIQSNQHLAKMVEAMQAGQASSYVN 88

Query: 85  YIGKNITNADGS 96
           YIG +IT + G+
Sbjct: 89  YIGSDITASGGT 100


>gi|16799779|ref|NP_470047.1| flagellar basal body rod modification protein [Listeria innocua
           Clip11262]
 gi|16413156|emb|CAC95936.1| lin0704 [Listeria innocua Clip11262]
 gi|313620065|gb|EFR91578.1| flagellar hook capping protein [Listeria innocua FSL S4-378]
          Length = 140

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 68/111 (61%), Gaps = 7/111 (6%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST---LQELLKSN 77
           KTLG+D F+KL +T +++QDP+ P+  +E ++Q+A  S MEQ   M +    L E  +++
Sbjct: 24  KTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQAQNS 83

Query: 78  NLAQASSYIGKNITNA--DGS-ISGVVNAIQVSSTG-LTAITVDNTEIPIT 124
            L  A ++IGK+I     +G  ISG V ++Q ++ G +  I   ++ +P+T
Sbjct: 84  ALQSAVNFIGKDIKGVSLNGEVISGQVESVQQTTNGVMLKIKDQDSLVPMT 134


>gi|221636049|ref|YP_002523925.1| flagellar hook capping protein [Thermomicrobium roseum DSM 5159]
 gi|221158205|gb|ACM07323.1| flagellar hook capping protein [Thermomicrobium roseum DSM 5159]
          Length = 146

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 4/107 (3%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           L + AFL LL+ Q+K+QDP  PM+  E +AQLA  + +EQ  Q+N T+  + +   L Q 
Sbjct: 25  LDKQAFLMLLVAQLKNQDPMNPMQDREFIAQLAQLNTLEQLQQLNETVAAMAQHAALGQV 84

Query: 83  SSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
           + Y+G+ ++  D +   +V    V +T L    V    + ++ G RI
Sbjct: 85  AGYLGRVVSGLDRTSGDLVTGTVVRATILDGAAV----LELSGGQRI 127


>gi|256004790|ref|ZP_05429765.1| flagellar hook capping protein [Clostridium thermocellum DSM 2360]
 gi|255991240|gb|EEU01347.1| flagellar hook capping protein [Clostridium thermocellum DSM 2360]
 gi|316940771|gb|ADU74805.1| flagellar hook capping protein [Clostridium thermocellum DSM 1313]
          Length = 323

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 67/124 (54%), Gaps = 16/124 (12%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           S  ++   LG+D FL LLITQ+++QDP  P+   E ++Q+A FS +EQ       +Q L 
Sbjct: 23  STQRNTGELGKDEFLNLLITQLQYQDPLNPVDDKEFISQMAQFSALEQ-------MQNLN 75

Query: 75  KSNNLAQASSYIGKNITN--------ADGSISGVVNAIQVSSTGLTAITVDNTEIPITTG 126
           KS +  +A   IGK IT           G + G+V ++++ + G   + V+  ++P+   
Sbjct: 76  KSFSATKAFGMIGKYITGTTSNGSDSGAGFVEGIVRSVKMEN-GKILLEVNGLDVPVDNV 134

Query: 127 IRIS 130
           + +S
Sbjct: 135 LSVS 138


>gi|313624711|gb|EFR94666.1| flagellar hook capping protein [Listeria innocua FSL J1-023]
          Length = 140

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 68/111 (61%), Gaps = 7/111 (6%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST---LQELLKSN 77
           KTLG+D F+KL +T +++QDP+ P+  +E ++Q+A  S MEQ   M +    L E  +++
Sbjct: 24  KTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQAQNS 83

Query: 78  NLAQASSYIGKNITNA--DGS-ISGVVNAIQVSSTG-LTAITVDNTEIPIT 124
            L  A ++IGK+I     +G  ISG V ++Q ++ G +  I   ++ +P+T
Sbjct: 84  ALQSAVNFIGKDIKGVSLNGEVISGQVESVQQTTNGVMLKIKDQDSLVPMT 134


>gi|126462485|ref|YP_001043599.1| flagellar hook capping protein [Rhodobacter sphaeroides ATCC
          17029]
 gi|126104149|gb|ABN76827.1| flagellar hook capping protein [Rhodobacter sphaeroides ATCC
          17029]
          Length = 223

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 52/82 (63%), Gaps = 3/82 (3%)

Query: 12 QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          Q  +++K K  LGQ  FL LL TQ+++QDP +PM+  E +AQ+A FS +    Q+NSTL 
Sbjct: 16 QTSTQAKGKSNLGQQDFLTLLTTQLQNQDPFQPMENGEFLAQMAQFSTVSGIEQLNSTLT 75

Query: 72 EL---LKSNNLAQASSYIGKNI 90
           +   L +   A A+S IGK++
Sbjct: 76 GIGDGLGAFRTATAASLIGKSV 97


>gi|220929461|ref|YP_002506370.1| flagellar hook capping protein [Clostridium cellulolyticum H10]
 gi|219999789|gb|ACL76390.1| flagellar hook capping protein [Clostridium cellulolyticum H10]
          Length = 285

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 53/86 (61%), Gaps = 7/86 (8%)

Query: 6  EVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQ 65
          E   ++QE +  K+   LG++ FL LL+TQ+++QDP +P+   E +AQ+A FS +EQ   
Sbjct: 18 ESTKSKQEAAARKTGGELGKNDFLNLLVTQLRYQDPLQPVDDKEFIAQMAQFSSLEQMQN 77

Query: 66 MNSTLQELLKSNNLAQASSYIGKNIT 91
          MN ++ +       +QA + IGK IT
Sbjct: 78 MNGSMTK-------SQAFNLIGKVIT 96


>gi|83309604|ref|YP_419868.1| flagellar hook capping protein [Magnetospirillum magneticum AMB-1]
 gi|82944445|dbj|BAE49309.1| Flagellar hook capping protein [Magnetospirillum magneticum AMB-1]
          Length = 274

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 56/98 (57%), Gaps = 10/98 (10%)

Query: 20  KKTLGQD--AFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           K TLG +   FL +L TQ+KHQDP  PM +++   QL  FS +EQ +  NS L++L+K  
Sbjct: 24  KATLGSNFNTFLTMLTTQLKHQDPLSPMDSTQFTNQLVQFSSVEQQINANSNLEKLIKLQ 83

Query: 78  NLAQAS---SYIGKNITNADGSISGVVNAIQVSSTGLT 112
             AQ S   SY+G+ +      +SG    +Q S+  LT
Sbjct: 84  QTAQTSQGISYLGQTV-----EVSGTDLPLQDSAASLT 116


>gi|125972993|ref|YP_001036903.1| flagellar hook capping protein [Clostridium thermocellum ATCC
           27405]
 gi|281417204|ref|ZP_06248224.1| flagellar hook capping protein [Clostridium thermocellum JW20]
 gi|125713218|gb|ABN51710.1| flagellar hook capping protein [Clostridium thermocellum ATCC
           27405]
 gi|281408606|gb|EFB38864.1| flagellar hook capping protein [Clostridium thermocellum JW20]
          Length = 323

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 67/124 (54%), Gaps = 16/124 (12%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           S  ++   LG+D FL LLITQ+++QDP  P+   E ++Q+A FS +EQ       +Q L 
Sbjct: 23  STQRNTGELGKDEFLNLLITQLQYQDPLNPVDDKEFISQMAQFSALEQ-------MQNLN 75

Query: 75  KSNNLAQASSYIGKNITN--------ADGSISGVVNAIQVSSTGLTAITVDNTEIPITTG 126
           KS +  +A   IGK IT           G + G+V ++++ + G   + V+  ++P+   
Sbjct: 76  KSFSATKAFGMIGKYITGTTSNGSDSGAGFVEGIVRSVKMEN-GKILLEVNGLDVPVDNV 134

Query: 127 IRIS 130
           + +S
Sbjct: 135 LSVS 138


>gi|325274801|ref|ZP_08140829.1| flagellar basal body rod modification protein [Pseudomonas sp.
           TJI-51]
 gi|324100069|gb|EGB97887.1| flagellar basal body rod modification protein [Pseudomonas sp.
           TJI-51]
          Length = 233

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 51/79 (64%), Gaps = 3/79 (3%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL- 73
           S   +   LG+DAFL+LL+TQ+++Q+P +P +  E VAQLA FS +E    +N  +  + 
Sbjct: 28  STGAAGSALGKDAFLQLLVTQMQNQNPLDPQENGEFVAQLAQFSSLESMQSLNDAVTYIA 87

Query: 74  --LKSNNLAQASSYIGKNI 90
             L+S+   QASS +G+N+
Sbjct: 88  AGLQSSQALQASSLVGRNV 106


>gi|26991078|ref|NP_746503.1| flagellar basal body rod modification protein [Pseudomonas putida
           KT2440]
 gi|24986113|gb|AAN69967.1|AE016635_3 flagellar basal-body rod modification protein FlgD [Pseudomonas
           putida KT2440]
          Length = 233

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 51/79 (64%), Gaps = 3/79 (3%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL- 73
           S   +   LG+DAFL+LL+TQ+++Q+P +P +  E VAQLA FS +E    +N  +  + 
Sbjct: 28  STGAAGSALGKDAFLQLLVTQMQNQNPLDPQENGEFVAQLAQFSSLESMQSLNDAVTYIA 87

Query: 74  --LKSNNLAQASSYIGKNI 90
             L+S+   QASS +G+N+
Sbjct: 88  AGLQSSQALQASSLVGRNV 106


>gi|313497760|gb|ADR59126.1| FlgD [Pseudomonas putida BIRD-1]
          Length = 233

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 51/79 (64%), Gaps = 3/79 (3%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL- 73
           S   +   LG+DAFL+LL+TQ+++Q+P +P +  E VAQLA FS +E    +N  +  + 
Sbjct: 28  STGAAGSALGKDAFLQLLVTQMQNQNPLDPQENGEFVAQLAQFSSLESMQSLNDAVTYIA 87

Query: 74  --LKSNNLAQASSYIGKNI 90
             L+S+   QASS +G+N+
Sbjct: 88  AGLQSSQALQASSLVGRNV 106


>gi|332558509|ref|ZP_08412831.1| Flagellar scaffolding protein FlgD [Rhodobacter sphaeroides WS8N]
 gi|6502602|gb|AAF14369.1|AF133240_3 flagellar scaffolding protein FlgD [Rhodobacter sphaeroides]
 gi|332276221|gb|EGJ21536.1| Flagellar scaffolding protein FlgD [Rhodobacter sphaeroides WS8N]
          Length = 223

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 52/82 (63%), Gaps = 3/82 (3%)

Query: 12 QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          Q  +++K K  LGQ  FL LL TQ+++QDP +PM+  E +AQ+A FS +    Q+NSTL 
Sbjct: 16 QTSTQAKGKSNLGQQDFLTLLTTQLQNQDPFQPMENGEFLAQMAQFSTVSGIEQLNSTLT 75

Query: 72 EL---LKSNNLAQASSYIGKNI 90
           +   L +   A A+S IGK++
Sbjct: 76 GIGDGLGAFRTATAASLIGKSV 97


>gi|222053609|ref|YP_002535971.1| flagellar hook capping protein [Geobacter sp. FRC-32]
 gi|221562898|gb|ACM18870.1| flagellar hook capping protein [Geobacter sp. FRC-32]
          Length = 221

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL-KSNNLA- 80
          L +D FL+L +TQ+++QDP  P  +S+ + QLA  +++EQS   N+ LQ +L +SNN+A 
Sbjct: 24 LNKDDFLRLFVTQLQNQDPLNPQDSSQFITQLAQITEVEQSYNTNTNLQSILTQSNNMAS 83

Query: 81 -QASSYIGKNI 90
            A S+IGK+I
Sbjct: 84 LSAVSFIGKSI 94


>gi|77463653|ref|YP_353157.1| flagellar scaffolding protein FlgD [Rhodobacter sphaeroides
          2.4.1]
 gi|221639496|ref|YP_002525758.1| Flagellar scaffolding protein FlgD [Rhodobacter sphaeroides
          KD131]
 gi|77388071|gb|ABA79256.1| Flagellar scaffolding protein FlgD [Rhodobacter sphaeroides
          2.4.1]
 gi|221160277|gb|ACM01257.1| Flagellar scaffolding protein FlgD [Rhodobacter sphaeroides
          KD131]
          Length = 223

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 52/82 (63%), Gaps = 3/82 (3%)

Query: 12 QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          Q  +++K K  LGQ  FL LL TQ+++QDP +PM+  E +AQ+A FS +    Q+NSTL 
Sbjct: 16 QTSTQAKGKSNLGQQDFLTLLTTQLQNQDPFQPMENGEFLAQMAQFSTVSGIEQLNSTLT 75

Query: 72 EL---LKSNNLAQASSYIGKNI 90
           +   L +   A A+S IGK++
Sbjct: 76 GIGDGLGAFRTATAASLIGKSV 97


>gi|260886639|ref|ZP_05897902.1| flagellar hook capping protein [Selenomonas sputigena ATCC 35185]
 gi|330839529|ref|YP_004414109.1| flagellar hook capping protein [Selenomonas sputigena ATCC 35185]
 gi|260863782|gb|EEX78282.1| flagellar hook capping protein [Selenomonas sputigena ATCC 35185]
 gi|329747293|gb|AEC00650.1| flagellar hook capping protein [Selenomonas sputigena ATCC 35185]
          Length = 178

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 7/81 (8%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK- 75
           ++   +LG+DAFL+LL+TQ++HQDP  P   ++ +AQLA FS +EQ  QM    + + K 
Sbjct: 29  ARKNDSLGKDAFLQLLVTQLRHQDPLSPDDNTQYIAQLAQFSSLEQMTQMVKGFENVSKL 88

Query: 76  ------SNNLAQASSYIGKNI 90
                 S  +   S+ IGKNI
Sbjct: 89  VSNIDSSVLVGSLSNMIGKNI 109


>gi|23015642|ref|ZP_00055412.1| COG1843: Flagellar hook capping protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 277

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (61%), Gaps = 5/76 (6%)

Query: 20  KKTLGQD--AFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           K TLG +   FL +L TQ+KHQDP  PM +++   QL  FS +EQ +  NS L++L+K  
Sbjct: 28  KATLGSNFNTFLTMLTTQLKHQDPLSPMDSTQFTNQLVQFSSVEQQINANSNLEKLIKLQ 87

Query: 78  NLAQAS---SYIGKNI 90
             AQ S   SY+G+ +
Sbjct: 88  QTAQTSQGISYLGQTV 103


>gi|49082024|gb|AAT50412.1| PA1079 [synthetic construct]
          Length = 238

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL--- 74
           K    LG+D FLKLL+ Q+K+QDP  P +  E +AQLA FS +E    +N +++ +L   
Sbjct: 35  KGSSNLGKDEFLKLLVAQLKNQDPMSPQQNGEFIAQLAQFSTVEGVQSLNKSMESILSNY 94

Query: 75  KSNNLAQASSYIGKNI 90
           +S+   QASS +G+ +
Sbjct: 95  QSSQALQASSLVGRKV 110


>gi|289433974|ref|YP_003463846.1| flagellar hook assembly protein FlgD [Listeria seeligeri serovar
           1/2b str. SLCC3954]
 gi|289170218|emb|CBH26758.1| flagellar hook assembly protein FlgD [Listeria seeligeri serovar
           1/2b str. SLCC3954]
          Length = 140

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 69/111 (62%), Gaps = 7/111 (6%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST---LQELLKSN 77
           KTLG+D F+KL +T +++QDP+ P+  +E ++Q+A  S MEQ   M +    L E  +++
Sbjct: 24  KTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQAQNS 83

Query: 78  NLAQASSYIGKNI--TNADGS-ISGVVNAIQVSSTG-LTAITVDNTEIPIT 124
            L  A ++IGK+I   + +G  ISG V ++Q ++ G +  +   ++ +P+T
Sbjct: 84  ALQSAVNFIGKDIKGVSLNGEVISGQVESVQQTTNGVMLKLKEQDSLVPLT 134


>gi|312879591|ref|ZP_07739391.1| flagellar hook capping protein [Aminomonas paucivorans DSM 12260]
 gi|310782882|gb|EFQ23280.1| flagellar hook capping protein [Aminomonas paucivorans DSM 12260]
          Length = 139

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 59/107 (55%), Gaps = 4/107 (3%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K  LG+D FLKLLI Q+ +QDP +P+K  + +AQ+A F+ +EQ+  M   ++ L K  ++
Sbjct: 27  KNELGKDDFLKLLIAQLTNQDPLDPLKDQDFIAQMAQFTALEQTTNMAKGIETLTKL-SM 85

Query: 80  AQASSYIGKNITNADG---SISGVVNAIQVSSTGLTAITVDNTEIPI 123
             A  Y+G+ +   D    S +G V  ++     +T    D + + +
Sbjct: 86  TSAVGYVGRVVGYTDDEGNSKAGTVQYVEFKDGAVTLKLTDGSSLAL 132


>gi|116049008|ref|YP_792190.1| flagellar basal body rod modification protein [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|296390557|ref|ZP_06880032.1| flagellar basal body rod modification protein [Pseudomonas
           aeruginosa PAb1]
 gi|115584229|gb|ABJ10244.1| flagellar basal-body rod modification protein FlgD [Pseudomonas
           aeruginosa UCBPP-PA14]
          Length = 237

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL--- 74
           K    LG+D FLKLL+ Q+K+QDP  P +  E +AQLA FS +E    +N +++ +L   
Sbjct: 35  KGSSNLGKDEFLKLLVAQLKNQDPMSPQQNGEFIAQLAQFSTVEGVQSLNKSMESILSNY 94

Query: 75  KSNNLAQASSYIGKNI 90
           +S+   QASS +G+ +
Sbjct: 95  QSSQALQASSLVGRKV 110


>gi|315301939|ref|ZP_07872941.1| flagellar hook capping protein [Listeria ivanovii FSL F6-596]
 gi|313629692|gb|EFR97823.1| flagellar hook capping protein [Listeria ivanovii FSL F6-596]
 gi|313634373|gb|EFS00968.1| flagellar hook capping protein [Listeria seeligeri FSL N1-067]
 gi|313639058|gb|EFS04045.1| flagellar hook capping protein [Listeria seeligeri FSL S4-171]
          Length = 140

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 62/97 (63%), Gaps = 6/97 (6%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST---LQELLKSN 77
           KTLG+D F+KL +T +++QDP+ P+  +E ++Q+A  S MEQ   M +    L E  +++
Sbjct: 24  KTLGKDDFMKLFLTSLQYQDPSSPLDTNEMMSQMAQLSLMEQVANMTTAVDKLSEQAQNS 83

Query: 78  NLAQASSYIGKNI--TNADGS-ISGVVNAIQVSSTGL 111
            L  A ++IGK+I   + +G  ISG V ++Q ++ G+
Sbjct: 84  ALQSAVNFIGKDIKGVSLNGEVISGQVESVQQTTNGV 120


>gi|15596276|ref|NP_249770.1| flagellar basal body rod modification protein [Pseudomonas
           aeruginosa PAO1]
 gi|107100524|ref|ZP_01364442.1| hypothetical protein PaerPA_01001549 [Pseudomonas aeruginosa PACS2]
 gi|218892957|ref|YP_002441826.1| flagellar basal body rod modification protein [Pseudomonas
           aeruginosa LESB58]
 gi|254234215|ref|ZP_04927538.1| flagellar basal-body rod modification protein FlgD [Pseudomonas
           aeruginosa C3719]
 gi|254239437|ref|ZP_04932759.1| flagellar basal-body rod modification protein FlgD [Pseudomonas
           aeruginosa 2192]
 gi|313106034|ref|ZP_07792293.1| flagellar basal-body rod modification protein FlgD [Pseudomonas
           aeruginosa 39016]
 gi|9946995|gb|AAG04468.1|AE004539_10 flagellar basal-body rod modification protein FlgD [Pseudomonas
           aeruginosa PAO1]
 gi|126166146|gb|EAZ51657.1| flagellar basal-body rod modification protein FlgD [Pseudomonas
           aeruginosa C3719]
 gi|126192815|gb|EAZ56878.1| flagellar basal-body rod modification protein FlgD [Pseudomonas
           aeruginosa 2192]
 gi|218773185|emb|CAW28997.1| flagellar basal-body rod modification protein FlgD [Pseudomonas
           aeruginosa LESB58]
 gi|310878795|gb|EFQ37389.1| flagellar basal-body rod modification protein FlgD [Pseudomonas
           aeruginosa 39016]
          Length = 237

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL--- 74
           K    LG+D FLKLL+ Q+K+QDP  P +  E +AQLA FS +E    +N +++ +L   
Sbjct: 35  KGSSNLGKDEFLKLLVAQLKNQDPMSPQQNGEFIAQLAQFSTVEGVQSLNKSMESILSNY 94

Query: 75  KSNNLAQASSYIGKNI 90
           +S+   QASS +G+ +
Sbjct: 95  QSSQALQASSLVGRKV 110


>gi|220913725|ref|YP_002489034.1| flagellar hook capping protein [Arthrobacter chlorophenolicus A6]
 gi|219860603|gb|ACL40945.1| flagellar hook capping protein [Arthrobacter chlorophenolicus A6]
          Length = 138

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 63/106 (59%), Gaps = 4/106 (3%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA 80
           ++L  D F+KLL+TQ+K+QDP  PM  ++ +AQ    S ME+  ++++  +E        
Sbjct: 22  QSLDSDTFMKLLVTQLKYQDPGAPMDTNQMMAQSVQLSMMEKMTELSTGAKESFSLQMRT 81

Query: 81  QASSYIGKNI--TNADGSI-SGVVNAIQVSSTGLTAITVDNTEIPI 123
            A+  +G  +  T  DG+  SG+ +A+   +TG+  +TV N+++P+
Sbjct: 82  AAAQIVGSEVAYTLPDGTAGSGIASAVSF-TTGVPVVTVGNSKVPL 126


>gi|328542761|ref|YP_004302870.1| flagellar hook capping protein [polymorphum gilvum SL003B-26A1]
 gi|326412507|gb|ADZ69570.1| Flagellar hook capping protein [Polymorphum gilvum SL003B-26A1]
          Length = 220

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 5/79 (6%)

Query: 18 KSKKTL--GQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK 75
          KS++TL    D FL LL TQIK+QDP +P+  ++   QL  +S +EQS+  N+ L++L+ 
Sbjct: 19 KSRETLLGSYDLFLTLLTTQIKNQDPLDPLDTAQFTNQLVQYSSVEQSILTNTYLEQLMA 78

Query: 76 SNNLAQAS---SYIGKNIT 91
          S    QAS   SY+G  +T
Sbjct: 79 SVKSGQASGYVSYLGAEVT 97


>gi|152989628|ref|YP_001349651.1| flagellar basal body rod modification protein [Pseudomonas
           aeruginosa PA7]
 gi|150964786|gb|ABR86811.1| flagellar basal-body rod modification protein FlgD [Pseudomonas
           aeruginosa PA7]
          Length = 227

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL--- 74
           K    LG+D FLKLL+ Q+K+QDP  P +  E +AQLA FS +E    +N +++ +L   
Sbjct: 25  KGSSNLGKDEFLKLLVAQLKNQDPMSPQQNGEFIAQLAQFSTVEGVQSLNKSMESILSNY 84

Query: 75  KSNNLAQASSYIGKNI 90
           +S+   QASS +G+ +
Sbjct: 85  QSSQALQASSLVGRKV 100


>gi|23099017|ref|NP_692483.1| flagellar basal body rod modification protein [Oceanobacillus
           iheyensis HTE831]
 gi|22777245|dbj|BAC13518.1| flagellar hook assembly protein [Oceanobacillus iheyensis HTE831]
          Length = 172

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 66/110 (60%), Gaps = 13/110 (11%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA-- 80
           LG+D FLKLL+ Q+++QDPT+PM  S+ ++Q+A FS +EQ + M++++ E+L +N+L   
Sbjct: 23  LGKDEFLKLLMVQLQNQDPTKPMDDSQFMSQMATFSSLEQMMNMSNSI-EMLVNNSLVSP 81

Query: 81  --QASSYIGKNIT-----NADGSISGVVNAIQVSST---GLTAITVDNTE 120
             Q S  IG+ ++        G  +G+  +I V  T   G     ++N E
Sbjct: 82  VLQYSHMIGEEVSYMTFDEETGKETGIETSIVVGVTQNEGWAVFELENGE 131


>gi|332187922|ref|ZP_08389655.1| flagellar hook capping family protein [Sphingomonas sp. S17]
 gi|332012083|gb|EGI54155.1| flagellar hook capping family protein [Sphingomonas sp. S17]
          Length = 231

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 51/90 (56%), Gaps = 7/90 (7%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL--- 73
           +K   TL Q AFL LL  Q+K+QDP  PM  ++ VAQ+A FS +    +MN+TL  +   
Sbjct: 30  AKKSTTLDQSAFLTLLTAQLKNQDPFAPMDNTQMVAQMAQFSSVAGISEMNTTLASIATK 89

Query: 74  LKSNNLAQASSYIGKNI----TNADGSISG 99
           L +   A A +Y+GK +    T A G  SG
Sbjct: 90  LNATTPADAMNYVGKTVLTEGTTAYGRTSG 119


>gi|238924163|ref|YP_002937679.1| flagellar hook capping protein [Eubacterium rectale ATCC 33656]
 gi|238875838|gb|ACR75545.1| flagellar hook capping protein [Eubacterium rectale ATCC 33656]
          Length = 237

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 7/107 (6%)

Query: 5   TEVNPTQQEFSKSK--SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           T   PTQ   + S   S   LG D FLKLL  ++++QDP EP   ++ VAQ+A FSQ+E 
Sbjct: 15  TNTTPTQNRKTSSAKASGSNLGYDDFLKLLSAEMQYQDPLEPTSNTDYVAQMATFSQLEA 74

Query: 63  SVQMNSTLQELLKSNNLAQASSYIGKNI-----TNADGSISGVVNAI 104
           ++ M  ++         + A S +GK +      +A G  SG V+ +
Sbjct: 75  TLSMKESMSSSYDQTTKSAALSLVGKEVIVTDKDSASGYYSGKVDYV 121


>gi|323705439|ref|ZP_08117014.1| flagellar hook capping protein [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323535341|gb|EGB25117.1| flagellar hook capping protein [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 134

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 60/95 (63%), Gaps = 13/95 (13%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           LG+D FL+LL+TQ+++QDP  PM   E +AQ+A FS +EQ       +Q L +S +  +A
Sbjct: 28  LGKDQFLQLLVTQLENQDPLNPMDDKEFIAQMAQFSALEQ-------MQNLNESFSAVKA 80

Query: 83  SSYIGKNIT---NADGS---ISGVVNAIQVSSTGL 111
            S +GK +T   +++GS   ++G V++++   + L
Sbjct: 81  YSLLGKTVTASVDSNGSSSTVTGKVDSVKFDGSNL 115


>gi|218885351|ref|YP_002434672.1| flagellar hook capping protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756305|gb|ACL07204.1| flagellar hook capping protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 263

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 67/128 (52%), Gaps = 12/128 (9%)

Query: 11  QQEFSKSKSKKT----LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQM 66
           +Q F+     KT    L + AFL LL+ Q+ HQDP  PM   E VAQLA F+ +EQ   +
Sbjct: 11  EQTFNNYLGAKTKNDELDKQAFLNLLVAQLSHQDPLNPMDDKEFVAQLAQFTSLEQLTNI 70

Query: 67  NSTLQEL---LKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPI 123
           ++ + +L    K   ++ A  YIGK +T +   IS      Q  STG T  +V  + +  
Sbjct: 71  STGITDLNASAKQQQMSAAVGYIGKEVTASGYEIS---KTSQKDSTGATVNSV--STVYF 125

Query: 124 TTGIRISN 131
           TT  ++SN
Sbjct: 126 TTQEQVSN 133


>gi|148554190|ref|YP_001261772.1| flagellar hook capping protein [Sphingomonas wittichii RW1]
 gi|148499380|gb|ABQ67634.1| flagellar hook capping protein [Sphingomonas wittichii RW1]
          Length = 226

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 58/95 (61%), Gaps = 11/95 (11%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS- 76
           KS ++L Q+ FLKLL TQ++ QDP  P+  ++ VAQ+A FSQ     +MN +L+ +++S 
Sbjct: 26  KSNESLSQNDFLKLLTTQMQTQDPFNPVDNTQMVAQMAQFSQTTGIAEMNQSLKSMVQSL 85

Query: 77  --NNLAQASSYIGKNI--------TNADGSISGVV 101
             + +A A+++IGK            ADGS +G V
Sbjct: 86  QQSRVADAANWIGKAALLPSKAASALADGSFAGNV 120


>gi|89056698|ref|YP_512149.1| flagellar basal body rod modification protein [Jannaschia sp.
          CCS1]
 gi|88866247|gb|ABD57124.1| basal-body rod modification protein FlgD [Jannaschia sp. CCS1]
          Length = 221

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (64%), Gaps = 3/65 (4%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQA 82
          D FL+LL TQ+++QDP  P  ++E  AQLA FS +EQ V+ N  L++L     S N+ Q 
Sbjct: 31 DMFLRLLTTQMQNQDPLNPSDSTEYTAQLATFSGVEQQVETNDLLRDLQASFASMNMGQL 90

Query: 83 SSYIG 87
          S +IG
Sbjct: 91 SGWIG 95


>gi|327398497|ref|YP_004339366.1| flagellar hook capping protein [Hippea maritima DSM 10411]
 gi|327181126|gb|AEA33307.1| flagellar hook capping protein [Hippea maritima DSM 10411]
          Length = 226

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 51/82 (62%), Gaps = 3/82 (3%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKS 76
           K T+ ++ FLKLL+ Q+++QDP  PM   + + +  +FSQ+EQ + M+ ++ +    LK 
Sbjct: 25  KATIDKEGFLKLLVAQLRYQDPLNPMNNDQFIQENTMFSQLEQLMNMSKSMNKFMGDLKG 84

Query: 77  NNLAQASSYIGKNITNADGSIS 98
           N    A+SY+GK I+  +  I+
Sbjct: 85  NPKEYAASYLGKYISTGENKIN 106


>gi|254504946|ref|ZP_05117097.1| flagellar hook capping protein, putative [Labrenzia alexandrii
          DFL-11]
 gi|222441017|gb|EEE47696.1| flagellar hook capping protein, putative [Labrenzia alexandrii
          DFL-11]
          Length = 196

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (63%), Gaps = 3/72 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE---LLKSNNLAQASS 84
          FL +L TQI++QDP +P+ ++E   QL  +S +EQS+Q N  L+E   LL SN  +   +
Sbjct: 8  FLSMLTTQIQNQDPLDPLDSAEYTNQLVQYSNVEQSIQTNKNLEEMISLLSSNQSSAYVN 67

Query: 85 YIGKNITNADGS 96
          YIG  +T A G+
Sbjct: 68 YIGTEVTAAGGT 79


>gi|291286228|ref|YP_003503044.1| flagellar hook capping protein [Denitrovibrio acetiphilus DSM
           12809]
 gi|290883388|gb|ADD67088.1| flagellar hook capping protein [Denitrovibrio acetiphilus DSM
           12809]
          Length = 232

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 68/133 (51%), Gaps = 24/133 (18%)

Query: 6   EVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQ 65
           E N TQ E S+S          FL L ITQ+++QDPT+PM  S  + Q A F+Q+E    
Sbjct: 20  EYNNTQGELSQSD---------FLNLFITQLQNQDPTDPMDDSAMMEQTATFTQVELLTS 70

Query: 66  MNSTLQELL-KSNNL------AQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDN 118
           M  +L E+   ++NL        AS YIGK +   DG+ + +       S G+ A++ + 
Sbjct: 71  MEKSLSEIAGGASNLNTQQLMMSASGYIGK-LVEFDGNNTYL-------SDGVAAVSFEA 122

Query: 119 TEIPITTGIRISN 131
            E+P  T + I +
Sbjct: 123 EEVPFKTTVTIKD 135


>gi|291538501|emb|CBL11612.1| Flagellar hook capping protein [Roseburia intestinalis XB6B4]
          Length = 251

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 51/86 (59%), Gaps = 6/86 (6%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           LG D FL+LL  ++++QDP EP   +E VAQLA FSQME ++ M ST++    SN  A  
Sbjct: 28  LGYDQFLQLLCAEMQYQDPLEPTSNTEYVAQLATFSQMEATLGMQSTIE---SSNANALV 84

Query: 83  SSYIGKNITNADG---SISGVVNAIQ 105
             Y+    T++ G   +  G V+ +Q
Sbjct: 85  GKYVIIKTTSSTGETTATEGFVDYVQ 110


>gi|253573525|ref|ZP_04850868.1| flagellar hook capping protein [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251847053|gb|EES75058.1| flagellar hook capping protein [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 167

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 72/136 (52%), Gaps = 22/136 (16%)

Query: 8   NPTQQEFSKSKSKKT-LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQM 66
           N +Q    K+ +K   LG+DAFLKL+I Q+++QDP  PM  ++ VAQ+A F+ +EQ   +
Sbjct: 13  NYSQSNVQKASTKSNELGKDAFLKLMIAQMQNQDPLSPMDNTQMVAQIAQFTSVEQLTNI 72

Query: 67  NSTLQELLKSNNLAQASSYIGKNIT--------NADGSI----------SGVVNAIQVSS 108
           +  +  L +S  L   S  IGK +T        N D S           SG+V +I V S
Sbjct: 73  SEQIAALGES--LGNDSGLIGKEVTWVTETKTGNYDVSTGKAEVIIEKESGIVESIIVRS 130

Query: 109 TGLTAITVDNTEIPIT 124
            G+  + V + EI I+
Sbjct: 131 -GVHYVKVGDKEIKIS 145


>gi|220917664|ref|YP_002492968.1| flagellar hook capping protein [Anaeromyxobacter dehalogenans
          2CP-1]
 gi|219955518|gb|ACL65902.1| flagellar hook capping protein [Anaeromyxobacter dehalogenans
          2CP-1]
          Length = 225

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 47/83 (56%), Gaps = 11/83 (13%)

Query: 15 SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
          + + +   LG+DAFLKLL TQ++HQDP  PM +   VAQLA FS +EQ   +   L  L 
Sbjct: 19 APAPASSALGKDAFLKLLTTQLQHQDPLSPMDSQAFVAQLAQFSSVEQLGALGDKLDTL- 77

Query: 75 KSNNLAQASS-------YIGKNI 90
              +AQASS        +GK +
Sbjct: 78 ---AMAQASSNQLGTAALVGKEV 97


>gi|292670235|ref|ZP_06603661.1| flagellar Basal-body rod modification protein FlgD [Selenomonas
           noxia ATCC 43541]
 gi|292648187|gb|EFF66159.1| flagellar Basal-body rod modification protein FlgD [Selenomonas
           noxia ATCC 43541]
          Length = 174

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 49/80 (61%), Gaps = 7/80 (8%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK-- 75
           K    LG+DAFL+LL+TQ+K+QDP +P   SE ++QLA FS +EQ   ++  L E+ K  
Sbjct: 34  KRNDALGKDAFLQLLVTQMKYQDPLDPQDNSEYLSQLAQFSALEQMTNVSKGLSEVSKIV 93

Query: 76  -----SNNLAQASSYIGKNI 90
                S  + Q SS IG+ +
Sbjct: 94  DNINSSVLIGQLSSMIGQPV 113


>gi|320354324|ref|YP_004195663.1| flagellar hook capping protein [Desulfobulbus propionicus DSM 2032]
 gi|320122826|gb|ADW18372.1| flagellar hook capping protein [Desulfobulbus propionicus DSM 2032]
          Length = 226

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 64/121 (52%), Gaps = 21/121 (17%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA 80
           K LGQD FL LL+ Q+++QDP  P  A+E  AQLA +SQ+EQ   +N  + EL  +   +
Sbjct: 20  KALGQDDFLTLLVAQLQNQDPMNPADATEFTAQLAQYSQLEQLFNLNDAMDELTSATTES 79

Query: 81  Q---ASSYIGKNIT-----------------NADGSISGVVNAIQVSSTGLTAITVDNTE 120
           Q     S IG+++                    DGS+SG+   I+ +S+G T  T+  ++
Sbjct: 80  QNISTLSLIGQDVVVEGAKFTLGEAPVQIGYKVDGSVSGLSIFIK-NSSGKTVATLSASD 138

Query: 121 I 121
           +
Sbjct: 139 L 139


>gi|240145499|ref|ZP_04744100.1| basal-body rod modification protein FlgD [Roseburia intestinalis
           L1-82]
 gi|257202314|gb|EEV00599.1| basal-body rod modification protein FlgD [Roseburia intestinalis
           L1-82]
 gi|291536009|emb|CBL09121.1| Flagellar hook capping protein [Roseburia intestinalis M50/1]
          Length = 251

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 51/86 (59%), Gaps = 6/86 (6%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           LG D FL+LL  ++++QDP EP   +E VAQLA FSQME ++ M ST++    SN  A  
Sbjct: 28  LGYDQFLQLLCAEMQYQDPLEPTSNTEYVAQLATFSQMEATLGMQSTIE---SSNANALV 84

Query: 83  SSYIGKNITNADG---SISGVVNAIQ 105
             Y+    T++ G   +  G V+ +Q
Sbjct: 85  GKYVIIKTTSSTGETTATEGFVDYVQ 110


>gi|311068149|ref|YP_003973072.1| flagellar basal body rod modification protein [Bacillus atrophaeus
           1942]
 gi|310868666|gb|ADP32141.1| flagellar basal body rod modification protein [Bacillus atrophaeus
           1942]
          Length = 142

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 62/104 (59%), Gaps = 5/104 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN-LAQ 81
           LG+D FLK+L+ Q+++QDP  P+   E ++Q+A FS +EQ + +N+T+ + +   +    
Sbjct: 26  LGKDEFLKILMKQVQNQDPLNPVDDKEFISQMATFSSLEQMMNLNTTMTKFVDYQDPFTT 85

Query: 82  ASSYIGKNITNADGSI----SGVVNAIQVSSTGLTAITVDNTEI 121
             ++IGK+++ ++G      +G V++++ S      +  D  EI
Sbjct: 86  YVNWIGKDVSWSEGQDGKEQTGKVSSVKHSKGEYFLVLEDGKEI 129


>gi|299822272|ref|ZP_07054158.1| flagellar hook capping protein [Listeria grayi DSM 20601]
 gi|299815801|gb|EFI83039.1| flagellar hook capping protein [Listeria grayi DSM 20601]
          Length = 145

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 72/117 (61%), Gaps = 7/117 (5%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNN 78
           +L +D F+KL +T +++QDP+ P+  ++ ++Q++  + MEQ   M+S + +L    +S+ 
Sbjct: 29  SLNKDDFMKLFLTSLQYQDPSSPLDTNQMMSQMSQLAMMEQVSNMSSAVNKLSDQAQSSA 88

Query: 79  LAQASSYIGKNI--TNADGS-ISGVVNAIQVSSTGLTAITVDN-TEIPITTGIRISN 131
           +  A  +IGK+I   N +G  +SG+V +IQ ++ G+     DN T +P+T    ++N
Sbjct: 89  MQSAVGFIGKSIKGVNLNGDVVSGLVESIQQTTNGVMLKLKDNDTVVPLTYITEVNN 145


>gi|90021856|ref|YP_527683.1| flagellar basal-body rod modification protein FlgD [Saccharophagus
           degradans 2-40]
 gi|89951456|gb|ABD81471.1| flagellar hook capping protein [Saccharophagus degradans 2-40]
          Length = 238

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 52/87 (59%), Gaps = 9/87 (10%)

Query: 8   NPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN 67
           NPT+ +         LGQ AFL+L+ITQ+++QDP  P + SE +AQLA FS +E   ++N
Sbjct: 21  NPTEPQ------SNELGQSAFLELMITQLENQDPLSPQENSEFIAQLAQFSSVESLDKLN 74

Query: 68  STLQELLKS---NNLAQASSYIGKNIT 91
           +       S   N   QAS+ +G+++T
Sbjct: 75  NNFDSFANSFVANQALQASTLVGRSVT 101


>gi|304321137|ref|YP_003854780.1| putative FlgD protein [Parvularcula bermudensis HTCC2503]
 gi|303300039|gb|ADM09638.1| putative FlgD protein [Parvularcula bermudensis HTCC2503]
          Length = 202

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 51/86 (59%), Gaps = 3/86 (3%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQELLKSNNLAQA 82
           DAFL LL  Q+K+QDP  P+ +++ V QLA FS +EQ VQ N    T+  LL+S    Q 
Sbjct: 28  DAFLNLLTAQMKNQDPFAPIDSTQFVEQLATFSSLEQQVQTNKYLETMMGLLQSTLGGQQ 87

Query: 83  SSYIGKNITNADGSISGVVNAIQVSS 108
           +  IG  I  ++ +ISG  + + + S
Sbjct: 88  TDVIGAQIGASEITISGAFDPLPIVS 113


>gi|197122872|ref|YP_002134823.1| flagellar hook capping protein [Anaeromyxobacter sp. K]
 gi|196172721|gb|ACG73694.1| flagellar hook capping protein [Anaeromyxobacter sp. K]
          Length = 225

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 47/83 (56%), Gaps = 11/83 (13%)

Query: 15 SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
          + + +   LG+DAFLKLL TQ++HQDP  PM +   VAQLA FS +EQ   +   L  L 
Sbjct: 19 APAPASSALGKDAFLKLLTTQLQHQDPLSPMDSQAFVAQLAQFSSVEQLGALGDKLDTL- 77

Query: 75 KSNNLAQASS-------YIGKNI 90
              +AQASS        +GK +
Sbjct: 78 ---AMAQASSNQLGTAALVGKEV 97


>gi|315654585|ref|ZP_07907491.1| flagellar hook assembly protein FlgD [Mobiluncus curtisii ATCC
           51333]
 gi|315491049|gb|EFU80668.1| flagellar hook assembly protein FlgD [Mobiluncus curtisii ATCC
           51333]
          Length = 254

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 57/95 (60%), Gaps = 7/95 (7%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           LG+D F+KLL+  +K+QDPTEPM  ++ + Q +  + MEQ +QM    ++  ++   AQ 
Sbjct: 70  LGKDDFMKLLLATLKYQDPTEPMDTAKLLEQTSTMTNMEQMIQMTEASKKSFEAQQRAQG 129

Query: 83  SSYIGK----NITNADG---SISGVVNAIQVSSTG 110
           ++ +GK    +  +A G   + +G ++A++  + G
Sbjct: 130 TTMVGKTAVYDAVDAQGNAVTTAGKIDAVEFLADG 164


>gi|298345997|ref|YP_003718684.1| flagellar hook capping protein [Mobiluncus curtisii ATCC 43063]
 gi|304390245|ref|ZP_07372199.1| flagellar hook assembly protein FlgD [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|315657510|ref|ZP_07910392.1| flagellar hook assembly protein FlgD [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
 gi|298236058|gb|ADI67190.1| flagellar hook capping protein [Mobiluncus curtisii ATCC 43063]
 gi|304326727|gb|EFL93971.1| flagellar hook assembly protein FlgD [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|315491982|gb|EFU81591.1| flagellar hook assembly protein FlgD [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
          Length = 254

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 57/95 (60%), Gaps = 7/95 (7%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           LG+D F+KLL+  +K+QDPTEPM  ++ + Q +  + MEQ +QM    ++  ++   AQ 
Sbjct: 70  LGKDDFMKLLLATLKYQDPTEPMDTAKLLEQTSTMTNMEQMIQMTEASKKSFEAQQRAQG 129

Query: 83  SSYIGK----NITNADG---SISGVVNAIQVSSTG 110
           ++ +GK    +  +A G   + +G ++A++  + G
Sbjct: 130 TTMVGKTAVYDAVDAQGNAVTTAGKIDAVEFLADG 164


>gi|86157814|ref|YP_464599.1| flagellar hook capping protein [Anaeromyxobacter dehalogenans
          2CP-C]
 gi|85774325|gb|ABC81162.1| flagellar hook capping protein [Anaeromyxobacter dehalogenans
          2CP-C]
          Length = 225

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 46/80 (57%), Gaps = 5/80 (6%)

Query: 15 SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL- 73
          + + +   LG+DAFLKLL TQ++HQDP  PM +   VAQLA FS +EQ   +   L  L 
Sbjct: 19 APAPASSALGKDAFLKLLTTQLQHQDPLSPMDSQAFVAQLAQFSSVEQLGALGDKLDTLA 78

Query: 74 ---LKSNNLAQASSYIGKNI 90
               SN L  A + +GK +
Sbjct: 79 VAQASSNQLGTA-ALVGKEV 97


>gi|163733168|ref|ZP_02140612.1| flagellar basal-body rod modification protein, putative
          [Roseobacter litoralis Och 149]
 gi|161393703|gb|EDQ18028.1| flagellar basal-body rod modification protein, putative
          [Roseobacter litoralis Och 149]
          Length = 226

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 3/63 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQASS 84
          FLK+L  Q + QDP EP+ +SE  AQLA FS +EQ V  N  L EL   L SN++ Q ++
Sbjct: 33 FLKMLTAQARFQDPLEPIDSSEYAAQLAQFSMVEQQVLSNDLLTELGAQLGSNSIGQMAA 92

Query: 85 YIG 87
          +IG
Sbjct: 93 WIG 95


>gi|110677576|ref|YP_680583.1| flagellar basal body rod modification protein [Roseobacter
          denitrificans OCh 114]
 gi|109453692|gb|ABG29897.1| flagellar basal-body rod modification protein, putative
          [Roseobacter denitrificans OCh 114]
          Length = 226

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 3/63 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQASS 84
          FLK+L  Q + QDP EP+ +SE  AQLA FS +EQ V  N  L EL   L SN++ Q ++
Sbjct: 33 FLKMLTAQARFQDPLEPIDSSEYAAQLAQFSMVEQQVLSNDLLTELGAQLGSNSIGQMAA 92

Query: 85 YIG 87
          +IG
Sbjct: 93 WIG 95


>gi|331006030|ref|ZP_08329372.1| Flagellar basal-body rod modification protein FlgD [gamma
           proteobacterium IMCC1989]
 gi|330420159|gb|EGG94483.1| Flagellar basal-body rod modification protein FlgD [gamma
           proteobacterium IMCC1989]
          Length = 239

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LK 75
           S   LGQ AFL+L+ITQ+++QDP  P + SE +AQLA FS +E   ++N+          
Sbjct: 30  SGNELGQTAFLELMITQMENQDPLSPQENSEFIAQLAQFSSVEGLERLNTNFDSFTSSFI 89

Query: 76  SNNLAQASSYIGKNIT 91
           SN   QASS +G++++
Sbjct: 90  SNQALQASSLVGRSVS 105


>gi|254294562|ref|YP_003060585.1| flagellar hook capping protein [Hirschia baltica ATCC 49814]
 gi|254043093|gb|ACT59888.1| flagellar hook capping protein [Hirschia baltica ATCC 49814]
          Length = 222

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA--- 82
          D FL LL  Q+++QDP EP  ++E   QL  FS +EQ +Q N  L++L+ SNN A     
Sbjct: 30 DTFLTLLTAQLQNQDPLEPTDSTEFTNQLVQFSGVEQQIQTNDALEQLIASNNSATGAAM 89

Query: 83 SSYIGKNI 90
          SSY+G+++
Sbjct: 90 SSYLGQSV 97


>gi|68164547|gb|AAY87276.1| predicted flagellar hook capping protein [uncultured bacterium
           BAC17H8]
          Length = 231

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 67/119 (56%), Gaps = 13/119 (10%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           ++E +   SK TLGQ  FLKL+ TQ+++QDP  PM+ +E +AQ+A FS +    +M + L
Sbjct: 23  KKEDTARGSKDTLGQSDFLKLMTTQLQNQDPFAPMENAEFIAQMAQFSTVTGITEMGTEL 82

Query: 71  Q---ELLKSNNLAQASSYIGK------NITNAD--GSISGVVNAIQVSSTGLTAITVDN 118
           +   E L    +A A++ +G       N   AD  G I G++     S++G+T +T  N
Sbjct: 83  KAIAEQLGEFRIATAANLLGSSVMVPGNYARADDNGEIHGMIEL--PSASGITNLTFSN 139


>gi|325288802|ref|YP_004264983.1| flagellar hook capping protein [Syntrophobotulus glycolicus DSM
           8271]
 gi|324964203|gb|ADY54982.1| flagellar hook capping protein [Syntrophobotulus glycolicus DSM
           8271]
          Length = 144

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 67/122 (54%), Gaps = 9/122 (7%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS---TLQEL 73
           S + K LG++ FL+LL+ Q+K+QDP  PM  ++ V+Q+A FS +EQ   +     TL  L
Sbjct: 23  STASKDLGKNDFLQLLVAQLKYQDPMSPMDNTQFVSQMAQFSALEQMTNVADAIVTLTSL 82

Query: 74  LKSNNLAQASSYIGKNITNADGS-----ISGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
              + L Q S+ IGK      GS      +G VN+I++    L  + VD+  + +   ++
Sbjct: 83  YSQSLLYQGSAMIGKTAAYQAGSEGQELTTGKVNSIRIQDNVL-QVQVDDQWVDLGNILQ 141

Query: 129 IS 130
           +S
Sbjct: 142 VS 143


>gi|291280097|ref|YP_003496932.1| flagellar basal-body rod modification protein FlgD [Deferribacter
           desulfuricans SSM1]
 gi|290754799|dbj|BAI81176.1| flagellar basal-body rod modification protein FlgD [Deferribacter
           desulfuricans SSM1]
          Length = 221

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 56/117 (47%), Gaps = 13/117 (11%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN-- 77
           KK L +D FL LL+TQ+K+QDP  P+  SE +AQ   FS +EQ + ++    +L+ +   
Sbjct: 23  KKELDKDDFLNLLVTQLKNQDPLNPLDNSEFIAQTTQFSSLEQLINISEKFDKLIDNEES 82

Query: 78  ---NLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
              NL  A S+I K I       S   N           +  D +  P TT I I N
Sbjct: 83  SNLNLFSAVSFIDKTINFYGNDFSADENG--------ALLRFDISGTPATTNIEIYN 131


>gi|218133667|ref|ZP_03462471.1| hypothetical protein BACPEC_01536 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991042|gb|EEC57048.1| hypothetical protein BACPEC_01536 [Bacteroides pectinophilus ATCC
           43243]
          Length = 199

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 68/128 (53%), Gaps = 15/128 (11%)

Query: 3   INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           +NTE        +       L +DAFL+LL+ ++++QDP EP   +E VAQLA F+Q+E+
Sbjct: 12  LNTEATSIYHSTTDKSYDNGLDKDAFLQLLVAEMQNQDPLEPSSNTEYVAQLATFTQVEE 71

Query: 63  SVQMNSTLQELLKSNNLAQASSYIGK----NITNADGS---ISGVVNAIQVSSTGLTAIT 115
                  +Q +  S    QA++ +GK    N   A G+   + GVV+ I V+S G T + 
Sbjct: 72  -------MQNMANSMAQNQANALVGKTVIMNTITASGTTSYVGGVVDRI-VNSNGKTYVG 123

Query: 116 VDNTEIPI 123
           ++ +   I
Sbjct: 124 INGSLYDI 131


>gi|188586024|ref|YP_001917569.1| flagellar hook capping protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179350711|gb|ACB84981.1| flagellar hook capping protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 145

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 64/122 (52%), Gaps = 11/122 (9%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           QQ   + +++  LGQD F+K+L TQ++HQDP +PM   E + Q+  F+Q++Q       L
Sbjct: 19  QQNLPQLENQDDLGQDEFIKILTTQLQHQDPLDPMDDREFIVQMTSFNQLDQ-------L 71

Query: 71  QELLKSNNLAQASSYIGKNIT--NADGS-ISGVVNAIQVSSTGLTAITVDNTEIPITTGI 127
           Q L ++   +   + +G+++   N DG  I G V AI+    G     +D  ++     +
Sbjct: 72  QSLNETQEQSSMLNLLGRHVVAENEDGEIIEGTVTAIR-DFNGSPGFEIDGKKVDFEDVV 130

Query: 128 RI 129
            I
Sbjct: 131 EI 132


>gi|269796391|ref|YP_003315846.1| flagellar hook capping protein [Sanguibacter keddieii DSM 10542]
 gi|269098576|gb|ACZ23012.1| flagellar hook capping protein [Sanguibacter keddieii DSM 10542]
          Length = 186

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 61/110 (55%), Gaps = 4/110 (3%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           S +KK+L  + F+ LL+ Q+K+QDP+ PM  +E +AQ    + ME+   M  T+ E    
Sbjct: 30  STAKKSLDNETFMTLLVAQLKYQDPSSPMDTTEMMAQTTQLASMEKLTTMTDTIAESFAL 89

Query: 77  NNLAQASSYIGKNI--TNADGSI-SGVVNAIQVSSTGLTAITVDNTEIPI 123
                A++ +GK +  T ADG++ +GV  ++    + +  + VD  E+ +
Sbjct: 90  QMRDAAATLLGKQVSYTEADGTVKTGVAQSVSYKYS-VPMVVVDGVEVTL 138


>gi|325982372|ref|YP_004294774.1| flagellar hook capping protein [Nitrosomonas sp. AL212]
 gi|325531891|gb|ADZ26612.1| flagellar hook capping protein [Nitrosomonas sp. AL212]
          Length = 222

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 57/87 (65%), Gaps = 11/87 (12%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA-- 82
           QD FLKLLITQ+K+QDP +P+  +E  +QLA  S +    ++NSTLQ+L+ S +  ++  
Sbjct: 30  QDRFLKLLITQMKNQDPLKPLDNAEVTSQLAQISTVTGIDKLNSTLQQLVSSADDGRSIE 89

Query: 83  -------SSYI-GKNIT-NADGSISGV 100
                  S+Y+ GK+IT   +G+I+G+
Sbjct: 90  ALEMIGHSAYVPGKSITLEGEGAIAGI 116


>gi|303240281|ref|ZP_07326800.1| flagellar hook capping protein [Acetivibrio cellulolyticus CD2]
 gi|302592191|gb|EFL61920.1| flagellar hook capping protein [Acetivibrio cellulolyticus CD2]
          Length = 297

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 62/109 (56%), Gaps = 16/109 (14%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           LG+D F+ LL+TQ+++QDP  P   ++ +AQ+A FS +EQ       +Q L  S +  QA
Sbjct: 32  LGKDEFINLLVTQLQYQDPLNPQDDTQFIAQMAQFSALEQ-------MQNLNTSYSATQA 84

Query: 83  SSYIGK----NITNADGS----ISGVVNAIQVSSTGLTAITVDNTEIPI 123
              IGK    N+ + D S    I+G V ++++ S G   + V+  +IP+
Sbjct: 85  FGMIGKTVTANLKDGDSSKTNTITGEVTSVKMQS-GKAYVIVNGNDIPV 132


>gi|304316901|ref|YP_003852046.1| flagellar hook capping protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778403|gb|ADL68962.1| flagellar hook capping protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 135

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 59/93 (63%), Gaps = 13/93 (13%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           LG++ +L+LL+TQ+++QDP  PM   E +AQ+A FS +EQ + +N++        N  +A
Sbjct: 28  LGKNEYLQLLVTQLENQDPLNPMDDKEFIAQMAQFSALEQMLNLNNSF-------NAVKA 80

Query: 83  SSYIGKNIT---NADGS---ISGVVNAIQVSST 109
            S +GK I+   +++GS   I+G V+A++   +
Sbjct: 81  YSLLGKTISANIDSNGSSSTITGKVDAVKFDGS 113


>gi|148266216|ref|YP_001232922.1| flagellar hook capping protein [Geobacter uraniireducens Rf4]
 gi|146399716|gb|ABQ28349.1| flagellar hook capping protein [Geobacter uraniireducens Rf4]
          Length = 221

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL-KSNNLA- 80
          + +D FLKL +TQ+++QDP  P  +S+ ++QLA  +Q+EQ+   NS LQ++L ++NN   
Sbjct: 24 MNKDDFLKLFVTQLQNQDPMNPQDSSQFISQLAQLTQVEQAYNTNSNLQDMLNQANNTTT 83

Query: 81 -QASSYIGKNI 90
            A S+IGK +
Sbjct: 84 LSAVSFIGKEV 94


>gi|304310786|ref|YP_003810384.1| Flagellar basal-body rod modification protein FlgD [gamma
           proteobacterium HdN1]
 gi|301796519|emb|CBL44727.1| Flagellar basal-body rod modification protein FlgD [gamma
           proteobacterium HdN1]
          Length = 237

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 62/111 (55%), Gaps = 11/111 (9%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE-- 72
           S  KS     +D F++L++ Q+KHQ+P +P   +E VAQLA FS +E    +N ++++  
Sbjct: 33  SPQKSAAATDKDMFMQLMLAQLKHQNPLDPQDGTEFVAQLAQFSSLEGITNLNDSVKDIT 92

Query: 73  -LLKSNNLAQASSYIGKNITNADGSIS--------GVVNAIQVSSTGLTAI 114
            + +S+   QA++ +G+ +     S++        GV+NA Q +S  +  I
Sbjct: 93  SMYRSSQTLQATALVGREVLVDGDSVAFDGKNAALGVINAGQAASNAVMTI 143


>gi|148259133|ref|YP_001233260.1| flagellar hook capping protein [Acidiphilium cryptum JF-5]
 gi|326402286|ref|YP_004282367.1| putative flagellar hook capping protein [Acidiphilium multivorum
           AIU301]
 gi|146400814|gb|ABQ29341.1| flagellar hook capping protein [Acidiphilium cryptum JF-5]
 gi|325049147|dbj|BAJ79485.1| putative flagellar hook capping protein [Acidiphilium multivorum
           AIU301]
          Length = 253

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (68%), Gaps = 3/67 (4%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KSNNLAQASS 84
           FL +L TQ+++QDPT PM +S+  ++L  FSQ+EQ +  N +L +LL   ++ +L QASS
Sbjct: 66  FLTMLTTQLQNQDPTSPMSSSQFTSELVQFSQVEQQISTNQSLTQLLQLTQAGDLTQASS 125

Query: 85  YIGKNIT 91
            +G  +T
Sbjct: 126 MLGSKVT 132


>gi|302037612|ref|YP_003797934.1| flagellar hook capping protein FlgD (fragment) [Candidatus
          Nitrospira defluvii]
 gi|300605676|emb|CBK42009.1| Flagellar hook capping protein FlgD (fragment) [Candidatus
          Nitrospira defluvii]
          Length = 101

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 44/68 (64%)

Query: 5  TEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSV 64
          T+  P       +   K LG+D FLKLL+TQ++HQDP +PM+  + VAQ A FSQ+EQ  
Sbjct: 13 TQATPPDSSTPTTDGPKPLGKDDFLKLLVTQLQHQDPLKPMENEDFVAQTAQFSQLEQMS 72

Query: 65 QMNSTLQE 72
          ++ S +++
Sbjct: 73 KLVSLMEK 80


>gi|302343733|ref|YP_003808262.1| flagellar hook capping protein [Desulfarculus baarsii DSM 2075]
 gi|301640346|gb|ADK85668.1| flagellar hook capping protein [Desulfarculus baarsii DSM 2075]
          Length = 282

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 47/72 (65%), Gaps = 3/72 (4%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ---ELLKSNNL 79
          LGQDAFL + + Q+ +Q+P +PM  +E  AQLA FSQ+E+  Q+  +++   +L  S + 
Sbjct: 28 LGQDAFLTMFMAQVTNQNPLDPMDNTEFTAQLATFSQLEKLTQIAESMEGISDLQTSMDK 87

Query: 80 AQASSYIGKNIT 91
          + A  Y+GK +T
Sbjct: 88 SVALGYLGKEVT 99


>gi|192361923|ref|YP_001982401.1| flagellar basal-body rod modification protein FlgD [Cellvibrio
          japonicus Ueda107]
 gi|190688088|gb|ACE85766.1| flagellar basal-body rod modification protein FlgD [Cellvibrio
          japonicus Ueda107]
          Length = 231

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 48/74 (64%), Gaps = 1/74 (1%)

Query: 18 KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
          ++   LGQ AFL+L+I Q+ +Q+P  P   +E VAQLA FS +E   ++N +    + SN
Sbjct: 24 RNSNELGQAAFLELMIAQMNNQNPLSPQDNTEFVAQLAQFSSVEGLERLNKSFNSFM-SN 82

Query: 78 NLAQASSYIGKNIT 91
          N  QASS +G++++
Sbjct: 83 NALQASSLVGRSVS 96


>gi|86139469|ref|ZP_01058038.1| basal-body rod modification protein FlgD [Roseobacter sp. MED193]
 gi|85823972|gb|EAQ44178.1| basal-body rod modification protein FlgD [Roseobacter sp. MED193]
          Length = 231

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ---ELLKSNNLAQA 82
           D F+KLL  Q K+QDPTEPM  +E  +QLA FS +EQ V  N  L    E L   N+A  
Sbjct: 31  DTFIKLLTAQAKYQDPTEPMDNTEYASQLAEFSMVEQQVLTNDNLGSALEQLGLGNMAAL 90

Query: 83  SSYIGKNITNA 93
           + ++G  +  A
Sbjct: 91  TGWVGMEVRAA 101


>gi|284041519|ref|YP_003391859.1| flagellar hook capping protein [Conexibacter woesei DSM 14684]
 gi|283945740|gb|ADB48484.1| flagellar hook capping protein [Conexibacter woesei DSM 14684]
          Length = 152

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 61/111 (54%), Gaps = 11/111 (9%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           ++ +  LG+D FLKLLI Q+++QDP  P   +E + Q+  FS +EQ   +  T Q    +
Sbjct: 20  TRRESFLGKDDFLKLLIGQMQNQDPLNPTDGAEYMGQMTQFSILEQITNLGQTTQAAASN 79

Query: 77  NNLAQASSYIGKNIT-----NADG-----SISGVVNAIQVSSTGLTAITVD 117
           +  AQA   IG+ ++     N DG     S +G V ++  +S+G   +T+D
Sbjct: 80  DYDAQAIRLIGQTVSYLARVNEDGRSVLRSFTGRVESVTFTSSG-PQLTID 129


>gi|150390480|ref|YP_001320529.1| flagellar hook capping protein [Alkaliphilus metalliredigens QYMF]
 gi|149950342|gb|ABR48870.1| flagellar hook capping protein [Alkaliphilus metalliredigens QYMF]
          Length = 134

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 57/98 (58%), Gaps = 9/98 (9%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL---QE 72
           K K+   L +DAFLKLL+TQ+ +QDP  PM+  E ++Q+A FS +EQ   +N  L   +E
Sbjct: 19  KKKNTSDLDKDAFLKLLVTQMSNQDPLNPMEDREFISQMAQFSSLEQMQNLNDGLKDTKE 78

Query: 73  LLK------SNNLAQASSYIGKNITNADGSISGVVNAI 104
           LL       +NNL ++ + I   +   +  I+ V+N I
Sbjct: 79  LLADHITQMNNNLVKSQTTIADQLDLMNIQINKVLNHI 116


>gi|317051682|ref|YP_004112798.1| flagellar hook capping protein [Desulfurispirillum indicum S5]
 gi|316946766|gb|ADU66242.1| flagellar hook capping protein [Desulfurispirillum indicum S5]
          Length = 248

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 5/72 (6%)

Query: 20 KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL----K 75
          KK + +DAFL L+ITQ+++QDPT P   S+ +AQ A FSQ+EQ   M + +  L+    +
Sbjct: 27 KKEMDKDAFLHLMITQLRNQDPTNPQDNSQMIAQTAQFSQLEQLTNMTAAVDRLVAMQQQ 86

Query: 76 SNNLAQASSYIG 87
          + N   A++YIG
Sbjct: 87 TMNF-NAAAYIG 97


>gi|89895711|ref|YP_519198.1| hypothetical protein DSY2965 [Desulfitobacterium hafniense Y51]
 gi|89335159|dbj|BAE84754.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 193

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 59/97 (60%), Gaps = 10/97 (10%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE------ 72
           +K+ LG+D FLKLL+ ++ +QDP  PM   + + Q+A FS +EQ   M+ +++       
Sbjct: 31  TKEVLGKDDFLKLLVAELTNQDPLSPMDNKDMITQMAQFSSLEQMNNMSKSMENLVGAFG 90

Query: 73  -LLKSNNLAQASSYIGKNIT--NADGSI-SGVVNAIQ 105
            L +++ L+Q ++ IGK +   N +G I  G+V ++Q
Sbjct: 91  ALFQNSLLSQGAAMIGKYVAGLNTEGKIVEGLVQSVQ 127


>gi|323700470|ref|ZP_08112382.1| flagellar hook capping protein [Desulfovibrio sp. ND132]
 gi|323460402|gb|EGB16267.1| flagellar hook capping protein [Desulfovibrio desulfuricans ND132]
          Length = 225

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 4/73 (5%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQELLKSNNLAQA 82
           D F+ LL T++++QDPTEP+  ++ V Q+  +SQ+EQ  +MN    TL + L +  ++  
Sbjct: 32  DDFITLLCTELEYQDPTEPVDNTQMVDQMTQYSQLEQLTEMNEKMDTLTDALDAQGISSG 91

Query: 83  SSYIGKNITNADG 95
             Y+GK +  ADG
Sbjct: 92  LDYLGKEV-EADG 103


>gi|291529035|emb|CBK94621.1| Flagellar hook capping protein [Eubacterium rectale M104/1]
          Length = 237

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 7/107 (6%)

Query: 5   TEVNPTQQEFSKSK--SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           T   PTQ   + S   S   LG D FLKLL  ++++QDP EP   ++ VAQ+A FSQ+E 
Sbjct: 15  TNTTPTQNRKTSSAKASGSNLGYDDFLKLLSAEMQYQDPLEPTSNTDYVAQMATFSQLEA 74

Query: 63  SVQMNSTLQELLKSNNLAQASSYIGKNI-----TNADGSISGVVNAI 104
           ++ M  ++         + A S +GK +      +A G  SG V+ +
Sbjct: 75  TLSMKESMASSNDQTTKSAALSLVGKEVIVTDKDSASGYYSGKVDYV 121


>gi|291524894|emb|CBK90481.1| Flagellar hook capping protein [Eubacterium rectale DSM 17629]
          Length = 237

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 7/107 (6%)

Query: 5   TEVNPTQQEFSKSK--SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           T   PTQ   + S   S   LG D FLKLL  ++++QDP EP   ++ VAQ+A FSQ+E 
Sbjct: 15  TNTTPTQNRKTSSAKASGSNLGYDDFLKLLSAEMQYQDPLEPTSNTDYVAQMATFSQLEA 74

Query: 63  SVQMNSTLQELLKSNNLAQASSYIGKNI-----TNADGSISGVVNAI 104
           ++ M  ++         + A S +GK +      +A G  SG V+ +
Sbjct: 75  TLSMKESMASSNDQTTKSAALSLVGKEVIVTDKDSASGYYSGKVDYV 121


>gi|298530011|ref|ZP_07017413.1| flagellar hook capping protein [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298509385|gb|EFI33289.1| flagellar hook capping protein [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 241

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 49/90 (54%), Gaps = 16/90 (17%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ---------SVQM 66
           + +    LG+  FLKLLITQ+++QDP +PM   E VAQLA FS +EQ         S+  
Sbjct: 24  RDEDPAELGKMDFLKLLITQLENQDPLDPMDDKEFVAQLAQFSSLEQLTNISEGMESMNE 83

Query: 67  NSTLQELLKSNNLAQASSYIGKNITNADGS 96
           N   QE+L       A  +IGK I  ADG 
Sbjct: 84  NQARQEMLG------AVGFIGKEIR-ADGD 106


>gi|85859174|ref|YP_461376.1| flagellar hook capping protein [Syntrophus aciditrophicus SB]
 gi|85722265|gb|ABC77208.1| flagellar hook capping protein [Syntrophus aciditrophicus SB]
          Length = 220

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 49/78 (62%), Gaps = 3/78 (3%)

Query: 17 SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK- 75
          + + K  G+D FLK+LI Q+++Q+P  P+  ++  AQLA FS +EQ   MNSTL+ L   
Sbjct: 18 TSTNKLTGKDEFLKMLIAQLQNQNPLNPLDGTDFAAQLAQFSSLEQLTNMNSTLESLSAL 77

Query: 76 --SNNLAQASSYIGKNIT 91
            + N   A++ IG+ ++
Sbjct: 78 QTTQNGIMAANLIGRQVS 95


>gi|238926248|ref|ZP_04658008.1| possible flagellar basal body rod modification protein [Selenomonas
           flueggei ATCC 43531]
 gi|238885928|gb|EEQ49566.1| possible flagellar basal body rod modification protein [Selenomonas
           flueggei ATCC 43531]
          Length = 168

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 52/86 (60%), Gaps = 7/86 (8%)

Query: 12  QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
           Q  + SK    LG+DAFL+LL+TQ+++QDP  P   +E ++QLA FS +EQ   ++  L+
Sbjct: 22  QAKAASKDNSALGKDAFLQLLVTQMRYQDPLNPQDNAEYLSQLAQFSALEQMTNVSKGLE 81

Query: 72  ELLK-------SNNLAQASSYIGKNI 90
           ++ K       S  + Q SS IG+ I
Sbjct: 82  KVSKIVDNIDSSVLIGQLSSMIGQPI 107


>gi|326204619|ref|ZP_08194475.1| flagellar hook capping protein [Clostridium papyrosolvens DSM
          2782]
 gi|325985186|gb|EGD46026.1| flagellar hook capping protein [Clostridium papyrosolvens DSM
          2782]
          Length = 286

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (61%), Gaps = 7/81 (8%)

Query: 11 QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
          +Q  +  K+   LG++ FL LL+TQ+++QDP +P+   E +AQ+A FS +EQ   MN ++
Sbjct: 23 KQAAAARKTGGELGKNDFLNLLVTQLRYQDPLQPVDDKEFIAQMAQFSSLEQMQNMNGSM 82

Query: 71 QELLKSNNLAQASSYIGKNIT 91
           +       +QA + IGK IT
Sbjct: 83 TK-------SQAFTLIGKVIT 96


>gi|295706278|ref|YP_003599353.1| flagellar hook assembly protein [Bacillus megaterium DSM 319]
 gi|294803937|gb|ADF41003.1| flagellar hook assembly protein [Bacillus megaterium DSM 319]
          Length = 142

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 16 KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL- 74
          K     +LG+D FLKLLI Q+++QDP  PM+  + +AQ+A FS +EQ   M+++L   L 
Sbjct: 19 KQTGNSSLGKDDFLKLLIAQLQNQDPMNPMQDKDFIAQMAQFSSLEQMTNMSTSLNTFLT 78

Query: 75 --KSNNLAQASSYIGK 88
            +++ + + S  IGK
Sbjct: 79 QSQASPILKGSELIGK 94


>gi|167630296|ref|YP_001680795.1| flagellar hook capping protein, putative [Heliobacterium
          modesticaldum Ice1]
 gi|167593036|gb|ABZ84784.1| flagellar hook capping protein, putative [Heliobacterium
          modesticaldum Ice1]
          Length = 188

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/45 (55%), Positives = 35/45 (77%)

Query: 18 KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
          KS   LG+D FLKLL+TQ+++QDP +PM+  E +AQ+A FS +EQ
Sbjct: 22 KSNSQLGKDDFLKLLVTQLRYQDPMKPMEDKEFIAQMAQFSSLEQ 66


>gi|152965623|ref|YP_001361407.1| flagellar hook capping protein [Kineococcus radiotolerans SRS30216]
 gi|151360140|gb|ABS03143.1| flagellar hook capping protein [Kineococcus radiotolerans SRS30216]
          Length = 175

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 58/98 (59%), Gaps = 3/98 (3%)

Query: 7   VNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQM 66
            N T    S + +K    +D FLKLL+ Q+K+QDP++P   ++ +AQ A FS +E   ++
Sbjct: 31  ANKTDTSASAAVAKTKTDKDTFLKLLVAQLKYQDPSKPADTTQFMAQTAQFSALETMQEV 90

Query: 67  NSTLQELLKSNNLAQASSYIGK--NITNADGSI-SGVV 101
            ++   +L + N  QAS+ IG+  + T  DG+  SGVV
Sbjct: 91  AASSGSMLAAQNKLQASTLIGQIVSYTGEDGTAKSGVV 128


>gi|326791536|ref|YP_004309357.1| flagellar hook capping protein [Clostridium lentocellum DSM 5427]
 gi|326542300|gb|ADZ84159.1| flagellar hook capping protein [Clostridium lentocellum DSM 5427]
          Length = 270

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 55/92 (59%), Gaps = 1/92 (1%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           K +  L +DAF+ LL+TQ+K+QDP +P+  SE +AQLA F+ +EQ + +    Q+ L + 
Sbjct: 23  KEQSELDKDAFINLLVTQMKYQDPLDPVDNSEMLAQLAQFTALEQMMNVAQASQKQLANG 82

Query: 78  NLAQASSYIGKNI-TNADGSISGVVNAIQVSS 108
            + +   Y+ K+  T     + G V+ ++VS 
Sbjct: 83  MIGKYVEYLYKDSETGTSEYLVGKVDYVKVSG 114


>gi|320530203|ref|ZP_08031273.1| flagellar hook capping protein [Selenomonas artemidis F0399]
 gi|320137636|gb|EFW29548.1| flagellar hook capping protein [Selenomonas artemidis F0399]
          Length = 176

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (63%)

Query: 12 QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          QE + +K    LG+DAFL+LL+TQ+K+QDP +P   S+ ++QLA FS +EQ   +   L 
Sbjct: 22 QEKAANKKNDALGKDAFLQLLVTQMKYQDPLDPQDNSQYLSQLAQFSALEQMTNVAKGLS 81

Query: 72 ELLKSNNLAQASSYIGK 88
          ++ K  +   +S  IG+
Sbjct: 82 DVQKVVDNINSSVLIGQ 98


>gi|313894826|ref|ZP_07828386.1| flagellar hook capping protein [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312976507|gb|EFR41962.1| flagellar hook capping protein [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 180

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (63%)

Query: 12  QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
           QE + +K    LG+DAFL+LL+TQ+K+QDP +P   S+ ++QLA FS +EQ   +   L 
Sbjct: 26  QEKAANKKNDALGKDAFLQLLVTQMKYQDPLDPQDNSQYLSQLAQFSALEQMTNVAKGLS 85

Query: 72  ELLKSNNLAQASSYIGK 88
           ++ K  +   +S  IG+
Sbjct: 86  DVQKVVDNINSSVLIGQ 102


>gi|83591886|ref|YP_425638.1| flagellar hook capping protein [Rhodospirillum rubrum ATCC 11170]
 gi|83574800|gb|ABC21351.1| Flagellar hook capping protein [Rhodospirillum rubrum ATCC 11170]
          Length = 245

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 62/109 (56%), Gaps = 5/109 (4%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           + K T   + FL LL +Q+K+QDP  PM ++E   QL  F+Q+EQ +  N  +++LL  +
Sbjct: 24  RGKLTSDMNTFLTLLTSQLKNQDPLSPMDSTEFTNQLVQFAQVEQQINTNDNMEKLLAVS 83

Query: 78  NLAQAS---SYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPI 123
             +QA+    Y+GK +  A+ ++  + +   V + GLTA   DN  I +
Sbjct: 84  GNSQAAMAVGYLGKYV-EAESTVVALQDGQAVFTYGLTA-AADNVTIAL 130


>gi|315497295|ref|YP_004086099.1| flagellar hook capping protein [Asticcacaulis excentricus CB 48]
 gi|315415307|gb|ADU11948.1| flagellar hook capping protein [Asticcacaulis excentricus CB 48]
          Length = 219

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL--KSNNLAQASSY 85
          FL LL  Q+K+QDP  PM ++E  +QL  +S +EQ ++ N  L  L+     +L+ A +Y
Sbjct: 31 FLSLLTAQLKNQDPLSPMDSTEWTSQLVQYSSVEQQIKTNDYLSTLVAQSGGSLSSAVNY 90

Query: 86 IGKNIT 91
          IGK+IT
Sbjct: 91 IGKSIT 96


>gi|294500932|ref|YP_003564632.1| flagellar hook assembly protein [Bacillus megaterium QM B1551]
 gi|294350869|gb|ADE71198.1| flagellar hook assembly protein [Bacillus megaterium QM B1551]
          Length = 142

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 16 KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL- 74
          K     +LG+D FLKLLI Q+++QDP  PM+  + +AQ+A FS +EQ   M+++L   L 
Sbjct: 19 KQTGNSSLGKDDFLKLLIAQLQNQDPMNPMQDKDFIAQMAQFSSLEQMTNMSTSLNTFLT 78

Query: 75 --KSNNLAQASSYIGK 88
            +++ + + S  IGK
Sbjct: 79 QSQASPILKGSELIGK 94


>gi|332799180|ref|YP_004460679.1| flagellar hook capping protein [Tepidanaerobacter sp. Re1]
 gi|332696915|gb|AEE91372.1| flagellar hook capping protein [Tepidanaerobacter sp. Re1]
          Length = 128

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/45 (55%), Positives = 34/45 (75%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN 67
          L +D FLKLL+TQ+++QDP EPM  +E +AQLA FS +EQ   +N
Sbjct: 23 LDKDDFLKLLVTQLRYQDPLEPMDNNEYIAQLAQFSSLEQMQNLN 67


>gi|120554032|ref|YP_958383.1| flagellar hook capping protein [Marinobacter aquaeolei VT8]
 gi|120323881|gb|ABM18196.1| flagellar hook capping protein [Marinobacter aquaeolei VT8]
          Length = 225

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 67/116 (57%), Gaps = 15/116 (12%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL- 73
            K+     LG+DAF++L++ Q+K+Q+P EP    + +AQLA FS +E+   ++ ++ ++ 
Sbjct: 22  GKTPGGNELGKDAFMELMLAQLKNQNPLEPQDNGDFIAQLAQFSSLEEMQNLSGSVDDVV 81

Query: 74  --LKSNNLAQASSYIGK--------NITNADGSISGVVNAIQV-SSTGLTAITVDN 118
              +S+   QAS+ +GK         I  ++G I+G    IQV +STG   ++V N
Sbjct: 82  GQFRSSQALQASAMVGKTVLAPSSVGILGSEGEITGT---IQVPASTGGLRLSVMN 134


>gi|283782099|ref|YP_003372854.1| flagellar hook capping protein [Pirellula staleyi DSM 6068]
 gi|283440552|gb|ADB18994.1| flagellar hook capping protein [Pirellula staleyi DSM 6068]
          Length = 145

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 55/94 (58%), Gaps = 3/94 (3%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK 75
           K KS + LG D FL+L+IT++ +QDP  PM  ++ V Q+    ++  + +++ TL  +L 
Sbjct: 21  KPKSLEDLGIDEFLQLMITELTNQDPLNPMDNAQMVEQIGQIREIASNDKLSRTLDSVLT 80

Query: 76  SNNLAQASSYIGKNITNAD---GSISGVVNAIQV 106
             +L  AS  IG+ +T  D    ++ G+V+ + +
Sbjct: 81  GQSLTTASGLIGREVTALDLNNENVEGIVDRVSI 114


>gi|311030123|ref|ZP_07708213.1| hypothetical protein Bm3-1_06191 [Bacillus sp. m3-13]
          Length = 217

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%), Gaps = 3/78 (3%)

Query: 17 SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
          S     +G+D FL+LLI Q+++QDP  PM+  E +AQ+A FS +EQ   +N +++  + +
Sbjct: 19 SNQNNVMGKDDFLRLLIAQLQNQDPLNPMEDREFIAQMANFSSLEQMANLNKSMEGFIDT 78

Query: 77 NNLAQASS---YIGKNIT 91
           N     S   Y+G  +T
Sbjct: 79 QNKMNVLSLQQYLGSELT 96


>gi|307823530|ref|ZP_07653759.1| flagellar hook capping protein [Methylobacter tundripaludum SV96]
 gi|307735515|gb|EFO06363.1| flagellar hook capping protein [Methylobacter tundripaludum SV96]
          Length = 231

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 56/104 (53%), Gaps = 11/104 (10%)

Query: 10  TQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST 69
           T+ + + +  K +LGQD FLKL+ TQ+ HQDPT+PM+  + + Q+A F  +     +  +
Sbjct: 17  TKNDSAATTKKTSLGQDDFLKLMTTQMTHQDPTKPMENGQFITQIAQFGTVSGIQDLQKS 76

Query: 70  LQELLKSNNLA---QASSYIG--------KNITNADGSISGVVN 102
             +   S N +   QA+S +G        K +  A G I+G +N
Sbjct: 77  FGDFAGSINSSQALQATSLVGRYVSAPGTKGVLEAGGDITGNIN 120


>gi|126738592|ref|ZP_01754297.1| basal-body rod modification protein FlgD [Roseobacter sp.
           SK209-2-6]
 gi|126720391|gb|EBA17097.1| basal-body rod modification protein FlgD [Roseobacter sp.
           SK209-2-6]
          Length = 228

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 41/68 (60%), Gaps = 3/68 (4%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQELLKSNNLAQA 82
           D F+KLL  Q ++QDP EPM  +E  +QLA FS +EQ V  N   ST+ E L   N+A  
Sbjct: 33  DTFIKLLTAQAQYQDPLEPMDNTEYASQLAEFSMVEQQVLTNTNLSTVHEQLGLGNMASL 92

Query: 83  SSYIGKNI 90
           + ++G  +
Sbjct: 93  TGWVGMEV 100


>gi|83646775|ref|YP_435210.1| flagellar hook capping protein [Hahella chejuensis KCTC 2396]
 gi|83634818|gb|ABC30785.1| Flagellar hook capping protein [Hahella chejuensis KCTC 2396]
          Length = 136

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%)

Query: 20 KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
          + T+G + FL++ +TQ+  QDP EP+   E +AQLA FS +E + + N  ++ LL   ++
Sbjct: 18 QNTVGIEDFLQIFLTQLTFQDPLEPVDNREFIAQLAQFSSLETATRTNENIEGLLDVQSV 77

Query: 80 AQASSYIGKNI 90
          AQ    IGK +
Sbjct: 78 AQTVGLIGKTV 88


>gi|94500240|ref|ZP_01306773.1| Flagellar hook capping protein [Oceanobacter sp. RED65]
 gi|94427539|gb|EAT12516.1| Flagellar hook capping protein [Oceanobacter sp. RED65]
          Length = 262

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNL 79
           LG++ FLKLL+TQ+ +Q+P +P + SE VAQLA FS +E    +N+T+  +   L+S+  
Sbjct: 30  LGRNEFLKLLVTQMNNQNPLKPQENSEFVAQLAQFSSVEGLENLNTTVDSMSDGLRSSQA 89

Query: 80  AQASSYIGKNI 90
            QASS +G+++
Sbjct: 90  LQASSLVGQSV 100


>gi|229826309|ref|ZP_04452378.1| hypothetical protein GCWU000182_01681 [Abiotrophia defectiva ATCC
           49176]
 gi|229789179|gb|EEP25293.1| hypothetical protein GCWU000182_01681 [Abiotrophia defectiva ATCC
           49176]
          Length = 317

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 55/91 (60%), Gaps = 14/91 (15%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           LG+D+FLKLL  Q+++QDP +P   +E V+QLA +S +EQ   +N+T+         +QA
Sbjct: 44  LGKDSFLKLLCAQMENQDPMQPQSNTEWVSQLATYSSLEQMQNLNATIAN-------SQA 96

Query: 83  SSYIGKNIT----NADG---SISGVVNAIQV 106
              IG+ +     ++DG   ++SG V+ + V
Sbjct: 97  YGLIGQEVVMAAKDSDGHETTVSGKVDFVSV 127


>gi|83816116|ref|YP_446707.1| basal-body rod modification protein FlgD [Salinibacter ruber DSM
           13855]
 gi|294508643|ref|YP_003572702.1| Basal-body rod modification protein flgD [Salinibacter ruber M8]
 gi|83757510|gb|ABC45623.1| basal-body rod modification protein FlgD [Salinibacter ruber DSM
           13855]
 gi|294344972|emb|CBH25750.1| Basal-body rod modification protein flgD [Salinibacter ruber M8]
          Length = 260

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 56/102 (54%), Gaps = 14/102 (13%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN-LAQ 81
           LG++ FLKLL TQ+++QDP+ PMK  +  AQLA FS +EQ   ++  ++E  KS+  LAQ
Sbjct: 61  LGKNDFLKLLTTQLQNQDPSNPMKGKDFAAQLAQFSSVEQLTNISGQIEEQGKSDGALAQ 120

Query: 82  ------ASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVD 117
                 A+  IG+ +  +        N +Q +  G     VD
Sbjct: 121 SINDSMATDLIGRTVKTSG-------NTLQWTGEGEATFGVD 155


>gi|163738073|ref|ZP_02145489.1| flagellar hook capping protein [Phaeobacter gallaeciensis BS107]
 gi|161388689|gb|EDQ13042.1| flagellar hook capping protein [Phaeobacter gallaeciensis BS107]
          Length = 230

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 53/97 (54%), Gaps = 7/97 (7%)

Query: 18  KSKKTLG----QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
           + KKT G     + FLK+L  Q ++QDP EP+ ++E  AQLA FS +EQ VQ N  L+ +
Sbjct: 23  EPKKTTGIASDFETFLKMLTAQARYQDPLEPIDSTEYSAQLAQFSMVEQQVQGNEVLEGI 82

Query: 74  ---LKSNNLAQASSYIGKNITNADGSISGVVNAIQVS 107
              L   N+A  S ++G    +A  +     N + VS
Sbjct: 83  QAQLGLANMAAMSGWVGMETRSAAPAYFDGTNPVTVS 119


>gi|148358805|ref|YP_001250012.1| flagellar basal body rod modification protein FlgD [Legionella
          pneumophila str. Corby]
 gi|296106850|ref|YP_003618550.1| flagellar basal-body rod modification protein FlgD [Legionella
          pneumophila 2300/99 Alcoy]
 gi|148280578|gb|ABQ54666.1| flagellar basal body rod modification protein FlgD [Legionella
          pneumophila str. Corby]
 gi|295648751|gb|ADG24598.1| flagellar basal-body rod modification protein FlgD [Legionella
          pneumophila 2300/99 Alcoy]
          Length = 225

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 49/77 (63%), Gaps = 3/77 (3%)

Query: 17 SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL--- 73
          S  ++ LGQ  FL+L++ Q+++QDP +P    E ++QLA FS  +   +M  +LQ+L   
Sbjct: 22 SDKRQNLGQQDFLRLMVAQVQNQDPLQPQANGEFLSQLAQFSTNDGITKMQESLQQLASS 81

Query: 74 LKSNNLAQASSYIGKNI 90
          L+SN   QAS+ +G+ +
Sbjct: 82 LQSNQALQASALVGRKV 98


>gi|163742531|ref|ZP_02149917.1| basal-body rod modification protein FlgD [Phaeobacter gallaeciensis
           2.10]
 gi|161384116|gb|EDQ08499.1| basal-body rod modification protein FlgD [Phaeobacter gallaeciensis
           2.10]
          Length = 230

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 53/97 (54%), Gaps = 7/97 (7%)

Query: 18  KSKKTLG----QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
           + KKT G     + FLK+L  Q ++QDP EP+ ++E  AQLA FS +EQ VQ N  L+ +
Sbjct: 23  EPKKTTGIASDFETFLKMLTAQARYQDPLEPIDSTEYSAQLAQFSMVEQQVQGNEVLEGI 82

Query: 74  ---LKSNNLAQASSYIGKNITNADGSISGVVNAIQVS 107
              L   N+A  S ++G    +A  +     N + VS
Sbjct: 83  QAQLGLANMAAMSGWVGMETRSAAPAYFDGTNPVTVS 119


>gi|54297181|ref|YP_123550.1| flagellar basal body rod modification protein [Legionella
          pneumophila str. Paris]
 gi|53750966|emb|CAH12377.1| Flagellar basal-body rod modification protein FlgD [Legionella
          pneumophila str. Paris]
          Length = 225

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 49/77 (63%), Gaps = 3/77 (3%)

Query: 17 SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL--- 73
          S  ++ LGQ  FL+L++ Q+++QDP +P    E ++QLA FS  +   +M  +LQ+L   
Sbjct: 22 SDKRQNLGQQDFLRLMVAQVQNQDPLQPQANGEFLSQLAQFSTNDGITKMQESLQQLASS 81

Query: 74 LKSNNLAQASSYIGKNI 90
          L+SN   QAS+ +G+ +
Sbjct: 82 LQSNQALQASALVGRKV 98


>gi|254785370|ref|YP_003072799.1| flagellar basal-body rod modification protein FlgD [Teredinibacter
           turnerae T7901]
 gi|237687333|gb|ACR14597.1| flagellar basal-body rod modification protein FlgD [Teredinibacter
           turnerae T7901]
          Length = 238

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 47/72 (65%), Gaps = 3/72 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNL 79
           LGQ AFL+L+ITQ+++QDP  P + +E +AQLA FS +E   ++N+          +N  
Sbjct: 30  LGQSAFLELMITQMENQDPLSPQENTEFIAQLAQFSSVEALDKLNNNFDSFTNNFMANQA 89

Query: 80  AQASSYIGKNIT 91
            QAS+ +G+++T
Sbjct: 90  LQASTLVGRSVT 101


>gi|54294162|ref|YP_126577.1| flagellar basal body rod modification protein [Legionella
          pneumophila str. Lens]
 gi|53753994|emb|CAH15465.1| Flagellar basal-body rod modification protein FlgD [Legionella
          pneumophila str. Lens]
 gi|307609976|emb|CBW99505.1| flagellar basal-body rod modification protein FlgD [Legionella
          pneumophila 130b]
          Length = 225

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 49/77 (63%), Gaps = 3/77 (3%)

Query: 17 SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL--- 73
          S  ++ LGQ  FL+L++ Q+++QDP +P    E ++QLA FS  +   +M  +LQ+L   
Sbjct: 22 SDKRQNLGQQDFLRLMVAQVQNQDPLQPQANGEFLSQLAQFSTNDGITKMQESLQQLASS 81

Query: 74 LKSNNLAQASSYIGKNI 90
          L+SN   QAS+ +G+ +
Sbjct: 82 LQSNQALQASALVGRKV 98


>gi|327480019|gb|AEA83329.1| flagellar basal body rod modification protein [Pseudomonas stutzeri
           DSM 4166]
          Length = 227

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 54/85 (63%), Gaps = 5/85 (5%)

Query: 11  QQEFSKSKSKKT--LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
           Q +F + +  K   LG++ FL+LL+ Q+ +Q+P EP +  E + QLA FS +E   ++NS
Sbjct: 16  QYQFGEKREAKGNDLGKNEFLELLVAQLNNQNPLEPQENGEFIGQLAQFSTVEGVEKLNS 75

Query: 69  TLQELL---KSNNLAQASSYIGKNI 90
           ++Q +L   +S+   QASS +G+ +
Sbjct: 76  SMQTILSGYQSSQALQASSLVGRKV 100


>gi|52841450|ref|YP_095249.1| flagellar basal body rod modification protein [Legionella
          pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|52628561|gb|AAU27302.1| flagellar basal body rod modification protein FlgD [Legionella
          pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 225

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 49/77 (63%), Gaps = 3/77 (3%)

Query: 17 SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL--- 73
          S  ++ LGQ  FL+L++ Q+++QDP +P    E ++QLA FS  +   +M  +LQ+L   
Sbjct: 22 SGKRQNLGQQDFLRLMVAQVQNQDPLQPQANGEFLSQLAQFSTNDGITKMQESLQQLASS 81

Query: 74 LKSNNLAQASSYIGKNI 90
          L+SN   QAS+ +G+ +
Sbjct: 82 LQSNQALQASALVGRKV 98


>gi|222100887|ref|YP_002535455.1| Basal-body rod modification protein FlgD [Thermotoga neapolitana
          DSM 4359]
 gi|221573277|gb|ACM24089.1| Basal-body rod modification protein FlgD [Thermotoga neapolitana
          DSM 4359]
          Length = 223

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 19 SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK--- 75
          + KTL +DAFL+LL+ +++ QDP EPM+  + ++QL+  + +EQ   + S +++ ++   
Sbjct: 22 ASKTLDKDAFLRLLLQELEMQDPLEPMETKDMISQLSQLTSLEQITNLTSAVKDFVEAQT 81

Query: 76 SNNLAQASSYIGKNI 90
          S N AQ +S IGK +
Sbjct: 82 SVNPAQLASLIGKYV 96


>gi|149375035|ref|ZP_01892808.1| Flagellar hook capping protein [Marinobacter algicola DG893]
 gi|149360924|gb|EDM49375.1| Flagellar hook capping protein [Marinobacter algicola DG893]
          Length = 224

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 68/132 (51%), Gaps = 32/132 (24%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           QQE +   S+  LG++ F++L+I Q+K+Q+P EP    E ++QLA FS +E+   ++ ++
Sbjct: 19  QQEQTAKGSE--LGKNEFMELMIAQLKNQNPLEPQDNGEFISQLAQFSSLEEMQSLSGSV 76

Query: 71  QEL---LKSNNLAQASSYIGK--------NITNADGSISGVVNAIQVSSTGLTAITVDNT 119
            ++    +S    QAS+ +G+         +  ADG ISG                  N 
Sbjct: 77  DDMASQFRSTQALQASAMVGRTVLAPSSIGVLGADGEISG------------------NV 118

Query: 120 EIPITT-GIRIS 130
            +P TT G+RIS
Sbjct: 119 SVPATTSGLRIS 130


>gi|227876746|ref|ZP_03994855.1| conserved hypothetical protein [Mobiluncus mulieris ATCC 35243]
 gi|227842643|gb|EEJ52843.1| conserved hypothetical protein [Mobiluncus mulieris ATCC 35243]
          Length = 336

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 63/110 (57%), Gaps = 11/110 (10%)

Query: 12  QEFSKSKSKK----TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN 67
           Q   K+++KK     LG+D F+KLL+  +K+QDPT+PM  ++ + Q +  + MEQ +QM 
Sbjct: 70  QRTDKAQTKKEDPTKLGKDDFMKLLLATLKYQDPTQPMDTAQLLEQTSTMTNMEQMIQMT 129

Query: 68  STLQELLKSNNLAQASSYIGK----NITNADG---SISGVVNAIQVSSTG 110
              +   ++    Q +S +G+    ++ + +G   + +G V+A++  + G
Sbjct: 130 EASKRAYEAQQRVQGASMVGRTAVYDLIDDEGNAKTTAGKVDAVEFLAEG 179


>gi|226225730|ref|YP_002759836.1| putative flagellar basal-body rod modification protein FlgD
          [Gemmatimonas aurantiaca T-27]
 gi|226088921|dbj|BAH37366.1| putative flagellar basal-body rod modification protein FlgD
          [Gemmatimonas aurantiaca T-27]
          Length = 267

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (72%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
          +G+D FLK+L+ Q+K+QDP  PM   +  AQLA FS +EQ ++MN +L
Sbjct: 50 MGRDEFLKMLVAQLKNQDPLNPMDGKDMAAQLAQFSTVEQLLKMNESL 97


>gi|83589629|ref|YP_429638.1| flagellar hook capping protein [Moorella thermoacetica ATCC 39073]
 gi|83572543|gb|ABC19095.1| Flagellar hook capping protein [Moorella thermoacetica ATCC 39073]
          Length = 140

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 54/93 (58%), Gaps = 6/93 (6%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA 80
           K LG+D FLKLL  Q+++QDP  P+  ++ +AQ+A FS +EQ   +  +  E L    + 
Sbjct: 21  KGLGKDDFLKLLAAQLQNQDPLNPVSNTDFIAQMAQFSVLEQMNNLYESFNEAL----ML 76

Query: 81  QASSYIGKNITNA--DGSISGVVNAIQVSSTGL 111
           QA   IGK +T    D +++G V+ +  S  G+
Sbjct: 77  QAVGLIGKEVTARINDQTLTGTVSKVNWSPEGI 109


>gi|330502733|ref|YP_004379602.1| flagellar basal body rod modification protein [Pseudomonas
          mendocina NK-01]
 gi|328917019|gb|AEB57850.1| flagellar basal body rod modification protein [Pseudomonas
          mendocina NK-01]
          Length = 221

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 50/77 (64%), Gaps = 3/77 (3%)

Query: 17 SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL-- 74
          +K  K LG++ FL LL+ Q+ +Q+P EP    E +AQLA FSQ+E   ++N+++  +L  
Sbjct: 20 TKQNKDLGKNEFLNLLVAQLNNQNPLEPQGNGEFIAQLAQFSQVEGIEKLNTSMGSMLSS 79

Query: 75 -KSNNLAQASSYIGKNI 90
           +S+   QASS +G+ +
Sbjct: 80 FQSSQALQASSLVGRKV 96


>gi|306817693|ref|ZP_07451435.1| flagellar hook assembly protein FlgD [Mobiluncus mulieris ATCC
           35239]
 gi|304649507|gb|EFM46790.1| flagellar hook assembly protein FlgD [Mobiluncus mulieris ATCC
           35239]
          Length = 334

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 63/110 (57%), Gaps = 11/110 (10%)

Query: 12  QEFSKSKSKK----TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN 67
           Q   K+++KK     LG+D F+KLL+  +K+QDPT+PM  ++ + Q +  + MEQ +QM 
Sbjct: 68  QRTDKAQTKKEDPTKLGKDDFMKLLLATLKYQDPTQPMDTAQLLEQTSTMTNMEQMIQMT 127

Query: 68  STLQELLKSNNLAQASSYIGK----NITNADG---SISGVVNAIQVSSTG 110
              +   ++    Q +S +G+    ++ + +G   + +G V+A++  + G
Sbjct: 128 EASKRAYEAQQRVQGASMVGRTAVYDLIDDEGNAKTTAGKVDAVEFLAEG 177


>gi|327441048|dbj|BAK17413.1| flagellar hook capping protein [Solibacillus silvestris StLB046]
          Length = 231

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          LG+DAFLK+LITQ+++QDPT PM   E ++Q+A FS +EQ   M   ++
Sbjct: 29 LGKDAFLKILITQLQNQDPTSPMDDKEFISQMAQFSSLEQMQNMTKAME 77


>gi|326796598|ref|YP_004314418.1| flagellar hook capping protein [Marinomonas mediterranea MMB-1]
 gi|326547362|gb|ADZ92582.1| flagellar hook capping protein [Marinomonas mediterranea MMB-1]
          Length = 236

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 58/102 (56%), Gaps = 9/102 (8%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST---LQELLKSNNLAQASS 84
           F++L I Q+K+QDPT P +  + V+Q+A FS +EQ   M+ST   + E L S+    AS+
Sbjct: 48  FMELYIAQLKNQDPTAPQETGDMVSQMAEFSSLEQLTDMSSTMTSMSEALVSSQALTAST 107

Query: 85  YIGKNIT------NADGSISGVVNAIQVSSTGLTAITVDNTE 120
            +GK++       + DGS    + A   S +  T +T+ +++
Sbjct: 108 LVGKSVYVDQDTISYDGSTDAYIKATIPSDSSATTVTITDSD 149


>gi|304437041|ref|ZP_07397004.1| flagellar hook capping protein [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304369992|gb|EFM23654.1| flagellar hook capping protein [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 174

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 7/80 (8%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK-- 75
           K    LG+DAFL+LL+TQ+++QDP  P   +E ++QLA FS +EQ   ++  L+++ K  
Sbjct: 34  KDNSALGKDAFLQLLVTQMRYQDPLNPQDNAEYLSQLAQFSALEQMTNVSKGLEKVSKIV 93

Query: 76  -----SNNLAQASSYIGKNI 90
                S  + Q SS IG+ I
Sbjct: 94  DNIDSSVLIGQLSSMIGQPI 113


>gi|83647174|ref|YP_435609.1| flagellar hook capping protein [Hahella chejuensis KCTC 2396]
 gi|83635217|gb|ABC31184.1| Flagellar hook capping protein [Hahella chejuensis KCTC 2396]
          Length = 225

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 58/98 (59%), Gaps = 12/98 (12%)

Query: 16  KSKSKKT-LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL- 73
           KS ++K  LG++ F+ L+I Q+ +Q P +P   +  VAQLA FS +E    +NST+  + 
Sbjct: 22  KSANRKNELGKNEFMDLMIAQLNNQSPLDPQDNTAFVAQLAQFSSVEGIQSLNSTVDTMA 81

Query: 74  --LKSNNLAQASSYIGKN--------ITNADGSISGVV 101
              +S    QAS+ +G++        I +ADGSI+GVV
Sbjct: 82  SQFRSAQALQASAMVGRDVLAPMESAIKSADGSINGVV 119


>gi|319787122|ref|YP_004146597.1| flagellar hook capping protein [Pseudoxanthomonas suwonensis 11-1]
 gi|317465634|gb|ADV27366.1| flagellar hook capping protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 221

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 63/126 (50%), Gaps = 17/126 (13%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS---TLQ 71
           SK KS  +LGQ  FL+L+  Q+KHQDP  PM+ S  + Q+A FS ++    +NS     Q
Sbjct: 20  SKDKSD-SLGQADFLRLMTEQLKHQDPLNPMENSAFLGQMAQFSTVQGIETLNSQVRAFQ 78

Query: 72  ELLKSNNLAQASSYIGKNI--------TNADGSISGVVNA-----IQVSSTGLTAITVDN 118
             L S+ L + ++ +G+++         +  GS  G V A     +Q + T     TV  
Sbjct: 79  SALGSDQLLRGAAMVGRDVLVPSTKLALDDSGSAHGAVAAPDAGSVQFTVTDANGRTVRE 138

Query: 119 TEIPIT 124
             +P T
Sbjct: 139 FSVPAT 144


>gi|269976273|ref|ZP_06183269.1| putative flagellar hook capping protein [Mobiluncus mulieris 28-1]
 gi|269935602|gb|EEZ92140.1| putative flagellar hook capping protein [Mobiluncus mulieris 28-1]
          Length = 374

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 63/110 (57%), Gaps = 11/110 (10%)

Query: 12  QEFSKSKSKK----TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN 67
           Q   K+++KK     LG+D F+KLL+  +K+QDPT+PM  ++ + Q +  + MEQ +QM 
Sbjct: 99  QRTDKAQTKKEDPTKLGKDDFMKLLLATLKYQDPTQPMDTAQLLEQTSTMTNMEQMIQMT 158

Query: 68  STLQELLKSNNLAQASSYIGK----NITNADG---SISGVVNAIQVSSTG 110
              +   ++    Q +S +G+    ++ + +G   + +G V+A++  + G
Sbjct: 159 EASKRAYEAQQRVQGASMVGRTAVYDLIDDEGNAKTTAGKVDAVEFLAEG 208


>gi|332703534|ref|ZP_08423622.1| flagellar hook capping protein [Desulfovibrio africanus str.
          Walvis Bay]
 gi|332553683|gb|EGJ50727.1| flagellar hook capping protein [Desulfovibrio africanus str.
          Walvis Bay]
          Length = 236

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 48/78 (61%), Gaps = 4/78 (5%)

Query: 16 KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK 75
          KSKS   L Q  FL LL+ Q++HQDP  PM+  +  AQLA FS +EQ  ++N  ++ L  
Sbjct: 22 KSKSG-ALDQSTFLNLLMAQLQHQDPLNPMEDKDFTAQLAQFSSLEQLNKINEGIEGLNS 80

Query: 76 S---NNLAQASSYIGKNI 90
          S    ++  A S+IGK+I
Sbjct: 81 SAGRQDMLGAVSFIGKDI 98


>gi|332981438|ref|YP_004462879.1| flagellar hook capping protein [Mahella australiensis 50-1 BON]
 gi|332699116|gb|AEE96057.1| flagellar hook capping protein [Mahella australiensis 50-1 BON]
          Length = 143

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 63/113 (55%), Gaps = 16/113 (14%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           KS K L QD FLKLL  Q+++Q+P +PM     +AQ+A FS +EQ   M++ L       
Sbjct: 20  KSAK-LRQDDFLKLLAAQMQNQNPLDPMDDKAFIAQMAQFSSLEQMQNMSANL------- 71

Query: 78  NLAQASSYIGKNI-------TNADGSISGVVNAIQVSSTGLTAITVDNTEIPI 123
           ++AQA + IGK +             ISG V++++ S+ G   +TV   ++P+
Sbjct: 72  SMAQAVAMIGKEVYATIPTERGVQQQISGTVDSVKFSN-GQAILTVGAVDVPL 123


>gi|307699887|ref|ZP_07636938.1| flagellar hook capping protein [Mobiluncus mulieris FB024-16]
 gi|307614925|gb|EFN94143.1| flagellar hook capping protein [Mobiluncus mulieris FB024-16]
          Length = 335

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 63/110 (57%), Gaps = 11/110 (10%)

Query: 12  QEFSKSKSKK----TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN 67
           Q   K+++KK     LG+D F+KLL+  +K+QDPT+PM  ++ + Q +  + MEQ +QM 
Sbjct: 63  QRTDKAQTKKDDPTKLGKDDFMKLLLATLKYQDPTQPMDTAQLLEQTSTMTNMEQMIQMT 122

Query: 68  STLQELLKSNNLAQASSYIGK----NITNADG---SISGVVNAIQVSSTG 110
              +   ++    Q +S +G+    ++ + +G   + +G V+A++  + G
Sbjct: 123 EASKRAYEAQQRVQGASMVGRTAVYDLIDDEGNAKTTAGKVDAVEFLAEG 172


>gi|146278629|ref|YP_001168788.1| flagellar basal body rod modification protein [Rhodobacter
          sphaeroides ATCC 17025]
 gi|145556870|gb|ABP71483.1| flagellar hook capping protein [Rhodobacter sphaeroides ATCC
          17025]
          Length = 218

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 51/91 (56%), Gaps = 3/91 (3%)

Query: 1  MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
          ME+++  +PT      S    T   + FL++L TQ+++QDP  PM++ +   QLA FS +
Sbjct: 1  MEVSSATSPTAGSAPASGRSTTSDYETFLRMLTTQLQNQDPLNPMESDDFAMQLATFSGV 60

Query: 61 EQSVQMNSTLQEL---LKSNNLAQASSYIGK 88
          EQ V+ N  L  +     +  L++ + +IG+
Sbjct: 61 EQQVRTNQILTGMSGSFGAMGLSELAGWIGR 91


>gi|117926845|ref|YP_867462.1| flagellar hook capping protein [Magnetococcus sp. MC-1]
 gi|117610601|gb|ABK46056.1| flagellar hook capping protein [Magnetococcus sp. MC-1]
          Length = 224

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 52/88 (59%), Gaps = 5/88 (5%)

Query: 8   NPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVF---SQMEQSV 64
           +P   +++ + +     Q  FL++L  Q++HQDP EPM+ +E  +QLA F   SQ + S 
Sbjct: 14  DPNASKYTSTSTDAKELQSDFLRMLTAQLEHQDPLEPMENTEFTSQLATFEGLSQQQNST 73

Query: 65  QMNSTLQELLK--SNNLAQASSYIGKNI 90
           Q+   L EL+   ++ + QA +YIG+ +
Sbjct: 74  QLLQQLVELMSGGTDQVGQAVAYIGREV 101


>gi|169831905|ref|YP_001717887.1| flagellar hook capping protein [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169638749|gb|ACA60255.1| flagellar hook capping protein [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 134

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 49/88 (55%), Gaps = 2/88 (2%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASS 84
           QD FLKLL+ Q+K+  P  P    + + Q A F  +E+ V++   L+E+ ++  LAQA+ 
Sbjct: 28  QDTFLKLLVAQLKNPSPFSPPDTDKMMEQAAQFGMLERLVKVEEALREMSRAAYLAQAAE 87

Query: 85  YIGKNIT--NADGSISGVVNAIQVSSTG 110
            +G+ +     D  ISG V  + ++  G
Sbjct: 88  IVGREVVVLAGDRQISGTVERVLLNERG 115


>gi|258592497|emb|CBE68806.1| putative basal-body rod modification protein flgD [NC10 bacterium
           'Dutch sediment']
          Length = 234

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 60/92 (65%), Gaps = 10/92 (10%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           + S   + LG+DAFLKLL+ Q+++Q+P  P++ ++ +AQ A F+ +EQ  Q+N+++ +L 
Sbjct: 21  TSSALDRGLGKDAFLKLLVAQLRNQNPLNPLQGTDFIAQTAQFTSLEQLQQINASIAQLS 80

Query: 75  KSN---------NLAQASSYIGKNITNADGSI 97
            S+         +   ASSYIGK +T A+G+I
Sbjct: 81  ASSAATSGSNSLDAVLASSYIGKVVT-ANGTI 111


>gi|218462420|ref|ZP_03502511.1| flagellar basal body rod modification protein [Rhizobium etli Kim
          5]
          Length = 61

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/42 (61%), Positives = 34/42 (80%)

Query: 17 SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFS 58
          ++ K TL  D FL+LLI Q+K+QDPT+PM ASEQ++QLA FS
Sbjct: 20 AQKKATLNYDNFLQLLIAQMKNQDPTDPMDASEQMSQLASFS 61


>gi|307293788|ref|ZP_07573632.1| flagellar hook capping protein [Sphingobium chlorophenolicum L-1]
 gi|306879939|gb|EFN11156.1| flagellar hook capping protein [Sphingobium chlorophenolicum L-1]
          Length = 218

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (60%), Gaps = 3/74 (4%)

Query: 20 KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKS 76
          K  +GQ  FL+LL  Q++ QDP EP+  ++ VAQ+A  +      +MN TL+ L   L  
Sbjct: 25 KSEMGQADFLRLLTAQMQTQDPFEPVDNAQMVAQMATITNSSGIAEMNQTLKNLASELTG 84

Query: 77 NNLAQASSYIGKNI 90
          + L  A+S+IGK++
Sbjct: 85 SRLGDAASWIGKSM 98


>gi|331017027|gb|EGH97083.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. lachrymans str. M302278PT]
          Length = 229

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNL 79
           LG+DAFL+LL+TQ+K+Q+P +P   ++ VAQLA FS +E    +  T+  +    +S+  
Sbjct: 33  LGKDAFLQLLVTQMKNQNPLDPQDNTQFVAQLAQFSSLESMQNLTKTVDTIASSYQSSQA 92

Query: 80  AQASSYIGKNI 90
            QASS +G+++
Sbjct: 93  LQASSLVGRSV 103


>gi|28869139|ref|NP_791758.1| basal-body rod modification protein FlgD [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213967583|ref|ZP_03395731.1| basal-body rod modification protein FlgD [Pseudomonas syringae pv.
           tomato T1]
 gi|301385712|ref|ZP_07234130.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. tomato Max13]
 gi|302060076|ref|ZP_07251617.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. tomato K40]
 gi|302134835|ref|ZP_07260825.1| flagellar basal body rod modification protein [Pseudomonas syringae
           pv. tomato NCPPB 1108]
 gi|28852379|gb|AAO55453.1| basal-body rod modification protein FlgD [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213927884|gb|EEB61431.1| basal-body rod modification protein FlgD [Pseudomonas syringae pv.
           tomato T1]
          Length = 229

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNL 79
           LG+DAFL+LL+TQ+K+Q+P +P   ++ VAQLA FS +E    +  T+  +    +S+  
Sbjct: 33  LGKDAFLQLLVTQMKNQNPLDPQDNTQFVAQLAQFSSLESMQNLTKTVDTIASSYQSSQA 92

Query: 80  AQASSYIGKNI 90
            QASS +G+++
Sbjct: 93  LQASSLVGRSV 103


>gi|291334311|gb|ADD93972.1| predicted flagellar hook capping protein [uncultured marine
           bacterium MedDCM-OCT-S09-C247]
          Length = 230

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 62/104 (59%), Gaps = 11/104 (10%)

Query: 10  TQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST 69
           T+Q  ++  +K TLGQ  FLKL+ TQ+++QDP  PM   + +AQ+A FS +    ++N++
Sbjct: 20  TRQAGTQKAAKDTLGQSDFLKLMTTQLQNQDPFAPMDNGDFIAQMAQFSTVTGIQEVNNS 79

Query: 70  LQELLKSNN---LAQASSYIGK------NITNAD--GSISGVVN 102
           + +L+   +   +A AS+ +G       NI  AD  G + GV++
Sbjct: 80  IGQLVDEFDQARIATASNLLGHSVLVPGNIGRADEEGQLHGVLD 123


>gi|294013085|ref|YP_003546545.1| flagellar basal-body rod modification protein FlgD [Sphingobium
          japonicum UT26S]
 gi|292676415|dbj|BAI97933.1| flagellar basal-body rod modification protein FlgD [Sphingobium
          japonicum UT26S]
          Length = 218

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 19 SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LK 75
           K  +GQ  FL+LL  Q++ QDP EP+  ++ VAQ+A  +      +MN TL+ L   L 
Sbjct: 24 GKSEMGQADFLRLLTAQMQTQDPFEPVDNAQMVAQMATITNSSGIAEMNQTLKNLASELT 83

Query: 76 SNNLAQASSYIGKNI 90
           + L  A+S+IGK++
Sbjct: 84 GSRLGDAASWIGKSM 98


>gi|256370962|ref|YP_003108786.1| flagellar hook capping protein [Acidimicrobium ferrooxidans DSM
           10331]
 gi|256007546|gb|ACU53113.1| flagellar hook capping protein [Acidimicrobium ferrooxidans DSM
           10331]
          Length = 159

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 61/104 (58%), Gaps = 3/104 (2%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIG 87
           FL LL+T++++Q+P  PM  S+ V+Q +  S++E    + S L ++  S  +  ASS IG
Sbjct: 31  FLNLLVTELQNQNPLSPMDPSQMVSQTSSLSEVELLSTIQSALTQMASSQGILSASSLIG 90

Query: 88  KNITNADGS--ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
           +++T  DGS  ++G V+ +  S+ G+  + V    +PI   I +
Sbjct: 91  QSVTYQDGSGEVAGQVSGVGQSANGVV-LDVGGQSVPIANVIAV 133


>gi|209963570|ref|YP_002296485.1| basal-body rod modification protein FlgD, putative
          [Rhodospirillum centenum SW]
 gi|209957036|gb|ACI97672.1| basal-body rod modification protein FlgD, putative
          [Rhodospirillum centenum SW]
          Length = 219

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (65%), Gaps = 5/73 (6%)

Query: 23 LGQD--AFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L QD  +FLKLL  Q+ +QDP  P+ A++ V QLA FS +EQ+VQ N+ L E+   L+S+
Sbjct: 24 LAQDTQSFLKLLTAQLANQDPMAPIDATQFVTQLAQFSSVEQAVQSNTRLAEVLGELRSS 83

Query: 78 NLAQASSYIGKNI 90
          +     +Y+G+ +
Sbjct: 84 SERLDLAYVGRTV 96


>gi|254436854|ref|ZP_05050348.1| flagellar hook capping protein, putative [Octadecabacter
           antarcticus 307]
 gi|198252300|gb|EDY76614.1| flagellar hook capping protein, putative [Octadecabacter
           antarcticus 307]
          Length = 220

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 55/108 (50%), Gaps = 9/108 (8%)

Query: 1   MEINTEVNPTQQEFSKSK---SKKTLGQD--AFLKLLITQIKHQDPTEPMKASEQVAQLA 55
           MEI+  + P  Q  S  +   SK  +  D   FLK+L  Q+++QDP  P  +SE   QLA
Sbjct: 1   MEISPALTPVTQPSSAPQTETSKTVISSDFETFLKMLTVQMENQDPLNPTDSSEYAQQLA 60

Query: 56  VFSQMEQSVQMNSTLQELLKSNN---LAQASSYIGKNI-TNADGSISG 99
            FS +EQ+V  N  L  L+   N   +AQ + ++GK     A G   G
Sbjct: 61  TFSGVEQAVLTNDLLSALMVQMNTTGMAQMADWVGKEARATAPGHFDG 108


>gi|78776231|ref|YP_392546.1| flagellar hook capping protein [Sulfurimonas denitrificans DSM
          1251]
 gi|78496771|gb|ABB43311.1| Flagellar hook capping protein [Sulfurimonas denitrificans DSM
          1251]
          Length = 221

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 41/64 (64%)

Query: 18 KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
          K K  LG+D F+KLL+ +++HQDPTEPM + + ++Q +  + +E S   N  L EL  S 
Sbjct: 23 KDKTALGKDDFMKLLLVELQHQDPTEPMDSEKILSQTSQLATLEASENTNKALSELAASM 82

Query: 78 NLAQ 81
          + +Q
Sbjct: 83 SASQ 86


>gi|302670725|ref|YP_003830685.1| flagellar hook capping protein FlgD [Butyrivibrio proteoclasticus
          B316]
 gi|302395198|gb|ADL34103.1| flagellar hook capping protein FlgD [Butyrivibrio proteoclasticus
          B316]
          Length = 237

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 49/87 (56%), Gaps = 7/87 (8%)

Query: 4  NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
          N EV  T +E +   +     +D+FLK+L+ Q+K+QDP EP   +E + Q A F+Q+EQ 
Sbjct: 13 NGEVANTVKEDATKNATAGYDKDSFLKILVAQMKYQDPMEPTSNTEYINQYATFTQVEQ- 71

Query: 64 VQMNSTLQELLKSNNLAQASSYIGKNI 90
                L  +  S  L++AS  +GK +
Sbjct: 72 ------LSNMANSMALSRASEMVGKTV 92


>gi|89068735|ref|ZP_01156121.1| flagellar hook assembly protein FlgD [Oceanicola granulosus
           HTCC2516]
 gi|89045698|gb|EAR51760.1| flagellar hook assembly protein FlgD [Oceanicola granulosus
           HTCC2516]
          Length = 222

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 45/75 (60%), Gaps = 5/75 (6%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS----NNLAQAS 83
           FLK+L  Q+ +QDP  PM +S  V QLA  SQ+EQ+VQ N  L+ELL       ++A+  
Sbjct: 31  FLKMLTAQVTNQDPLAPMDSSTFVTQLAQLSQVEQTVQSNGHLRELLAGVQSFGSMAEV- 89

Query: 84  SYIGKNITNADGSIS 98
             IGK +T A   IS
Sbjct: 90  QLIGKPVTYASDRIS 104


>gi|144900454|emb|CAM77318.1| Basal-body rod modification protein FlgD [Magnetospirillum
          gryphiswaldense MSR-1]
          Length = 226

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 41/68 (60%), Gaps = 3/68 (4%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KSNNLAQA 82
          D FL +L  Q+K+QDP  PM ++E   QL  FS +EQ +  N  L+ L+   ++N  AQA
Sbjct: 27 DTFLTMLTVQLKNQDPLSPMDSTEFTNQLVQFSAVEQQIASNKNLENLISVTQTNTKAQA 86

Query: 83 SSYIGKNI 90
           +YIG  I
Sbjct: 87 IAYIGHTI 94


>gi|309779446|ref|ZP_07674207.1| basal-body rod modification protein FlgD [Ralstonia sp.
          5_7_47FAA]
 gi|308921687|gb|EFP67323.1| basal-body rod modification protein FlgD [Ralstonia sp.
          5_7_47FAA]
          Length = 218

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASS 84
          Q+ F++LL+ Q+K+QDP  PM  S+  +QLA  + +    Q+N+T+  +L  N   QASS
Sbjct: 30 QNTFMQLLVAQLKNQDPLNPMDNSQMTSQLAQINTVNGIQQLNTTMSSMLTQNATTQASS 89

Query: 85 YIGKNI 90
           IG+++
Sbjct: 90 MIGRSV 95


>gi|157165774|ref|YP_001466012.1| flagellar basal body rod modification protein [Campylobacter
           concisus 13826]
 gi|112801160|gb|EAT98504.1| flagellar hook assembly protein [Campylobacter concisus 13826]
          Length = 235

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 48/79 (60%), Gaps = 3/79 (3%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNL 79
           L +DAF+KLL+T+++HQDPT PM   + + Q +  + +E     N  ++EL   LKSN  
Sbjct: 39  LDKDAFMKLLLTELQHQDPTSPMDTEKMLTQTSQLASVEMQENTNKAMKELVNQLKSNAN 98

Query: 80  AQASSYIGKNITNADGSIS 98
           A A S +GK ++    +++
Sbjct: 99  AYAISALGKMVSTGSNAVT 117


>gi|147678417|ref|YP_001212632.1| flagellar hook capping protein [Pelotomaculum thermopropionicum SI]
 gi|146274514|dbj|BAF60263.1| flagellar hook capping protein [Pelotomaculum thermopropionicum SI]
          Length = 132

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 50/88 (56%), Gaps = 2/88 (2%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA 80
           K L ++AFL+L + Q+K+QDP  P  ++  + QL+ FS +EQ   +N  +    +   L 
Sbjct: 22  KALDKNAFLQLFVAQLKNQDPLSPQDSNTFITQLSQFSMLEQLASLNEEVTLARRFQELG 81

Query: 81  QASSYIGKNIT--NADGSISGVVNAIQV 106
           +A++ +G+ +     DG +SG V  + V
Sbjct: 82  EAAALLGRQVKVQTGDGDVSGQVEKVAV 109


>gi|296534176|ref|ZP_06896666.1| basal-body rod modification protein FlgD [Roseomonas cervicalis
          ATCC 49957]
 gi|296265496|gb|EFH11631.1| basal-body rod modification protein FlgD [Roseomonas cervicalis
          ATCC 49957]
          Length = 226

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 5/77 (6%)

Query: 19 SKKTLGQD--AFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL-- 74
          +K  LG D  +FL LL TQ+++QDP +P  +SE   QLA FSQ+EQ +  N+ L+ LL  
Sbjct: 22 AKTQLGSDMQSFLTLLTTQLQNQDPMDPTDSSEFATQLAQFSQVEQQIATNAHLESLLSL 81

Query: 75 -KSNNLAQASSYIGKNI 90
           +S +L  ++  +G  +
Sbjct: 82 QQSASLLSSTGLVGNTV 98


>gi|119503643|ref|ZP_01625726.1| Flagellar hook capping protein [marine gamma proteobacterium
           HTCC2080]
 gi|119460705|gb|EAW41797.1| Flagellar hook capping protein [marine gamma proteobacterium
           HTCC2080]
          Length = 239

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 55/89 (61%), Gaps = 4/89 (4%)

Query: 7   VNPTQQ-EFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQ 65
           +NPT+  E  K+ S + +G + FL+L+I Q+++QDPT+PM     ++QLA F+Q+    +
Sbjct: 19  LNPTRAAEKGKAGSAEEMGSEEFLQLMIAQLENQDPTKPMDQMAFMSQLAQFTQVSGIQE 78

Query: 66  MN---STLQELLKSNNLAQASSYIGKNIT 91
           +N   S L E L      QAS  +G++++
Sbjct: 79  LNESFSGLTETLTGQQALQASQMVGRSVS 107


>gi|268316349|ref|YP_003290068.1| flagellar hook capping protein [Rhodothermus marinus DSM 4252]
 gi|262333883|gb|ACY47680.1| flagellar hook capping protein [Rhodothermus marinus DSM 4252]
          Length = 230

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 54/93 (58%), Gaps = 12/93 (12%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           + +   + L ++AFL+LL+TQ+++QDP  P+ + E  AQLA FS +EQ + +N TL    
Sbjct: 22  APAPPSQELDKEAFLRLLVTQLRYQDPINPLDSREFAAQLAQFSTVEQLIGINETLA--- 78

Query: 75  KSNNLAQASSY--IGKNITN--ADGSISGVVNA 103
                AQ+ +Y  + + I N  A G +  V+ A
Sbjct: 79  -----AQSDAYAALAQGIHNSVAAGLVGKVIEA 106


>gi|229918634|ref|YP_002887280.1| flagellar hook capping protein [Exiguobacterium sp. AT1b]
 gi|229470063|gb|ACQ71835.1| flagellar hook capping protein [Exiguobacterium sp. AT1b]
          Length = 142

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 60/125 (48%), Gaps = 12/125 (9%)

Query: 5   TEVNPTQQEF-----SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           T + P   +F     S  K+     +D F+KLL+ QI +QDP  PM+  E +AQ+A FS 
Sbjct: 2   TSIQPKTNDFTLPDQSLPKATNQYDKDMFMKLLLAQIANQDPMSPMEDKEFIAQMAQFSS 61

Query: 60  MEQSVQMNSTLQELLKSNNLAQASSY---IGKNIT----NADGSISGVVNAIQVSSTGLT 112
           +EQ   ++  L  +L   +++  S Y   IGK I      ++ +  G    + +S   LT
Sbjct: 62  LEQMQAISKQLDSVLVDRHMSSISEYSSMIGKTIDFTSETSEETTKGSGRVVSISRNDLT 121

Query: 113 AITVD 117
               D
Sbjct: 122 GYMAD 126


>gi|260429426|ref|ZP_05783403.1| flagellar basal body rod modification protein [Citreicella sp.
          SE45]
 gi|260420049|gb|EEX13302.1| flagellar basal body rod modification protein [Citreicella sp.
          SE45]
          Length = 222

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (56%), Gaps = 5/79 (6%)

Query: 15 SKSKSKKTLGQD--AFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE 72
          + S +K  L  D   FLK+L TQ+++QDP  P+  +E   QLA FS +EQ V  N  L+E
Sbjct: 18 TASTNKTVLSPDFETFLKMLTTQMQNQDPLNPLDTTEYATQLATFSSVEQQVLTNDLLKE 77

Query: 73 L---LKSNNLAQASSYIGK 88
          L   +  N   + + +IGK
Sbjct: 78 LTGVIGGNQFQELAGWIGK 96


>gi|254522227|ref|ZP_05134282.1| flagellar protein [Stenotrophomonas sp. SKA14]
 gi|219719818|gb|EED38343.1| flagellar protein [Stenotrophomonas sp. SKA14]
          Length = 227

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 63/115 (54%), Gaps = 16/115 (13%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST---LQEL 73
           +K K TL Q  FL+L+  Q++HQDP +PM  ++ VAQ+A  S ++    +N T    QE 
Sbjct: 27  TKKKNTLDQADFLRLMTEQLQHQDPLKPMDNTQMVAQMAQMSTVQGITDLNKTVKGFQES 86

Query: 74  LKSNNLAQASSYIG--------KNITNADGSISGVVNAIQVSSTGLTAITVDNTE 120
           + S+ + + ++ +G        K +   +GS+ G V A    S G+  ITVD T+
Sbjct: 87  MASDQVLRGAALVGHQVLVPSEKLMLEKEGSVEGTVAA---PSAGI--ITVDITD 136


>gi|225375326|ref|ZP_03752547.1| hypothetical protein ROSEINA2194_00951 [Roseburia inulinivorans
          DSM 16841]
 gi|225212815|gb|EEG95169.1| hypothetical protein ROSEINA2194_00951 [Roseburia inulinivorans
          DSM 16841]
          Length = 224

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 39/56 (69%), Gaps = 2/56 (3%)

Query: 18 KSKKT--LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          K KKT  LG D FL++L  ++++QDP EP   +E +AQLA FSQ+E  + + ST++
Sbjct: 29 KDKKTNELGYDQFLQILCAEMQYQDPLEPTSNTEYIAQLATFSQLESQLSVQSTIE 84


>gi|332701536|ref|ZP_08421624.1| flagellar hook capping protein [Desulfovibrio africanus str.
          Walvis Bay]
 gi|332551685|gb|EGJ48729.1| flagellar hook capping protein [Desulfovibrio africanus str.
          Walvis Bay]
          Length = 232

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 55/93 (59%), Gaps = 4/93 (4%)

Query: 1  MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
          +++ + +N T  E + ++   +L QD FL++L+ Q++ QDPTEP   ++ V Q+  ++Q+
Sbjct: 3  IDVTSYLNSTMPE-ADTEPSSSLDQDDFLQILVAQLEQQDPTEPTDNAQMVDQMTSYAQL 61

Query: 61 EQSVQMNSTLQEL---LKSNNLAQASSYIGKNI 90
          EQ   +++ +  L   + S    QA+ YIG  +
Sbjct: 62 EQLTNISTAMDTLIAGMASLGATQAAGYIGMGV 94


>gi|190574264|ref|YP_001972109.1| flagellar basal body rod modification protein [Stenotrophomonas
           maltophilia K279a]
 gi|190012186|emb|CAQ45809.1| putative basal-body rod modification protein [Stenotrophomonas
           maltophilia K279a]
          Length = 227

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 68/125 (54%), Gaps = 19/125 (15%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST---LQEL 73
           +K K TL Q  FL+L+  Q++HQDP +PM  ++ VAQ+A  S ++    +N T    QE 
Sbjct: 27  TKKKNTLDQADFLRLMTEQLQHQDPLKPMDNTQMVAQMAQMSTVQGITDLNKTVKGFQES 86

Query: 74  LKSNNLAQASSYIG--------KNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITT 125
           + S+ + + ++ +G        K +   +G++ G V A    S G+  ITVD T+    T
Sbjct: 87  MASDQVLRGAALVGHQVLVPSEKLVLEKEGNVEGTVAA---PSAGI--ITVDITD---AT 138

Query: 126 GIRIS 130
           G +++
Sbjct: 139 GAKVT 143


>gi|294679045|ref|YP_003579660.1| flagellar hook capping protein [Rhodobacter capsulatus SB 1003]
 gi|294477865|gb|ADE87253.1| flagellar hook capping protein [Rhodobacter capsulatus SB 1003]
          Length = 225

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 36/58 (62%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSY 85
          FLKLL TQ+ +QDPT PM +++   QLA FSQ+EQ V+ N+ L  L     +   S Y
Sbjct: 36 FLKLLTTQMTNQDPTSPMDSADYAVQLATFSQVEQQVKTNTLLTSLATQMGVMGMSEY 93


>gi|146307870|ref|YP_001188335.1| flagellar basal body rod modification protein [Pseudomonas
          mendocina ymp]
 gi|145576071|gb|ABP85603.1| flagellar hook capping protein [Pseudomonas mendocina ymp]
          Length = 221

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 49/77 (63%), Gaps = 3/77 (3%)

Query: 17 SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL-- 74
          ++  K LG++ FL LL+ Q+ +Q+P EP    E +AQLA FS +E   ++N +++ +L  
Sbjct: 20 TRQNKDLGKNEFLNLLVAQLNNQNPLEPQGNGEFIAQLAQFSSLEGIEKLNKSMESMLSS 79

Query: 75 -KSNNLAQASSYIGKNI 90
           +S+   QASS +G+ +
Sbjct: 80 YQSSQALQASSLVGRKV 96


>gi|189426346|ref|YP_001953523.1| flagellar hook capping protein [Geobacter lovleyi SZ]
 gi|189422605|gb|ACD97003.1| flagellar hook capping protein [Geobacter lovleyi SZ]
          Length = 223

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 5/76 (6%)

Query: 20 KKTLGQD--AFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL--K 75
          K+T G D  AFLKL I QI++QDP  P   ++ ++Q++  +Q+EQS    + L  LL  +
Sbjct: 22 KQTFGMDTDAFLKLFIAQIQYQDPLAPQDTNDMLSQISQLTQVEQSYNTATALNNLLTAQ 81

Query: 76 SNNLAQAS-SYIGKNI 90
          SN+LA +S   IGK+I
Sbjct: 82 SNSLALSSVGLIGKDI 97


>gi|311694360|gb|ADP97233.1| flagellar hook capping protein [marine bacterium HP15]
          Length = 225

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 60/100 (60%), Gaps = 12/100 (12%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNL 79
           LG++ F++L++ Q+K+Q+P EP +  E ++QLA FS +E+   ++ T++++    +S   
Sbjct: 30  LGRNEFMELMLAQLKNQNPLEPQENGEFISQLAQFSSLEEMQNLSGTVEDVVGQFRSTQA 89

Query: 80  AQASSYIGK--------NITNADGSISGVVNAIQVSSTGL 111
            QAS+ +GK         I  A+G I+G +  +  S+ GL
Sbjct: 90  LQASAMVGKTVLAPSQIGILGAEGEITGTIQ-VPASTGGL 128


>gi|149203159|ref|ZP_01880130.1| Possible FlgD protein [Roseovarius sp. TM1035]
 gi|149143705|gb|EDM31741.1| Possible FlgD protein [Roseovarius sp. TM1035]
          Length = 230

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (64%), Gaps = 3/65 (4%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQA 82
           + FL+LL TQ+++QDP  P+++S+   QLA FS +EQ V  N  L +L   L +  L+Q 
Sbjct: 39  ETFLRLLTTQLRNQDPLNPIESSDFAVQLATFSTVEQQVLTNDLLTDLGARLGAQGLSQV 98

Query: 83  SSYIG 87
           S +IG
Sbjct: 99  SGWIG 103


>gi|325927874|ref|ZP_08189098.1| flagellar hook capping protein [Xanthomonas perforans 91-118]
 gi|325541714|gb|EGD13232.1| flagellar hook capping protein [Xanthomonas perforans 91-118]
          Length = 221

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 55/98 (56%), Gaps = 11/98 (11%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQEL 73
           +K ++ LGQ  FLKL+  Q++HQDP +PM+ S  + QLA FS ++    +N   S   + 
Sbjct: 21  AKKEEALGQADFLKLMTEQLQHQDPLKPMENSAFLGQLAQFSTVQGIGDLNTKVSNFSDS 80

Query: 74  LKSNNLAQASSYIGKNI--------TNADGSISGVVNA 103
           + S+ + + ++ +G N+         +A GS  GVV A
Sbjct: 81  MNSDQVLKGAALVGHNVLVPSAQVAIDATGSAKGVVAA 118


>gi|329898290|ref|ZP_08272373.1| Flagellar basal-body rod modification protein FlgD [gamma
           proteobacterium IMCC3088]
 gi|328920855|gb|EGG28298.1| Flagellar basal-body rod modification protein FlgD [gamma
           proteobacterium IMCC3088]
          Length = 228

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 45/71 (63%), Gaps = 3/71 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNL 79
           L +DAFL+L   Q+K Q+P +PMK    VAQLA FS +E    M ++L+ L   L++++L
Sbjct: 30  LDRDAFLQLFTAQLKSQNPLDPMKNEAFVAQLAQFSSVEGIKGMQASLETLVSNLRTDSL 89

Query: 80  AQASSYIGKNI 90
              SS +GK +
Sbjct: 90  LTGSSLVGKKV 100


>gi|87307399|ref|ZP_01089544.1| probable basal-body rod modification protein FlgD [Blastopirellula
           marina DSM 3645]
 gi|87290139|gb|EAQ82028.1| probable basal-body rod modification protein FlgD [Blastopirellula
           marina DSM 3645]
          Length = 169

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 50/85 (58%), Gaps = 3/85 (3%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSY 85
           D FLKL+I ++++QDP EPMK SE + Q+     +  + Q+++TL  +L   N+  A++ 
Sbjct: 2   DQFLKLMIAELQNQDPMEPMKNSEMLEQIGQIRNITATEQLSTTLTNVLDGQNILSATTL 61

Query: 86  IGKNI---TNADGSISGVVNAIQVS 107
           IG  +   T+    + GVV   Q++
Sbjct: 62  IGGQVQALTDQGDVVFGVVTGAQIT 86


>gi|78047587|ref|YP_363762.1| flagellar basal body rod modification protein [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|78036017|emb|CAJ23708.1| flagellar hook capping protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 221

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 55/98 (56%), Gaps = 11/98 (11%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQEL 73
           +K ++ LGQ  FLKL+  Q++HQDP +PM+ S  + QLA FS ++    +N   S   + 
Sbjct: 21  AKKEEALGQADFLKLMTEQLQHQDPLKPMENSAFLGQLAQFSTVQGIGDLNTKVSNFSDS 80

Query: 74  LKSNNLAQASSYIGKNI--------TNADGSISGVVNA 103
           + S+ + + ++ +G N+         +A GS  GVV A
Sbjct: 81  MNSDQVLKGAALVGHNVLVPSAQVAIDATGSAKGVVAA 118


>gi|167585193|ref|ZP_02377581.1| flagellar basal body rod modification protein [Burkholderia
           ubonensis Bu]
          Length = 250

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+K+QDPT P+ +S+  +QLA  + +    Q+NS+L  L   L +    Q
Sbjct: 43  QSTFLKLLVTQLKNQDPTSPVDSSQMTSQLAQINTVSGIAQLNSSLTSLSTQLTAGQQTQ 102

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 103 AAMLIGTNV 111


>gi|152997583|ref|YP_001342418.1| flagellar hook capping protein [Marinomonas sp. MWYL1]
 gi|150838507|gb|ABR72483.1| flagellar hook capping protein [Marinomonas sp. MWYL1]
          Length = 234

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 54/91 (59%), Gaps = 7/91 (7%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FLKL I Q+K QDPT P   ++ VAQ++ FS +E+   ++  L+ +   L SN    
Sbjct: 43  QNVFLKLYIEQLKGQDPTAPQDTNDMVAQMSQFSSLERLTSISDQLENMATSLTSNQALS 102

Query: 82  ASSYIGKNITNADGS---ISGVVNAIQVSST 109
           AS+ +GK+I   DGS   +   V A+Q+ +T
Sbjct: 103 ASTLVGKSIL-MDGSKVKVGDNVEAVQLKAT 132


>gi|95928664|ref|ZP_01311411.1| flagellar hook capping protein [Desulfuromonas acetoxidans DSM
          684]
 gi|95135454|gb|EAT17106.1| flagellar hook capping protein [Desulfuromonas acetoxidans DSM
          684]
          Length = 220

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 39/60 (65%)

Query: 17 SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
          + S K LG+  FL+LL+ Q+++QDP EP   +E +AQLA FS +EQ    N+ L  ++ +
Sbjct: 19 TASSKALGEADFLELLVAQLENQDPLEPQSNTEFIAQLATFSSLEQQTMTNNKLDSVISA 78


>gi|149911703|ref|ZP_01900311.1| flagellar basal body rod modification protein [Moritella sp. PE36]
 gi|149805233|gb|EDM65250.1| flagellar basal body rod modification protein [Moritella sp. PE36]
          Length = 237

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 3/75 (4%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LK 75
           S+K LGQ+ F  LL  ++  QDP +P++ SE VAQ+A F+  +    M S  ++L   + 
Sbjct: 32  SRKELGQEDFFSLLTQELAFQDPFKPVENSEMVAQMASFTTADGIANMGSKFEQLTTIMS 91

Query: 76  SNNLAQASSYIGKNI 90
           SN   QASS +G  +
Sbjct: 92  SNQALQASSLVGTKV 106


>gi|58582194|ref|YP_201210.1| flagellar basal body rod modification protein [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|84624087|ref|YP_451459.1| flagellar basal body rod modification protein [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|188576755|ref|YP_001913684.1| flagellar basal body rod modification protein [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|188576946|ref|YP_001913875.1| flagellar basal body rod modification protein [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|58426788|gb|AAW75825.1| flagellar protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84368027|dbj|BAE69185.1| flagellar protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188521207|gb|ACD59152.1| flagellar protein [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188521398|gb|ACD59343.1| flagellar protein [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 221

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 55/97 (56%), Gaps = 11/97 (11%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---L 74
           K +++LGQ  FLKL+  Q++HQDP +PM+ S  + QLA FS ++    +N+ +      +
Sbjct: 22  KKEESLGQADFLKLMTEQLQHQDPLKPMENSAFLGQLAQFSTVQGIGDLNTKVSNFSTSM 81

Query: 75  KSNNLAQASSYIGKNI--------TNADGSISGVVNA 103
            S+ + + ++ +G N+         +A GS  GVV A
Sbjct: 82  SSDQVLKGAALVGHNVLVPSAQVAIDATGSAKGVVTA 118


>gi|168334551|ref|ZP_02692707.1| flagellar hook assembly protein [Epulopiscium sp. 'N.t.
          morphotype B']
          Length = 266

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 32/40 (80%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
          LG+DAF+ LLITQ+++QDP  PM  SE +AQ+A F+ +EQ
Sbjct: 30 LGKDAFMSLLITQLQYQDPLSPMDNSEMMAQMAQFTALEQ 69


>gi|322421728|ref|YP_004200951.1| flagellar hook capping protein [Geobacter sp. M18]
 gi|320128115|gb|ADW15675.1| flagellar hook capping protein [Geobacter sp. M18]
          Length = 221

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 47/76 (61%), Gaps = 5/76 (6%)

Query: 20 KKTLG--QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
          KK+ G  +D FLKL +TQ+++QDP  P   ++ ++QLA  +Q+EQ+   N+ LQ LL   
Sbjct: 19 KKSTGMNKDDFLKLFVTQLQNQDPLNPQDGTQFISQLAQLTQVEQAYNTNTNLQNLLGQG 78

Query: 78 NLA---QASSYIGKNI 90
          + A    A S IGK +
Sbjct: 79 SNAGTLAAVSLIGKQV 94


>gi|289208113|ref|YP_003460179.1| flagellar hook capping protein [Thioalkalivibrio sp. K90mix]
 gi|288943744|gb|ADC71443.1| flagellar hook capping protein [Thioalkalivibrio sp. K90mix]
          Length = 223

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 63/118 (53%), Gaps = 18/118 (15%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS---NNL 79
           LGQ  FLKL+ TQ+++QDP EPM+  E + Q+A FS +    +++ + ++L +S   +  
Sbjct: 27  LGQSDFLKLMTTQLQNQDPFEPMENGEFIGQMAQFSTVTGIEELSKSFEKLAQSMGQSQT 86

Query: 80  AQASSYIGKNI--------TNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
            QA+S +GK++           DG + G V   Q  STG   +     E+   TG RI
Sbjct: 87  LQAASLVGKDVLVPTDFSELGTDGMVRGAVELDQ--STGQLQV-----EVYSPTGERI 137


>gi|254475002|ref|ZP_05088388.1| flagellar hook capping protein [Ruegeria sp. R11]
 gi|214029245|gb|EEB70080.1| flagellar hook capping protein [Ruegeria sp. R11]
          Length = 228

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 46/83 (55%), Gaps = 3/83 (3%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQELLKSNNLAQASS 84
           FLK+L  Q ++QDP EP+ ++E  AQLA FS +EQ VQ N   + +Q  L   N+A  S 
Sbjct: 35  FLKMLTAQARYQDPLEPIDSTEYSAQLAQFSMVEQQVQGNDLLTAMQAQLGLANMAAMSG 94

Query: 85  YIGKNITNADGSISGVVNAIQVS 107
           ++G    +   S     N I VS
Sbjct: 95  WVGMETRSTAPSHFDGANPITVS 117


>gi|58038900|ref|YP_190864.1| basal-body rod modification protein FlgD [Gluconobacter oxydans
           621H]
 gi|58001314|gb|AAW60208.1| Basal-body rod modification protein FlgD [Gluconobacter oxydans
           621H]
          Length = 246

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%), Gaps = 3/73 (4%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS---NNLAQASS 84
           FL LL TQ++HQDP+ P       A+LA F+ ++Q V+ N+ L  L+ +   N +A A S
Sbjct: 58  FLTLLTTQLQHQDPSNPTSTDSFTAELAQFAGVQQQVETNTNLTSLISATQDNQMASAVS 117

Query: 85  YIGKNITNADGSI 97
            IGK  T +  S+
Sbjct: 118 LIGKTTTASSSSL 130


>gi|254420677|ref|ZP_05034401.1| flagellar hook capping protein, putative [Brevundimonas sp. BAL3]
 gi|196186854|gb|EDX81830.1| flagellar hook capping protein, putative [Brevundimonas sp. BAL3]
          Length = 238

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 2/68 (2%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL--KSNNLAQASSY 85
          FL LL TQ+K+QDP  P+ ++E  AQL   + +EQ +  N  L  L+  +S NL  A++Y
Sbjct: 28 FLTLLTTQMKNQDPLSPLDSNEFTAQLTQMAGVEQQLLTNDLLTSLVAAQSGNLNNAAAY 87

Query: 86 IGKNITNA 93
          IGK +T A
Sbjct: 88 IGKEVTAA 95


>gi|21242728|ref|NP_642310.1| flagellar basal body rod modification protein [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|294625273|ref|ZP_06703912.1| flagellar protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
 gi|294664590|ref|ZP_06729931.1| flagellar protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
 gi|21108204|gb|AAM36846.1| flagellar protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|292600447|gb|EFF44545.1| flagellar protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
 gi|292605647|gb|EFF48957.1| flagellar protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
          Length = 221

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 54/98 (55%), Gaps = 11/98 (11%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQEL 73
           +K +  LGQ  FLKL+  Q++HQDP +PM+ S  + QLA FS ++    +N   S   + 
Sbjct: 21  AKKEDALGQADFLKLMTEQLQHQDPLKPMENSAFLGQLAQFSTVQGIGDLNTKVSNFSDS 80

Query: 74  LKSNNLAQASSYIGKNI--------TNADGSISGVVNA 103
           + S+ + + ++ +G N+         +A GS  GVV A
Sbjct: 81  MNSDQVLKGAALVGHNVLVPSAQVAIDATGSAKGVVAA 118


>gi|94495412|ref|ZP_01301992.1| flagellar scaffolding protein [Sphingomonas sp. SKA58]
 gi|94424800|gb|EAT09821.1| flagellar scaffolding protein [Sphingomonas sp. SKA58]
          Length = 219

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 22 TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNN 78
          T+ Q +FLKLL  Q+++QDP EP+  +E V+Q+A  +      +MN+ L  +   L    
Sbjct: 28 TMDQASFLKLLTAQMQYQDPFEPVDNAEMVSQMATITNSSGIAEMNANLASIKQELTGTR 87

Query: 79 LAQASSYIGKNI 90
          L  A+S+IGK++
Sbjct: 88 LGDAASWIGKSM 99


>gi|84502383|ref|ZP_01000519.1| related to basal-body rod modification protein (FlgD) [Oceanicola
          batsensis HTCC2597]
 gi|84389195|gb|EAQ01992.1| related to basal-body rod modification protein (FlgD) [Oceanicola
          batsensis HTCC2597]
          Length = 221

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (62%), Gaps = 7/70 (10%)

Query: 27 AFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQAS--- 83
          +FLKLL  Q+ +QDP EPM +S  V+QLA  SQ+EQS+Q N+ L+ +  S  LA A    
Sbjct: 30 SFLKLLTAQLTNQDPLEPMDSSTFVSQLAQLSQVEQSIQTNTHLESI--SGQLANAGLTS 87

Query: 84 --SYIGKNIT 91
              IG+ ++
Sbjct: 88 DLGLIGREVS 97


>gi|292492362|ref|YP_003527801.1| flagellar hook capping protein [Nitrosococcus halophilus Nc4]
 gi|291580957|gb|ADE15414.1| flagellar hook capping protein [Nitrosococcus halophilus Nc4]
          Length = 226

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 50/90 (55%), Gaps = 11/90 (12%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNL 79
           LG + FLKL+ TQ+ HQDP EPM  S  + Q+A F  +     + ++ +EL   ++SN  
Sbjct: 30  LGLEQFLKLMTTQLNHQDPFEPMDNSTFLGQMAQFGTVSGIQDLQNSFKELSGSMQSNQA 89

Query: 80  AQASSYIGKNI--------TNADGSISGVV 101
            QAS  +G+++          A+GS+ G V
Sbjct: 90  LQASGLVGRSVLVPSEFGALEAEGSLRGAV 119


>gi|218288301|ref|ZP_03492600.1| flagellar hook capping protein [Alicyclobacillus acidocaldarius
           LAA1]
 gi|258511378|ref|YP_003184812.1| flagellar hook capping protein [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|218241660|gb|EED08833.1| flagellar hook capping protein [Alicyclobacillus acidocaldarius
           LAA1]
 gi|257478104|gb|ACV58423.1| flagellar hook capping protein [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 159

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 65/114 (57%), Gaps = 11/114 (9%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN-------STLQEL 73
            +L ++ F++LL+TQ+++QDP  P+  ++ +AQLA FS +E+  Q+        S +Q L
Sbjct: 41  NSLNENDFMQLLVTQLQNQDPLNPVDNTQMLAQLAQFSALEEMTQVAQTDAQVLSAVQNL 100

Query: 74  LKSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPIT 124
               +L  A S IG ++T  D S   + G V+++ ++  G   I V+ T  P+T
Sbjct: 101 ESEMSLLMAHSLIGASVTVQDASGNQVQGTVSSVTMNQ-GTPQIVVNGTSYPLT 153


>gi|114777403|ref|ZP_01452400.1| Flagellar hook capping protein [Mariprofundus ferrooxydans PV-1]
 gi|114552185|gb|EAU54687.1| Flagellar hook capping protein [Mariprofundus ferrooxydans PV-1]
          Length = 221

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 49/72 (68%), Gaps = 5/72 (6%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA-- 82
          +D FLKLL+ Q+++Q+P +P   ++  +QLA F+ +EQ    N+ LQ+L+ +++  +A  
Sbjct: 27 KDIFLKLLVAQMQNQNPLKPQDPTQMSSQLAQFNMVEQQTSSNALLQQLVDASSTQKATS 86

Query: 83 ---SSYIGKNIT 91
             +SY+GKN+T
Sbjct: 87 SNGASYLGKNVT 98


>gi|254496886|ref|ZP_05109734.1| flagellar basal body rod modification protein [Legionella
          drancourtii LLAP12]
 gi|254353905|gb|EET12592.1| flagellar basal body rod modification protein [Legionella
          drancourtii LLAP12]
          Length = 224

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 47/73 (64%), Gaps = 3/73 (4%)

Query: 21 KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          K LGQ  FL+L++ QI++QDP +P    E ++QLA FS  +   +M  ++Q++   L+SN
Sbjct: 25 KNLGQQDFLRLMVAQIQNQDPMQPQVNGEFLSQLAQFSTNDGVSKMQESMQQMANSLQSN 84

Query: 78 NLAQASSYIGKNI 90
             QAS+ +G+ +
Sbjct: 85 QALQASALVGRKV 97


>gi|220934393|ref|YP_002513292.1| flagellar hook capping protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995703|gb|ACL72305.1| flagellar hook capping protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 226

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 66/125 (52%), Gaps = 8/125 (6%)

Query: 2   EINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVF---S 58
           +I  ++  T  E + +K    LGQ  FL+L+ITQ+++QDP +PM++ E + QLA F   S
Sbjct: 10  DIMNKLGLTSHETANTKGDDRLGQSDFLRLMITQLENQDPFKPMESGEFLGQLAQFGTVS 69

Query: 59  QMEQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSI-----SGVVNAIQVSSTGLTA 113
            +E   +  +   + + S    QA++ + +++T     I      G+  A+QV ++    
Sbjct: 70  GIEDLQKSFNRFSQSIASGQALQAAALVDRHVTVPGDMIIMDPAEGMRGAVQVPASAEVV 129

Query: 114 ITVDN 118
           I V N
Sbjct: 130 IGVYN 134


>gi|289666046|ref|ZP_06487627.1| flagellar basal body rod modification protein [Xanthomonas
           campestris pv. vasculorum NCPPB702]
 gi|289670505|ref|ZP_06491580.1| flagellar basal body rod modification protein [Xanthomonas
           campestris pv. musacearum NCPPB4381]
          Length = 221

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 52/97 (53%), Gaps = 11/97 (11%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---L 74
           K +  LGQ  FLKL+  Q++HQDP +PM  S  + QLA FS ++    +N+    L   +
Sbjct: 22  KKEDALGQADFLKLMTEQLQHQDPLKPMDNSAFLGQLAQFSTVQGIGDLNTKFSNLSTSM 81

Query: 75  KSNNLAQASSYIGKNI--------TNADGSISGVVNA 103
            S+ + + ++ +G N+         +A GS  GVV A
Sbjct: 82  SSDQVLKGAALVGHNVLVPSAQVAIDATGSAKGVVAA 118


>gi|114799290|ref|YP_758991.1| putative basal-body rod modification protein FlgD [Hyphomonas
          neptunium ATCC 15444]
 gi|114739464|gb|ABI77589.1| putative basal-body rod modification protein FlgD [Hyphomonas
          neptunium ATCC 15444]
          Length = 216

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQELLKSNNLAQA 82
          ++F+KLL  Q+++QDP  PM +++ V QLA FS +EQ V  N   S++  ++   N   A
Sbjct: 28 NSFIKLLTAQVRNQDPMSPMDSTQFVEQLATFSSLEQLVNSNTALSSIASMIGDLNGLMA 87

Query: 83 SSYIGKNITNA 93
          S ++G+++T A
Sbjct: 88 SQWLGEDVTFA 98


>gi|154174409|ref|YP_001407312.1| flagellar basal body rod modification protein [Campylobacter curvus
           525.92]
 gi|112803496|gb|EAU00840.1| flagellar hook assembly protein [Campylobacter curvus 525.92]
          Length = 235

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 55/89 (61%), Gaps = 3/89 (3%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNL 79
           L +DAF+KLL+T++++QDPT PM   + + Q +  + +E     NST+++L   L+SN  
Sbjct: 39  LDKDAFMKLLLTELQYQDPTSPMDTEKMLTQTSQLAALEMQENTNSTMRQLVAQLQSNAN 98

Query: 80  AQASSYIGKNITNADGSISGVVNAIQVSS 108
           A A S +GK ++    +++   +  ++SS
Sbjct: 99  AYAISALGKMVSTGSNAVNITDDTKEISS 127


>gi|288962682|ref|YP_003452976.1| flagellar basal-body rod modification protein [Azospirillum sp.
           B510]
 gi|288914948|dbj|BAI76432.1| flagellar basal-body rod modification protein [Azospirillum sp.
           B510]
          Length = 232

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 48/74 (64%), Gaps = 3/74 (4%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKS 76
           K T+  ++FLKLL  Q+++QDP  PM A++ + QLA  S +EQS++ N TL ++   LKS
Sbjct: 36  KATVDYESFLKLLTAQLRNQDPLAPMDATQFMTQLAQLSTVEQSMRSNDTLGKVLDTLKS 95

Query: 77  NNLAQASSYIGKNI 90
           + +    + +G+ +
Sbjct: 96  SGMRMDMALLGRKV 109


>gi|149202209|ref|ZP_01879182.1| Flagellar scaffolding protein FlgD [Roseovarius sp. TM1035]
 gi|149144307|gb|EDM32338.1| Flagellar scaffolding protein FlgD [Roseovarius sp. TM1035]
          Length = 225

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 59/105 (56%), Gaps = 15/105 (14%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNL 79
           LGQ  FL L+  Q+++QDP  PM+  E +AQ+A FS +    ++N+TL ++   +  N +
Sbjct: 32  LGQQDFLALMTAQLQNQDPFAPMENGEFLAQMAQFSTVAGLDRVNTTLSDIGSQIGGNRI 91

Query: 80  AQASSYIGKNI--------TNADGSISGVVNAIQVSSTGLTAITV 116
           A ASS +G+ +         +A G + GV +  + +S    A+TV
Sbjct: 92  ATASSLLGQQVLVPGSLARPDASGGVHGVADLPEAAS----AVTV 132


>gi|90411004|ref|ZP_01219018.1| flagellar basal body rod modification protein [Photobacterium
           profundum 3TCK]
 gi|90328217|gb|EAS44528.1| flagellar basal body rod modification protein [Photobacterium
           profundum 3TCK]
          Length = 238

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 54/98 (55%), Gaps = 11/98 (11%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQ 71
           SK   +  L QD FL LL  Q+  QDP +P+   + +AQ+A F+ ++   QMN    +L 
Sbjct: 31  SKVTGQNELKQDDFLSLLTKQLAQQDPFKPVGNDQMIAQMASFATVDGINQMNEQFGSLN 90

Query: 72  ELLKSNNLAQASSYIGKN--------ITNADGSISGVV 101
             + S+   QASS +G++        + NA+G I+G+V
Sbjct: 91  SAMTSSQALQASSLVGRDVLIPGATGVKNAEGGITGMV 128


>gi|166712063|ref|ZP_02243270.1| flagellar basal body rod modification protein [Xanthomonas oryzae
           pv. oryzicola BLS256]
          Length = 221

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 55/97 (56%), Gaps = 11/97 (11%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---L 74
           K +++LGQ  FLKL+  Q++HQDP +PM+ S  + QLA FS ++    +N+ +      +
Sbjct: 22  KKEESLGQADFLKLMTEQLQHQDPLKPMENSAFLGQLAQFSTVQGIGDLNTKVSNFSTSM 81

Query: 75  KSNNLAQASSYIGKNI--------TNADGSISGVVNA 103
            S+ + + ++ +G N+         +A GS  GVV A
Sbjct: 82  SSDQVLKGAALVGHNVLVPSAQVAIDATGSAKGVVAA 118


>gi|313901444|ref|ZP_07834902.1| flagellar hook capping protein [Thermaerobacter subterraneus DSM
           13965]
 gi|313468294|gb|EFR63750.1| flagellar hook capping protein [Thermaerobacter subterraneus DSM
           13965]
          Length = 154

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 50/94 (53%), Gaps = 9/94 (9%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           S       L  DAF +LL  Q+++QDP +PM+ +  VAQLA  +Q+E++  + + L  L 
Sbjct: 27  SGPGGPGGLAPDAFFRLLAAQLRYQDPLQPMQDTAFVAQLAQLTQLEETRALRAALSGL- 85

Query: 75  KSNNLAQASSYIGKN--ITNADGSISGVVNAIQV 106
                  A   +G+   IT A G+ +G V  +++
Sbjct: 86  ------SALPLLGRTVEITTAQGTRTGTVTGVRM 113


>gi|283955492|ref|ZP_06372987.1| flagellar hook assembly protein [Campylobacter jejuni subsp. jejuni
           1336]
 gi|283792953|gb|EFC31727.1| flagellar hook assembly protein [Campylobacter jejuni subsp. jejuni
           1336]
          Length = 292

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 40/55 (72%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           TL +DAFLKLL+ +++HQDPT+PM + + + Q +  S +E     N+T+Q+++++
Sbjct: 46  TLDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQLSALEMQQNTNTTMQKMVET 100


>gi|114762150|ref|ZP_01441618.1| Possible FlgD protein [Pelagibaca bermudensis HTCC2601]
 gi|114545174|gb|EAU48177.1| Possible FlgD protein [Roseovarius sp. HTCC2601]
          Length = 224

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (61%), Gaps = 4/73 (5%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQASS 84
           FLK+L TQ+++QDP  P+ +++   QLA FS +EQ V  N  L +L   +    L Q  S
Sbjct: 39  FLKMLTTQMQNQDPLNPVDSTDYATQLATFSSVEQQVLTNDLLGDLAQAMTGGTLQQLGS 98

Query: 85  YIGKNITNADGSI 97
           +IG+++  AD ++
Sbjct: 99  WIGRDVL-ADAAV 110


>gi|120597304|ref|YP_961878.1| flagellar hook capping protein [Shewanella sp. W3-18-1]
 gi|146294551|ref|YP_001184975.1| flagellar hook capping protein [Shewanella putrefaciens CN-32]
 gi|120557397|gb|ABM23324.1| flagellar hook capping protein [Shewanella sp. W3-18-1]
 gi|145566241|gb|ABP77176.1| flagellar hook capping protein [Shewanella putrefaciens CN-32]
          Length = 220

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 49/68 (72%), Gaps = 3/68 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME--QSVQMNSTLQELLKSN-NLAQ 81
          ++ F+ L+I QIK+QDPT+P+ ++E ++QLA FSQ+E  + ++ N + Q ++  N  + Q
Sbjct: 29 KNEFMTLMIAQIKNQDPTKPLNSAEYISQLAQFSQVESLEGMRKNQSNQMIMMENLGIVQ 88

Query: 82 ASSYIGKN 89
          ++S IGKN
Sbjct: 89 SASLIGKN 96


>gi|317121821|ref|YP_004101824.1| flagellar hook capping protein [Thermaerobacter marianensis DSM
           12885]
 gi|315591801|gb|ADU51097.1| flagellar hook capping protein [Thermaerobacter marianensis DSM
           12885]
          Length = 183

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 48/81 (59%), Gaps = 5/81 (6%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSY 85
           DAF +LL  Q+++QDP +P++ +  VAQLA  +Q+E++  + +T+  L     L +A + 
Sbjct: 72  DAFFRLLAAQLRYQDPLQPLQDTAFVAQLAQLTQLEETRALRATVSGLAALPLLGRAVA- 130

Query: 86  IGKNITNADGSISGVVNAIQV 106
               +T ADG   G V  +++
Sbjct: 131 ----VTTADGEQQGTVTGVRL 147


>gi|296531798|ref|ZP_06894614.1| flagellar basal body rod modification protein FlgD [Roseomonas
           cervicalis ATCC 49957]
 gi|296267872|gb|EFH13683.1| flagellar basal body rod modification protein FlgD [Roseomonas
           cervicalis ATCC 49957]
          Length = 231

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 44/69 (63%), Gaps = 4/69 (5%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS----NNLAQ 81
           D FLKLL  Q++ QDP  P   ++ VAQLA FSQ+EQ  + N+ LQ + ++     +LA+
Sbjct: 36  DRFLKLLTAQLRFQDPMSPTDPTQFVAQLAQFSQVEQQTKTNALLQGIAETLSGQASLAE 95

Query: 82  ASSYIGKNI 90
            ++ +GK +
Sbjct: 96  NAALLGKAV 104


>gi|118593644|ref|ZP_01551020.1| flagellar hook capping protein [Stappia aggregata IAM 12614]
 gi|118433755|gb|EAV40416.1| flagellar hook capping protein [Stappia aggregata IAM 12614]
          Length = 219

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 45/72 (62%), Gaps = 4/72 (5%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQASS 84
           FL +L TQI++QDP +P+ ++E   QL  +S +EQ+++ N  L+E+   L SN      S
Sbjct: 30  FLSILTTQIQNQDPLDPLDSAEYTNQLVQYSSVEQAIKQNQNLEEIIASLTSNQSMGYVS 89

Query: 85  YIGKNITNADGS 96
           YIG  +T AD S
Sbjct: 90  YIGNEVT-ADAS 100


>gi|78485813|ref|YP_391738.1| flagellar hook capping protein [Thiomicrospira crunogena XCL-2]
 gi|78364099|gb|ABB42064.1| Flagellar hook capping protein FlgD [Thiomicrospira crunogena
           XCL-2]
          Length = 227

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNL 79
           LGQ  FL+LL TQ+++QDP +PM  +  V  L   SQ+E + +MN ++  +   L++  +
Sbjct: 32  LGQADFLRLLTTQLQNQDPNKPMDPTNFVTDLTQMSQLEATTKMNQSMLAMTTGLQNMQV 91

Query: 80  AQASSYIGKNI 90
            Q++S IGKN+
Sbjct: 92  MQSASLIGKNV 102


>gi|310659038|ref|YP_003936759.1| flagellar hook capping protein [Clostridium sticklandii DSM 519]
 gi|308825816|emb|CBH21854.1| Flagellar hook capping protein [Clostridium sticklandii]
          Length = 128

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 6/72 (8%)

Query: 5  TEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSV 64
          TE N T+Q  S+      LG+DAFL+LL TQ+ HQDP  P    E ++Q+A FS +EQ  
Sbjct: 19 TEKNYTRQVNSE------LGKDAFLRLLTTQLSHQDPLNPTDDKEFLSQMASFSSLEQMQ 72

Query: 65 QMNSTLQELLKS 76
           +N++   L K+
Sbjct: 73 NLNTSFAGLDKT 84


>gi|90415319|ref|ZP_01223253.1| flagellar basal body rod modification protein [marine gamma
           proteobacterium HTCC2207]
 gi|90332642|gb|EAS47812.1| flagellar basal body rod modification protein [marine gamma
           proteobacterium HTCC2207]
          Length = 228

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 52/92 (56%), Gaps = 3/92 (3%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           ++E + +  +  LGQDAFL L   Q+++Q+P +PM     V+QLA FS +E    M  +L
Sbjct: 18  EKENAVAYGEDELGQDAFLTLFTAQLQNQNPLDPMDNEAFVSQLAEFSSLEGIKGMQGSL 77

Query: 71  QEL---LKSNNLAQASSYIGKNITNADGSISG 99
             +   ++ + +   ++ +GK +  A G+ +G
Sbjct: 78  DNMVNGMRQDQMVAGANLVGKKVQVAGGNFTG 109


>gi|83944158|ref|ZP_00956614.1| flagellar hook assembly protein FlgD [Sulfitobacter sp. EE-36]
 gi|83845025|gb|EAP82906.1| flagellar hook assembly protein FlgD [Sulfitobacter sp. EE-36]
          Length = 223

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 39/53 (73%), Gaps = 2/53 (3%)

Query: 23 LGQDA--FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          LG+D   FL LL  QI++QDP EP+ +++ VAQLA  SQ+EQ+VQ N+ L+ L
Sbjct: 26 LGEDYTKFLTLLTAQIQNQDPLEPVDSTQFVAQLAQLSQVEQAVQTNTQLETL 78


>gi|253996320|ref|YP_003048384.1| flagellar hook capping protein [Methylotenera mobilis JLW8]
 gi|253982999|gb|ACT47857.1| flagellar hook capping protein [Methylotenera mobilis JLW8]
          Length = 224

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA---Q 81
           QD F+KLL+TQ+++QDP  PM  ++  +Q+A  S +    ++N+TL+ L+ +  +    Q
Sbjct: 33  QDRFMKLLVTQMRNQDPLNPMDNAQVTSQMAQLSTVTGIDKLNNTLETLINNVQMGQSYQ 92

Query: 82  ASSYIGKNI 90
           AS+ IG+NI
Sbjct: 93  ASNMIGRNI 101


>gi|153952103|ref|YP_001397314.1| flagellar basal body rod modification protein [Campylobacter jejuni
           subsp. doylei 269.97]
 gi|152939549|gb|ABS44290.1| flagellar hook assembly protein [Campylobacter jejuni subsp. doylei
           269.97]
          Length = 287

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 40/55 (72%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           TL +DAFLKLL+ +++HQDPT+PM + + + Q +  S +E     N+T+Q+++++
Sbjct: 46  TLDKDAFLKLLLVELQHQDPTDPMDSDKMLTQTSQLSALEMQQNTNTTMQKMVET 100


>gi|71906390|ref|YP_283977.1| flagellar hook capping protein [Dechloromonas aromatica RCB]
 gi|71846011|gb|AAZ45507.1| Flagellar hook capping protein [Dechloromonas aromatica RCB]
          Length = 229

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 38/58 (65%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
          QD+FL +L TQ+K+QDP  PM  ++  +QLA  S +E    +N+TL  LL S N +QA
Sbjct: 37 QDSFLTMLTTQLKNQDPLNPMDNAQMTSQLAQISTLEGIQGLNTTLTSLLSSYNTSQA 94


>gi|325918876|ref|ZP_08180953.1| flagellar hook capping protein [Xanthomonas vesicatoria ATCC 35937]
 gi|325534913|gb|EGD06832.1| flagellar hook capping protein [Xanthomonas vesicatoria ATCC 35937]
          Length = 223

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 55/105 (52%), Gaps = 11/105 (10%)

Query: 10  TQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST 69
           T    S  K +++LGQ  FLKL+  Q++HQDP +PM+ S  + QLA FS ++    +N+ 
Sbjct: 16  TSSAASTKKKEESLGQADFLKLMTEQLQHQDPLKPMENSAFLGQLAQFSTVQGIGDLNTK 75

Query: 70  LQELLKSNNLAQ---ASSYIGKNI--------TNADGSISGVVNA 103
           +     S N  Q    ++ +G N+         +A GS  GVV A
Sbjct: 76  VGNFSDSMNADQVLKGAALVGHNVLVPSAQLAIDATGSAKGVVAA 120


>gi|83955142|ref|ZP_00963798.1| flagellar hook assembly protein FlgD [Sulfitobacter sp. NAS-14.1]
 gi|83840471|gb|EAP79644.1| flagellar hook assembly protein FlgD [Sulfitobacter sp. NAS-14.1]
          Length = 223

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 39/53 (73%), Gaps = 2/53 (3%)

Query: 23 LGQDA--FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          LG+D   FL LL  QI++QDP EP+ +++ VAQLA  SQ+EQ+VQ N+ L+ L
Sbjct: 26 LGEDYTKFLTLLTAQIQNQDPLEPVDSTQFVAQLAQLSQVEQAVQTNTQLETL 78


>gi|85706208|ref|ZP_01037303.1| Possible FlgD protein [Roseovarius sp. 217]
 gi|85669372|gb|EAQ24238.1| Possible FlgD protein [Roseovarius sp. 217]
          Length = 230

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 60/114 (52%), Gaps = 15/114 (13%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQASS 84
           FLK+L TQ+++QDP  P+++S+   QLA FS +EQ V  N  L +L   + +  L+Q S 
Sbjct: 41  FLKMLTTQLRNQDPLNPIESSDFAVQLATFSTVEQQVLTNDLLTDLGARIGAQGLSQVSG 100

Query: 85  YIG-KNITNADGSISGV-----------VNAIQVSSTGLTAITVDNTEIPITTG 126
           +IG + ++    + SG              A ++ +T    I V+   IP T+G
Sbjct: 101 WIGMEALSELPVTFSGEPVSLLATVDPQAEAAEIVATNAQGIIVNRQPIPTTSG 154


>gi|331005438|ref|ZP_08328817.1| Flagellar basal-body rod modification protein FlgD [gamma
           proteobacterium IMCC1989]
 gi|330420714|gb|EGG95001.1| Flagellar basal-body rod modification protein FlgD [gamma
           proteobacterium IMCC1989]
          Length = 136

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 60/113 (53%), Gaps = 2/113 (1%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           +  + Q+ FL++L+ Q+ +QDP EP+  SE ++Q A  + + Q+   N  L  LL   ++
Sbjct: 17  RAGIDQEDFLQVLLAQLNYQDPLEPVDNSEFISQFAELTTLTQTQSSNDKLDSLLTIQSV 76

Query: 80  AQASSYIGKNI-TNADGSIS-GVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            QA   IGK +  N+ GS + G V  I  SS G   +TV   +     G+ +S
Sbjct: 77  NQAVQLIGKTVEVNSSGSDTIGQVTTITFSSEGTPQMTVLRDDGGFINGVGLS 129


>gi|126176157|ref|YP_001052306.1| flagellar hook capping protein [Shewanella baltica OS155]
 gi|125999362|gb|ABN63437.1| flagellar hook capping protein [Shewanella baltica OS155]
          Length = 220

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 47/65 (72%), Gaps = 3/65 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME--QSVQMNSTLQELLKSN-NLAQASS 84
          F+ L+I QIK+QDPT+P+ ++E ++QLA FSQ+E  + ++ N + Q ++  N  + Q++S
Sbjct: 32 FMTLMIAQIKNQDPTKPLNSAEYISQLAQFSQVESLEGMRKNQSNQMVMMENLGIVQSAS 91

Query: 85 YIGKN 89
           IGKN
Sbjct: 92 LIGKN 96


>gi|304412509|ref|ZP_07394115.1| flagellar hook capping protein [Shewanella baltica OS183]
 gi|307307168|ref|ZP_07586906.1| flagellar hook capping protein [Shewanella baltica BA175]
 gi|304349151|gb|EFM13563.1| flagellar hook capping protein [Shewanella baltica OS183]
 gi|306910407|gb|EFN40838.1| flagellar hook capping protein [Shewanella baltica BA175]
          Length = 220

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 47/65 (72%), Gaps = 3/65 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME--QSVQMNSTLQELLKSN-NLAQASS 84
          F+ L+I QIK+QDPT+P+ ++E ++QLA FSQ+E  + ++ N + Q ++  N  + Q++S
Sbjct: 32 FMTLMIAQIKNQDPTKPLNSAEYISQLAQFSQVESLEGMRKNQSNQMVMMENLGIVQSAS 91

Query: 85 YIGKN 89
           IGKN
Sbjct: 92 LIGKN 96


>gi|302878275|ref|YP_003846839.1| flagellar hook capping protein [Gallionella capsiferriformans ES-2]
 gi|302581064|gb|ADL55075.1| flagellar hook capping protein [Gallionella capsiferriformans ES-2]
          Length = 227

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS---NNLAQ 81
           QD F+KLL+TQ+K+QDP  PM  ++  +Q+A  S +    ++N+TLQ L  S   N   Q
Sbjct: 36  QDRFMKLLVTQLKNQDPLNPMDNAQMTSQMAQISTVSGIDKLNATLQALSASMTPNQTLQ 95

Query: 82  ASSYIGKNI 90
           A++ IG+ +
Sbjct: 96  AATMIGRGV 104


>gi|205373382|ref|ZP_03226186.1| flagellar basal body rod modification protein [Bacillus
          coahuilensis m4-4]
          Length = 94

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 37/48 (77%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
          LGQDAF+K+L+ ++++QDP  PM+  + +AQLA FSQ+E+   M+ +L
Sbjct: 25 LGQDAFMKILMAELQNQDPMNPMQDKDFIAQLATFSQLEELTGMSDSL 72


>gi|159045905|ref|YP_001534699.1| flagellar basal body rod modification protein [Dinoroseobacter
           shibae DFL 12]
 gi|157913665|gb|ABV95098.1| flagellar hook capping protein FlgD [Dinoroseobacter shibae DFL 12]
          Length = 220

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 50/75 (66%), Gaps = 4/75 (5%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQA 82
           + FL++L TQ+++QDP EP+ + +   QLA FS +EQ  Q NS L++L   +   +L+Q 
Sbjct: 29  ETFLRMLTTQLENQDPLEPVASQDLAVQLATFSGVEQQTQTNSLLEDLGSQMGLMSLSQL 88

Query: 83  SSYIGKNITNADGSI 97
           +S++G +   A+G++
Sbjct: 89  ASWVGMDAL-AEGNV 102


>gi|57169038|ref|ZP_00368166.1| probable flagellar hook assembly protein Cj0042 [Campylobacter
          coli RM2228]
 gi|57019583|gb|EAL56273.1| probable flagellar hook assembly protein Cj0042 [Campylobacter
          coli RM2228]
          Length = 287

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 40/55 (72%)

Query: 22 TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
          TL +DAFLKLL+ +++HQDPT+PM + + + Q +  S +E     N+T+Q+++++
Sbjct: 45 TLDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQLSALEMQQNTNTTMQKMVET 99


>gi|218886712|ref|YP_002436033.1| flagellar hook capping protein [Desulfovibrio vulgaris str.
          'Miyazaki F']
 gi|218757666|gb|ACL08565.1| flagellar hook capping protein [Desulfovibrio vulgaris str.
          'Miyazaki F']
          Length = 222

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 45/68 (66%), Gaps = 3/68 (4%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST---LQELLKSNNLAQA 82
          DAFL+LLI ++++QDPT P   +E + Q+A FS +EQ   +N T   + + L + +L  A
Sbjct: 26 DAFLQLLIAELQNQDPTNPTDNTEMINQIASFSTVEQLSALNDTATSIYDSLTAMSLNSA 85

Query: 83 SSYIGKNI 90
           S+IG+++
Sbjct: 86 VSFIGQSV 93


>gi|254470066|ref|ZP_05083470.1| flagellar hook capping protein [Pseudovibrio sp. JE062]
 gi|211960377|gb|EEA95573.1| flagellar hook capping protein [Pseudovibrio sp. JE062]
          Length = 218

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 56/105 (53%), Gaps = 13/105 (12%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE---LLKSNNLAQA 82
           D F+ LL TQI++QDP EP+ +SE   QL  ++ +EQ V     L E    LK+ + +Q 
Sbjct: 27  DLFISLLTTQIQNQDPLEPLDSSEYTNQLVQYTMVEQQVATTEKLDEQLTQLKTQSASQF 86

Query: 83  SSYIGKNITN-------ADGSISGVVNAIQVSSTGLTAITVDNTE 120
            +YIGK +T         D   S  ++A+   S G   +T+ N+E
Sbjct: 87  VNYIGKEVTAQSSTAQLKDDKASWNLDAV---SAGKATVTIKNSE 128


>gi|21231398|ref|NP_637315.1| flagellar basal body rod modification protein [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66768549|ref|YP_243311.1| flagellar basal body rod modification protein [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|188991642|ref|YP_001903652.1| flagellar basal body rod modification protein [Xanthomonas
           campestris pv. campestris str. B100]
 gi|21113064|gb|AAM41239.1| flagellar protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66573881|gb|AAY49291.1| flagellar protein [Xanthomonas campestris pv. campestris str. 8004]
 gi|167733402|emb|CAP51603.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 221

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 54/98 (55%), Gaps = 11/98 (11%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL--- 73
           +K +  LGQ  FLKL+  Q++HQDP +PM+ S  + QLA FS ++    +N+ +      
Sbjct: 21  AKKEDALGQADFLKLMTEQLQHQDPLKPMENSAFLGQLAQFSTVQGIGDLNTKVGNFSDS 80

Query: 74  LKSNNLAQASSYIGKNI--------TNADGSISGVVNA 103
           + S+ + + ++ +G N+         +A GS  GVV A
Sbjct: 81  MNSDQVLKGAALVGHNVLVPSAQVAIDATGSAKGVVAA 118


>gi|305432528|ref|ZP_07401690.1| flagellar hook assembly protein [Campylobacter coli JV20]
 gi|304444567|gb|EFM37218.1| flagellar hook assembly protein [Campylobacter coli JV20]
          Length = 286

 Score = 53.9 bits (128), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 41/58 (70%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           TL +DAFLKLL+ +++HQDPT+PM + + + Q +  S +E     N+T+Q+++++  L
Sbjct: 44  TLDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQLSALEMQQNTNTTMQKMVETMQL 101


>gi|194365681|ref|YP_002028291.1| flagellar basal body rod modification protein [Stenotrophomonas
           maltophilia R551-3]
 gi|194348485|gb|ACF51608.1| flagellar hook capping protein [Stenotrophomonas maltophilia
           R551-3]
          Length = 227

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 63/115 (54%), Gaps = 16/115 (13%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST---LQEL 73
           +K K TL Q  FL+L+  Q++HQDP +PM  ++ VAQ+A  S ++    +N T    QE 
Sbjct: 27  TKKKNTLDQADFLRLMTEQLQHQDPLKPMDNTQMVAQMAQMSTVQGITDLNKTVKGFQES 86

Query: 74  LKSNNLAQASSYIG--------KNITNADGSISGVVNAIQVSSTGLTAITVDNTE 120
           + S+ + + ++ +G        K +   +G++ G V A    + G+  +TVD T+
Sbjct: 87  MASDQVLRGAALVGHEVLVPSEKLVLEKEGTVEGTVAA---PAAGI--VTVDITD 136


>gi|315926888|gb|EFV06254.1| flagellar hook capping family protein [Campylobacter jejuni
          subsp. jejuni DFVF1099]
 gi|315926905|gb|EFV06271.1| flagellar hook capping family protein [Campylobacter jejuni
          subsp. jejuni DFVF1099]
          Length = 294

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 40/55 (72%)

Query: 22 TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
          TL +DAFLKLL+ +++HQDPT+PM + + + Q +  S +E     N+T+Q+++++
Sbjct: 45 TLDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQLSALEMQQNTNTTMQKMVET 99


>gi|157414367|ref|YP_001481623.1| flagellar basal body rod modification protein [Campylobacter
          jejuni subsp. jejuni 81116]
 gi|157385331|gb|ABV51646.1| putative flagellar hook assembly protein [Campylobacter jejuni
          subsp. jejuni 81116]
 gi|307747009|gb|ADN90279.1| Flagellar hook assembly protein [Campylobacter jejuni subsp.
          jejuni M1]
 gi|315931631|gb|EFV10596.1| flagellar hook capping family protein [Campylobacter jejuni
          subsp. jejuni 327]
          Length = 294

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 40/55 (72%)

Query: 22 TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
          TL +DAFLKLL+ +++HQDPT+PM + + + Q +  S +E     N+T+Q+++++
Sbjct: 45 TLDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQLSALEMQQNTNTTMQKMVET 99


>gi|57237056|ref|YP_178068.1| flagellar basal body rod modification protein [Campylobacter
          jejuni RM1221]
 gi|86149626|ref|ZP_01067856.1| flagellar hook assembly protein [Campylobacter jejuni subsp.
          jejuni CF93-6]
 gi|86151430|ref|ZP_01069645.1| flagellar hook assembly protein [Campylobacter jejuni subsp.
          jejuni 260.94]
 gi|86154065|ref|ZP_01072266.1| flagellar hook assembly protein [Campylobacter jejuni subsp.
          jejuni HB93-13]
 gi|88597673|ref|ZP_01100906.1| flagellar hook assembly protein [Campylobacter jejuni subsp.
          jejuni 84-25]
 gi|121613172|ref|YP_999768.1| flagellar basal body rod modification protein [Campylobacter
          jejuni subsp. jejuni 81-176]
 gi|148926856|ref|ZP_01810534.1| putative flagellar hook assembly protein [Campylobacter jejuni
          subsp. jejuni CG8486]
 gi|167004742|ref|ZP_02270500.1| putative flagellar hook assembly protein [Campylobacter jejuni
          subsp. jejuni 81-176]
 gi|205356433|ref|ZP_03223197.1| flagellar hook protein flgE [Campylobacter jejuni subsp. jejuni
          CG8421]
 gi|218561734|ref|YP_002343513.1| flagellar basal body rod modification protein [Campylobacter
          jejuni subsp. jejuni NCTC 11168]
 gi|315123657|ref|YP_004065661.1| putative flagellar hook assembly protein [Campylobacter jejuni
          subsp. jejuni ICDCCJ07001]
 gi|57165860|gb|AAW34639.1| flagellar hook assembly protein [Campylobacter jejuni RM1221]
 gi|85839894|gb|EAQ57153.1| flagellar hook assembly protein [Campylobacter jejuni subsp.
          jejuni CF93-6]
 gi|85841777|gb|EAQ59024.1| flagellar hook assembly protein [Campylobacter jejuni subsp.
          jejuni 260.94]
 gi|85842479|gb|EAQ59693.1| flagellar hook assembly protein [Campylobacter jejuni subsp.
          jejuni HB93-13]
 gi|87248965|gb|EAQ71927.1| flagellar hook assembly protein [Campylobacter jejuni subsp.
          jejuni 81-176]
 gi|88189977|gb|EAQ93953.1| flagellar hook assembly protein [Campylobacter jejuni subsp.
          jejuni 84-25]
 gi|112359440|emb|CAL34222.1| putative flagellar hook assembly protein [Campylobacter jejuni
          subsp. jejuni NCTC 11168]
 gi|145844433|gb|EDK21541.1| putative flagellar hook assembly protein [Campylobacter jejuni
          subsp. jejuni CG8486]
 gi|205345620|gb|EDZ32259.1| flagellar hook protein flgE [Campylobacter jejuni subsp. jejuni
          CG8421]
 gi|315017379|gb|ADT65472.1| putative flagellar hook assembly protein [Campylobacter jejuni
          subsp. jejuni ICDCCJ07001]
 gi|315057483|gb|ADT71812.1| Flagellar basal-body rod modification protein FlgD [Campylobacter
          jejuni subsp. jejuni S3]
 gi|315929147|gb|EFV08372.1| flagellar hook capping family protein [Campylobacter jejuni
          subsp. jejuni 305]
          Length = 294

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 40/55 (72%)

Query: 22 TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
          TL +DAFLKLL+ +++HQDPT+PM + + + Q +  S +E     N+T+Q+++++
Sbjct: 45 TLDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQLSALEMQQNTNTTMQKMVET 99


>gi|171320707|ref|ZP_02909720.1| flagellar hook capping protein [Burkholderia ambifaria MEX-5]
 gi|171094034|gb|EDT39132.1| flagellar hook capping protein [Burkholderia ambifaria MEX-5]
          Length = 135

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 50/80 (62%), Gaps = 2/80 (2%)

Query: 27  AFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYI 86
           + L++++TQ+ +QDP +P+   E V+QLA F+ +EQS Q+ + + +LL   +  Q    +
Sbjct: 25  SLLRIIVTQLTYQDPLKPVDNYEFVSQLAQFTSLEQSRQIAAKIDDLLSVQSATQTIGLL 84

Query: 87  GK--NITNADGSISGVVNAI 104
           G+  +I    G+++G+V  +
Sbjct: 85  GRKVDIRGDAGTMTGIVKGV 104


>gi|256376466|ref|YP_003100126.1| flagellar hook capping protein [Actinosynnema mirum DSM 43827]
 gi|255920769|gb|ACU36280.1| flagellar hook capping protein [Actinosynnema mirum DSM 43827]
          Length = 139

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 63/110 (57%), Gaps = 11/110 (10%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ---ELLKSNN 78
           +LG DAFLKLL+ Q+K+QDP+ P  ++  +AQ A  + ++   ++NS  Q   +L+ S  
Sbjct: 27  SLGGDAFLKLLVAQLKYQDPSNPTDSTAFMAQTAQLTSVD---KLNSIAQQQTQLVASQL 83

Query: 79  LAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITT 125
            AQA+  +G+ +T    S    SG+V++    S     + V   ++P+++
Sbjct: 84  SAQAAGLVGREVTYTTASGERASGIVSSTTFGSA--PTLRVGAVDVPLSS 131


>gi|222095376|ref|YP_002529436.1| flagellar basal body rod modification protein [Bacillus cereus Q1]
 gi|221239434|gb|ACM12144.1| basal-body rod modification protein [Bacillus cereus Q1]
          Length = 192

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 59/120 (49%), Gaps = 6/120 (5%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELL 74
           K+   +G+D FLKL +   +HQDP   M  ++   Q AQL++  Q++   +    LQ  +
Sbjct: 46  KTPGVMGKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQSTM 105

Query: 75  KSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            S  L     ++GK +   DG    ++G V  ++++      + +DN  + +    R+S+
Sbjct: 106 YSTALDGGMKFLGKYVRGVDGDGKKVTGQVETVRLAENNEVQLVIDNKVVSLRFVERVSD 165


>gi|91794996|ref|YP_564647.1| flagellar hook capping protein [Shewanella denitrificans OS217]
 gi|91716998|gb|ABE56924.1| flagellar hook capping protein [Shewanella denitrificans OS217]
          Length = 220

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 51/70 (72%), Gaps = 3/70 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME--QSVQMNSTLQELLKSN-NLAQ 81
          ++ F+ L+I QIK+QDPT+P++++E V+QLA FSQ+E  + ++ N + Q ++  N  + Q
Sbjct: 29 KNEFMTLMIAQIKNQDPTKPIESAEYVSQLAQFSQVESLEYMRKNQSSQMVMMENLGIVQ 88

Query: 82 ASSYIGKNIT 91
          ++S IGK+ T
Sbjct: 89 SASLIGKSAT 98


>gi|324325770|gb|ADY21030.1| flagellar basal body rod modification protein [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 192

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 59/120 (49%), Gaps = 6/120 (5%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELL 74
           K+   +G+D FLKL +   +HQDP   M  ++   Q AQL++  Q++   +    LQ  +
Sbjct: 46  KTPGVMGKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQSTM 105

Query: 75  KSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            S  L     ++GK +   DG    ++G V  ++++      + +DN  + +    R+S+
Sbjct: 106 YSTALDGGMKFLGKYVRGVDGDGKKVTGQVETVRLAENNEVQLVIDNKVVSLRFVERVSD 165


>gi|168182739|ref|ZP_02617403.1| flagellar hook capping protein [Clostridium botulinum Bf]
 gi|237796096|ref|YP_002863648.1| flagellar hook capping protein [Clostridium botulinum Ba4 str. 657]
 gi|182674115|gb|EDT86076.1| flagellar hook capping protein [Clostridium botulinum Bf]
 gi|229261576|gb|ACQ52609.1| flagellar hook capping protein [Clostridium botulinum Ba4 str. 657]
          Length = 265

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 7/71 (9%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           K  + L ++AF K+L  ++ +QDPT     +E V+QLA FS +EQ   +NS ++      
Sbjct: 48  KKGQDLDKNAFFKILAAELANQDPTNAKDGTEYVSQLAQFSSLEQMANLNSMMK------ 101

Query: 78  NLAQASSYIGK 88
            L  ASS+IGK
Sbjct: 102 -LTGASSFIGK 111


>gi|146281770|ref|YP_001171923.1| basal-body rod modification protein FlgD [Pseudomonas stutzeri
           A1501]
 gi|145569975|gb|ABP79081.1| basal-body rod modification protein FlgD [Pseudomonas stutzeri
           A1501]
          Length = 226

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 48/77 (62%), Gaps = 3/77 (3%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KSNNL 79
           LG+  F+ LL+TQ+ +Q+P +P   SE VAQLA FS +E    +N+++  LL   +S+  
Sbjct: 29  LGKTDFMMLLVTQLNNQNPLDPQDNSEFVAQLAQFSSLESMENLNASMTSLLSTYQSSQA 88

Query: 80  AQASSYIGKNITNADGS 96
            QA+S +G ++    GS
Sbjct: 89  LQATSLVGSSVIVETGS 105


>gi|206975041|ref|ZP_03235956.1| flagellar hook assembly protein family protein [Bacillus cereus
           H3081.97]
 gi|229195965|ref|ZP_04322718.1| Flagellar hook assembly protein [Bacillus cereus m1293]
 gi|206747060|gb|EDZ58452.1| flagellar hook assembly protein family protein [Bacillus cereus
           H3081.97]
 gi|228587524|gb|EEK45589.1| Flagellar hook assembly protein [Bacillus cereus m1293]
          Length = 192

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 60/120 (50%), Gaps = 6/120 (5%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELL 74
           K+   +G+D FLKL ++  +HQDP   M  ++   Q AQL++  Q++   +    LQ  +
Sbjct: 46  KTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQSTM 105

Query: 75  KSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            S  L     ++GK +   DG    ++G V  ++++      + +DN  + +    R+S+
Sbjct: 106 YSTALDGGMKFLGKYVRGIDGDGKKVTGQVETVRLAENNDVQLVIDNKVVSLRFVERVSD 165


>gi|144900943|emb|CAM77807.1| basal-body rod modification protein flgD precursor
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 220

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 49/90 (54%), Gaps = 7/90 (7%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASS- 84
           D F++LL  Q+++QDP +P  A+E   QL  +S +EQ +  N  L E+L S +L   SS 
Sbjct: 27  DMFIQLLCAQLENQDPLDPTDATEFTNQLVQYSNLEQQMATNDKLDEVLSSIDLMSMSSG 86

Query: 85  --YIGKNITNADGSIS----GVVNAIQVSS 108
             Y+G  +     +IS    G V+A  V S
Sbjct: 87  VGYMGHTVEAEGDTISVQDDGTVDAAWVYS 116


>gi|313673417|ref|YP_004051528.1| flagellar hook capping protein [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312940173|gb|ADR19365.1| flagellar hook capping protein [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 222

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%), Gaps = 11/86 (12%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN- 78
           KK L +D FL L+ITQ+K+QDP  PM  +E +AQ    S +EQ +     + +L++  N 
Sbjct: 24  KKDLDKDDFLSLMITQLKNQDPLSPMNNNEFIAQTTQMSSLEQLIN----IAKLMEKQNA 79

Query: 79  ------LAQASSYIGKNITNADGSIS 98
                 L   +S+IGKN++    S S
Sbjct: 80  QSTESQLLSGASFIGKNVSYNGNSFS 105


>gi|300696912|ref|YP_003747573.1| flagellar hook assembly protein, basal-body rod modification
          [Ralstonia solanacearum CFBP2957]
 gi|299073636|emb|CBJ53156.1| flagellar hook assembly protein, basal-body rod modification
          [Ralstonia solanacearum CFBP2957]
          Length = 218

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 42/66 (63%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASS 84
          Q+ F++LL+ Q+K+QDP  PM  S+  +QLA  + +    Q+N+TL  +   +  +QASS
Sbjct: 30 QNTFMQLLVAQLKNQDPLNPMDNSQLTSQLAQINTVNGISQLNTTLSSMATQSAASQASS 89

Query: 85 YIGKNI 90
           IG+ +
Sbjct: 90 LIGRTV 95


>gi|207728345|ref|YP_002256739.1| basal-body rod modification protein flgd [Ralstonia solanacearum
          MolK2]
 gi|206591591|emb|CAQ57203.1| basal-body rod modification protein flgd [Ralstonia solanacearum
          MolK2]
          Length = 218

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 42/66 (63%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASS 84
          Q+ F++LL+ Q+K+QDP  PM  S+  +QLA  + +    Q+N+T+  +   +  +QASS
Sbjct: 30 QNTFMQLLVAQLKNQDPLNPMDNSQLTSQLAQINTVNGIAQLNTTMSSMATQSAASQASS 89

Query: 85 YIGKNI 90
           IG+ +
Sbjct: 90 LIGRTV 95


>gi|148380614|ref|YP_001255155.1| flagellar hook capping protein [Clostridium botulinum A str. ATCC
           3502]
 gi|153930937|ref|YP_001384900.1| flagellar hook capping protein [Clostridium botulinum A str. ATCC
           19397]
 gi|153937540|ref|YP_001388369.1| flagellar hook capping protein [Clostridium botulinum A str. Hall]
 gi|170759186|ref|YP_001787977.1| flagellar hook capping protein [Clostridium botulinum A3 str. Loch
           Maree]
 gi|148290098|emb|CAL84217.1| putative flagellar hook assembly protein [Clostridium botulinum A
           str. ATCC 3502]
 gi|152926981|gb|ABS32481.1| flagellar hook capping protein [Clostridium botulinum A str. ATCC
           19397]
 gi|152933454|gb|ABS38953.1| flagellar hook capping protein [Clostridium botulinum A str. Hall]
 gi|169406175|gb|ACA54586.1| flagellar hook capping protein [Clostridium botulinum A3 str. Loch
           Maree]
          Length = 265

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 7/71 (9%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           K  + L ++AF K+L  ++ +QDPT     +E V+QLA FS +EQ   +NS ++      
Sbjct: 48  KKGQDLDKNAFFKILAAELANQDPTNAKDGTEYVSQLAQFSSLEQMANLNSMMK------ 101

Query: 78  NLAQASSYIGK 88
            L  ASS+IGK
Sbjct: 102 -LTGASSFIGK 111


>gi|300693337|ref|YP_003749310.1| flagellar hook assembly protein, basal-body rod modification
          [Ralstonia solanacearum PSI07]
 gi|299075374|emb|CBJ34669.1| flagellar hook assembly protein, basal-body rod modification
          [Ralstonia solanacearum PSI07]
          Length = 218

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 42/66 (63%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASS 84
          Q+ F++LL+ Q+K+QDP  PM  S+  +QLA  + +    Q+N+T+  +   +  +QASS
Sbjct: 30 QNTFMQLLVAQLKNQDPLNPMDNSQLTSQLAQINTVNGIAQLNTTMSSMATQSAASQASS 89

Query: 85 YIGKNI 90
           IG+ +
Sbjct: 90 LIGRTV 95


>gi|253702501|ref|YP_003023690.1| flagellar hook capping protein [Geobacter sp. M21]
 gi|251777351|gb|ACT19932.1| flagellar hook capping protein [Geobacter sp. M21]
          Length = 221

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 48/77 (62%), Gaps = 7/77 (9%)

Query: 20 KKTLG--QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL--- 74
          KK+ G  +D FLKL +TQ+++QDP  P   ++ ++QLA  +Q+EQ+   NS LQ +L   
Sbjct: 19 KKSTGMNKDDFLKLFVTQLQNQDPLNPQDGTQFISQLAQLTQVEQAYNTNSNLQNMLNQG 78

Query: 75 -KSNNLAQASSYIGKNI 90
            S  LA A + IGK +
Sbjct: 79 SNSATLA-AVTLIGKQV 94


>gi|217959236|ref|YP_002337784.1| flagellar basal body rod modification protein [Bacillus cereus
           AH187]
 gi|229138453|ref|ZP_04267042.1| Flagellar hook assembly protein [Bacillus cereus BDRD-ST26]
 gi|217062964|gb|ACJ77214.1| flagellar hook assembly protein family protein [Bacillus cereus
           AH187]
 gi|228644990|gb|EEL01233.1| Flagellar hook assembly protein [Bacillus cereus BDRD-ST26]
          Length = 192

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 61/120 (50%), Gaps = 6/120 (5%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELL 74
           K+   +G+D FLKL ++  +HQDP   M  ++   Q AQL++  Q++   +   +L+  +
Sbjct: 46  KTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDSLRTTM 105

Query: 75  KSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            S  L     ++GK +   DG    ++G V  ++++      + +DN  + +    R+S+
Sbjct: 106 YSTALDGGMKFLGKYVRGVDGDGKKVTGQVETVRLAENNEVQLVIDNKVVSLRFVERVSD 165


>gi|17548565|ref|NP_521905.1| basal-body rod modification protein FlgD [Ralstonia solanacearum
          GMI1000]
 gi|17430813|emb|CAD17495.1| probable basal-body rod modification protein flgd [Ralstonia
          solanacearum GMI1000]
          Length = 221

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 42/66 (63%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASS 84
          Q+ F++LL+ Q+K+QDP  PM  S+  +QLA  + +    Q+N+T+  +   +  +QASS
Sbjct: 33 QNTFMQLLVAQLKNQDPLNPMDNSQLTSQLAQINTVNGIAQLNTTMSSMATQSAASQASS 92

Query: 85 YIGKNI 90
           IG+ +
Sbjct: 93 LIGRTV 98


>gi|327543122|gb|EGF29558.1| flagellar hook capping protein [Rhodopirellula baltica WH47]
          Length = 153

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 57/95 (60%), Gaps = 3/95 (3%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           S ++   +L  D+FLKLLI ++++QDP +P+  ++ V Q+    ++  + Q+ +TL +L 
Sbjct: 28  SANEGYNSLDVDSFLKLLINELQNQDPLDPVDNAQMVQQIGQIREIGATDQLTNTLSDLS 87

Query: 75  KSNNLAQASSYIGKNITN-AD--GSISGVVNAIQV 106
            S  L  AS  IG+ ++  AD   + +GVV+ I V
Sbjct: 88  NSQQLVTASGLIGRTVSGLADDQSNTTGVVDKITV 122


>gi|317152825|ref|YP_004120873.1| flagellar hook capping protein [Desulfovibrio aespoeensis Aspo-2]
 gi|316943076|gb|ADU62127.1| flagellar hook capping protein [Desulfovibrio aespoeensis Aspo-2]
          Length = 225

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 35/56 (62%)

Query: 17 SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE 72
          S +  +LG   FL LLITQ+++QDPTEP+  +E V Q+  FSQ+E    +   L E
Sbjct: 23 STASTSLGSMDFLNLLITQLQYQDPTEPVDNTEMVNQMTQFSQLESLTSIEDKLDE 78


>gi|83747655|ref|ZP_00944691.1| FlgD [Ralstonia solanacearum UW551]
 gi|207739738|ref|YP_002258131.1| basal-body rod modification protein flgd [Ralstonia solanacearum
          IPO1609]
 gi|83725707|gb|EAP72849.1| FlgD [Ralstonia solanacearum UW551]
 gi|206593120|emb|CAQ60026.1| basal-body rod modification protein flgd [Ralstonia solanacearum
          IPO1609]
          Length = 218

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 42/66 (63%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASS 84
          Q+ F++LL+ Q+K+QDP  PM  S+  +QLA  + +    Q+N+T+  +   +  +QASS
Sbjct: 30 QNTFMQLLVAQLKNQDPLNPMDNSQLTSQLAQINTVNGIAQLNTTMSSMATQSAASQASS 89

Query: 85 YIGKNI 90
           IG+ +
Sbjct: 90 LIGRTV 95


>gi|229029433|ref|ZP_04185516.1| Flagellar hook assembly protein [Bacillus cereus AH1271]
 gi|228731892|gb|EEL82791.1| Flagellar hook assembly protein [Bacillus cereus AH1271]
          Length = 192

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 60/120 (50%), Gaps = 6/120 (5%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELL 74
           K+   +G+D FLKL +   +HQDP   M  ++   Q AQL++  Q++   +   +L+  +
Sbjct: 46  KTPGVMGKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDSLKSTM 105

Query: 75  KSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            S  L     ++GK +   DG    ++G V  ++++      + +DN  + +    R+S+
Sbjct: 106 YSTALDGGMKFLGKYVRGVDGDGKKVTGQVETVRLAENNEVQLVIDNKVVSLRFVERVSD 165


>gi|212637784|ref|YP_002314309.1| flagellar hook capping protein [Shewanella piezotolerans WP3]
 gi|212559268|gb|ACJ31722.1| Flagellar hook capping protein [Shewanella piezotolerans WP3]
          Length = 221

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 42/65 (64%), Gaps = 3/65 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQM--NSTLQELLKSN-NLAQASS 84
          F+ L+I QIK+QDPT P+  +E V QLA FSQ+E   QM  N + Q ++  N  + Q++ 
Sbjct: 33 FMTLMIAQIKNQDPTNPIDGTEYVTQLAQFSQVESLEQMRANQSSQMVMMENLGIVQSAH 92

Query: 85 YIGKN 89
           +GKN
Sbjct: 93 LVGKN 97


>gi|117928056|ref|YP_872607.1| flagellar hook capping protein [Acidothermus cellulolyticus 11B]
 gi|117648519|gb|ABK52621.1| flagellar hook capping protein [Acidothermus cellulolyticus 11B]
          Length = 144

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 55/100 (55%), Gaps = 4/100 (4%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIG 87
           FLKLL+ Q+ HQDP  P  +S  +A+ A F+ ++    MN  +  L      + A + IG
Sbjct: 36  FLKLLVAQLSHQDPLNPTDSSTYIAEEAQFAMVQTMNTMNQLMTNLYHDMQTSSAVALIG 95

Query: 88  KNITN--ADGS-ISGVVNAIQVSSTGLTAITVDNTEIPIT 124
           K +T   +DG+ ++GVV A    S G   + + +T +P++
Sbjct: 96  KTVTYTASDGTPVTGVVAAAMPGSNG-PMLRIGSTTVPLS 134


>gi|187478184|ref|YP_786208.1| flagellar basal body rod modification protein [Bordetella avium
          197N]
 gi|115422770|emb|CAJ49298.1| basal-body rod modification protein [Bordetella avium 197N]
          Length = 230

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ--- 81
          QD FLKLL+TQ+K+QDP  PM+ +E  +QLA  S +E    +N TL  +    +++Q   
Sbjct: 27 QDQFLKLLVTQLKNQDPLNPMQNAELTSQLAQISTVEGITNLNKTLLSISGQIDVSQSMN 86

Query: 82 ASSYIGKNI 90
          A++ IGK +
Sbjct: 87 AAALIGKAV 95


>gi|197120192|ref|YP_002140619.1| flagellar hook capping protein FlgD [Geobacter bemidjiensis Bem]
 gi|197089552|gb|ACH40823.1| flagellar hook capping protein FlgD [Geobacter bemidjiensis Bem]
          Length = 221

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 48/77 (62%), Gaps = 7/77 (9%)

Query: 20 KKTLG--QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL--- 74
          KK+ G  +D FLKL +TQ+++QDP  P   ++ ++QLA  +Q+EQ+   NS LQ +L   
Sbjct: 19 KKSTGMNKDDFLKLFVTQLQNQDPLNPQDGTQFISQLAQLTQVEQAYNTNSNLQNMLNQG 78

Query: 75 -KSNNLAQASSYIGKNI 90
            S  LA A + IGK +
Sbjct: 79 SNSATLA-AVTLIGKQV 94


>gi|295687863|ref|YP_003591556.1| flagellar hook capping protein [Caulobacter segnis ATCC 21756]
 gi|295429766|gb|ADG08938.1| flagellar hook capping protein [Caulobacter segnis ATCC 21756]
          Length = 94

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (72%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
          LG   FLKLL+TQ+++Q+P +P   +E  +QLA +SQ+EQ + MN TL
Sbjct: 26 LGTTDFLKLLMTQLENQNPLDPSDPTEFTSQLATYSQLEQQISMNDTL 73


>gi|32477562|ref|NP_870556.1| basal-body rod modification protein FlgD [Rhodopirellula baltica SH
           1]
 gi|32448116|emb|CAD77633.1| probable basal-body rod modification protein FlgD [Rhodopirellula
           baltica SH 1]
          Length = 164

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 57/95 (60%), Gaps = 3/95 (3%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           S ++   +L  D+FLKLLI ++++QDP +P+  ++ V Q+    ++  + Q+ +TL +L 
Sbjct: 39  SANEGYNSLDVDSFLKLLINELQNQDPLDPVDNAQMVQQIGQIREIGATDQLTNTLSDLS 98

Query: 75  KSNNLAQASSYIGKNITN-AD--GSISGVVNAIQV 106
            S  L  AS  IG+ ++  AD   + +GVV+ I V
Sbjct: 99  NSQQLVTASGLIGRTVSGLADDQSNTTGVVDKITV 133


>gi|157959903|ref|YP_001499937.1| flagellar hook capping protein [Shewanella pealeana ATCC 700345]
 gi|157844903|gb|ABV85402.1| flagellar hook capping protein [Shewanella pealeana ATCC 700345]
          Length = 219

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 45/65 (69%), Gaps = 3/65 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME--QSVQMNSTLQELLKSN-NLAQASS 84
          F+ L+I QI++QDPT P+  +E V+QLA FSQ+E  + ++ N ++Q ++  N  + Q++ 
Sbjct: 31 FMTLMIAQIQNQDPTNPIDGTEYVSQLAQFSQVESLEHMRTNQSMQMVMMENLGIVQSAQ 90

Query: 85 YIGKN 89
           +GKN
Sbjct: 91 LVGKN 95


>gi|317133482|ref|YP_004092796.1| flagellar hook capping protein [Ethanoligenens harbinense YUAN-3]
 gi|315471461|gb|ADU28065.1| flagellar hook capping protein [Ethanoligenens harbinense YUAN-3]
          Length = 156

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 61/117 (52%), Gaps = 15/117 (12%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
            G   F  L+  Q+++QDP EP   S+ +AQ+A FS +EQ+       Q+L ++  +   
Sbjct: 28  FGMSDFFTLMTKQLEYQDPLEPTDNSQFMAQMAQFSMVEQT-------QKLAQTAGIQAG 80

Query: 83  SSYIGKNI----TNADGSIS----GVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           ++ +GK++    T+A   +S    GVV A+  S +      ++   +P+T   R+++
Sbjct: 81  TAMVGKDVLYTTTDASTGVSATSEGVVQAVDFSDSSTPQCYINGGWVPLTDVTRVTS 137


>gi|297538895|ref|YP_003674664.1| flagellar hook capping protein [Methylotenera sp. 301]
 gi|297258242|gb|ADI30087.1| flagellar hook capping protein [Methylotenera sp. 301]
          Length = 225

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 48/79 (60%), Gaps = 3/79 (3%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL- 73
           S +KS     QD F+ LLITQ+K+QDP  PM  ++  +Q+A  S +    ++NST++ L 
Sbjct: 24  SSAKSSVDTAQDRFMTLLITQMKNQDPLNPMDNAQVTSQMAQLSTVTGINKLNSTVESLM 83

Query: 74  --LKSNNLAQASSYIGKNI 90
             ++S    QA++ IG N+
Sbjct: 84  SSMQSGQSYQAANMIGHNV 102


>gi|86146156|ref|ZP_01064482.1| flagellar basal body rod modification protein [Vibrio sp. MED222]
 gi|218708803|ref|YP_002416424.1| flagellar basal body rod modification protein [Vibrio splendidus
           LGP32]
 gi|85836103|gb|EAQ54235.1| flagellar basal body rod modification protein [Vibrio sp. MED222]
 gi|218321822|emb|CAV17791.1| Flagellar hook capping protein FlgD [Vibrio splendidus LGP32]
          Length = 236

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LK 75
            K+ L QD FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN+  + L   + 
Sbjct: 33  GKQDLKQDDFLSLLTKQLAQQDPFKPVSNDQMIAQMASFATVDGIGKMNTQFESLNSSMT 92

Query: 76  SNNLAQASSYIGKNI 90
           SN   QASS +G+++
Sbjct: 93  SNQALQASSLVGRDV 107


>gi|299066541|emb|CBJ37731.1| putative Flagellar hook capping protein (flgD) [Ralstonia
          solanacearum CMR15]
          Length = 134

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 42/63 (66%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIG 87
          FLK+L+TQ+ +QDP +PM   + +AQ+A F+ + QS QMNS ++ L+ +    Q+   IG
Sbjct: 25 FLKVLLTQLTYQDPLKPMDNQQFMAQIAQFTALGQSQQMNSNIETLVSNQASLQSVGLIG 84

Query: 88 KNI 90
          + +
Sbjct: 85 RTV 87


>gi|187926955|ref|YP_001893300.1| flagellar hook capping protein [Ralstonia pickettii 12J]
 gi|241665284|ref|YP_002983643.1| flagellar hook capping protein [Ralstonia pickettii 12D]
 gi|187728709|gb|ACD29873.1| flagellar hook capping protein [Ralstonia pickettii 12J]
 gi|240867311|gb|ACS64971.1| flagellar hook capping protein [Ralstonia pickettii 12D]
          Length = 215

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 41/66 (62%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASS 84
          Q+ F++LL+ Q+++QDP  PM  S+  +QLA  + +    Q+N+T+  +   N   QASS
Sbjct: 27 QNTFMQLLVAQLQNQDPLNPMDNSQMTSQLAQINTVNGIQQLNTTMSSMATQNAATQASS 86

Query: 85 YIGKNI 90
           IG+ +
Sbjct: 87 LIGRTV 92


>gi|163939558|ref|YP_001644442.1| flagellar basal body rod modification protein [Bacillus
           weihenstephanensis KBAB4]
 gi|163861755|gb|ABY42814.1| flagellar hook capping protein [Bacillus weihenstephanensis KBAB4]
          Length = 192

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 62/123 (50%), Gaps = 6/123 (4%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQ 71
           S  K+   +G+D FLKL ++  +HQDP   M  ++   Q AQL++  Q++   +   +L+
Sbjct: 43  SAQKTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDSLR 102

Query: 72  ELLKSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
             + S  L     ++GK +   DG    ++G V  ++++      + +DN  + +    R
Sbjct: 103 TTMYSTALDGGMKFLGKYVRGIDGDGKKVTGQVETVRLAENNDVQLVIDNKIVSLRFVER 162

Query: 129 ISN 131
           +S+
Sbjct: 163 VSD 165


>gi|294084419|ref|YP_003551177.1| flagellar hook capping protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663992|gb|ADE39093.1| flagellar hook capping protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 230

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 60/103 (58%), Gaps = 13/103 (12%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ---ELLKSNNL 79
           LGQ+ FL L+ TQ+++QDP  PM+ ++ +AQ+A FS +     MN TL    E L    +
Sbjct: 35  LGQEEFLTLMTTQLQNQDPFAPMENTDMIAQMAQFSTVTGITDMNQTLNGLAETLAEFRI 94

Query: 80  AQASSYIGKNIT--------NADGSISGVVNAIQVSSTGLTAI 114
           A AS+ +G ++         + +G I G+++    S++G+T++
Sbjct: 95  ATASNMLGNSVMIPGNYARPDNNGEIHGMLDL--PSASGVTSL 135


>gi|156973585|ref|YP_001444492.1| flagellar basal body rod modification protein [Vibrio harveyi ATCC
           BAA-1116]
 gi|156525179|gb|ABU70265.1| hypothetical protein VIBHAR_01288 [Vibrio harveyi ATCC BAA-1116]
          Length = 235

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 3/78 (3%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL-- 73
           +S  K+ L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MNS  + L  
Sbjct: 29  ESTGKQDLKQEDFLSLLTKQLSQQDPFKPVGNDQMIAQMASFATVDGIGKMNSQFESLNS 88

Query: 74  -LKSNNLAQASSYIGKNI 90
            + SN   QASS +G+++
Sbjct: 89  SMTSNQALQASSLVGRDV 106


>gi|153834466|ref|ZP_01987133.1| flagellar basal body rod modification protein [Vibrio harveyi HY01]
 gi|269961598|ref|ZP_06175960.1| flagellar basal body rod modification protein [Vibrio harveyi 1DA3]
 gi|148869162|gb|EDL68194.1| flagellar basal body rod modification protein [Vibrio harveyi HY01]
 gi|269833639|gb|EEZ87736.1| flagellar basal body rod modification protein [Vibrio harveyi 1DA3]
          Length = 235

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 3/78 (3%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL-- 73
           +S  K+ L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MNS  + L  
Sbjct: 29  ESTGKQDLKQEDFLSLLTKQLSQQDPFKPVGNDQMIAQMASFATVDGIGKMNSQFESLNS 88

Query: 74  -LKSNNLAQASSYIGKNI 90
            + SN   QASS +G+++
Sbjct: 89  SMTSNQALQASSLVGRDV 106


>gi|306820121|ref|ZP_07453769.1| flagellar hook capping protein [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304551899|gb|EFM39842.1| flagellar hook capping protein [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 158

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (66%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK 75
           +D F+KL + Q+KHQDP EPMK  + + Q+A F+ +EQ   M ++ ++  K
Sbjct: 65  KDTFIKLFVAQMKHQDPMEPMKNEQYMTQMAQFTAVEQMSNMATSFEKFAK 115


>gi|323498421|ref|ZP_08103417.1| flagellar basal body rod modification protein [Vibrio sinaloensis
           DSM 21326]
 gi|323316494|gb|EGA69509.1| flagellar basal body rod modification protein [Vibrio sinaloensis
           DSM 21326]
          Length = 236

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 54/98 (55%), Gaps = 11/98 (11%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LK 75
            K+ L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN+  + L   + 
Sbjct: 33  GKQDLKQEDFLSLLTKQLSQQDPFKPVSNDQMIAQMASFATVDGIGKMNNQFETLNASMT 92

Query: 76  SNNLAQASSYIGKN--------ITNADGSISGVVNAIQ 105
           SN   QASS +G++        +   DGS++ +VN  Q
Sbjct: 93  SNQALQASSLVGRDVLIPGAAGVKKDDGSMAAMVNLPQ 130


>gi|329890334|ref|ZP_08268677.1| flagellar hook capping family protein [Brevundimonas diminuta
          ATCC 11568]
 gi|328845635|gb|EGF95199.1| flagellar hook capping family protein [Brevundimonas diminuta
          ATCC 11568]
          Length = 246

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 3/67 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS---NNLAQASS 84
          FL LL TQ+K+QDP  P+ ++E  AQL   + +EQ +  N  L  LLK+   + L  A+ 
Sbjct: 28 FLSLLTTQLKNQDPLSPVDSNEFTAQLTQMAGVEQQLLTNDLLTGLLKAQQGDGLTGAAQ 87

Query: 85 YIGKNIT 91
          YIGK+ T
Sbjct: 88 YIGKDAT 94


>gi|299068731|emb|CBJ39970.1| flagellar hook assembly protein, basal-body rod modification
          [Ralstonia solanacearum CMR15]
          Length = 218

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 42/66 (63%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASS 84
          Q+ F++LL+ Q+K+QDP  PM  S+  +QLA  + +    Q+N+T+  +   +  +QASS
Sbjct: 30 QNTFMQLLVAQLKNQDPLNPMDNSQLTSQLAQINTVNGISQLNTTMSSMATQSAASQASS 89

Query: 85 YIGKNI 90
           IG+ +
Sbjct: 90 LIGRTV 95


>gi|283955453|ref|ZP_06372951.1| flagellar hook assembly protein [Campylobacter jejuni subsp.
          jejuni 414]
 gi|283793080|gb|EFC31851.1| flagellar hook assembly protein [Campylobacter jejuni subsp.
          jejuni 414]
          Length = 286

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 39/55 (70%)

Query: 22 TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
          TL +DAFLKLL+ +++HQDPT+PM + + + Q +  S +E     N T+Q+++++
Sbjct: 42 TLDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQLSALEMQQNTNITMQKMVET 96


>gi|77918789|ref|YP_356604.1| flagellar hook initiation protein FlgD [Pelobacter carbinolicus
          DSM 2380]
 gi|77544872|gb|ABA88434.1| flagellar hook initiation protein FlgD [Pelobacter carbinolicus
          DSM 2380]
          Length = 218

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
          LG+D FL LL+TQ+++QDP  P   +E  +QLA +S +EQ   +N  LQ+L  +N
Sbjct: 25 LGKDDFLLLLVTQLQNQDPLNPQDPTEFTSQLAQYSSLEQLFTVNDQLQQLETTN 79


>gi|329901229|ref|ZP_08272754.1| Flagellar basal-body rod modification protein FlgD
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327549161|gb|EGF33753.1| Flagellar basal-body rod modification protein FlgD
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 224

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KSNNLAQ 81
           QD F+KLL+TQ+K+QDP  P+  ++  +QLA  S +    +MN+TL+ ++   +S +  Q
Sbjct: 33  QDRFMKLLVTQMKNQDPLNPLDNAQVTSQLAQLSTVSGIDKMNTTLESMIASQQSGSAVQ 92

Query: 82  ASSYIGKNI 90
           A+  IG  +
Sbjct: 93  AAGMIGHGV 101


>gi|163802604|ref|ZP_02196496.1| flagellar basal body rod modification protein D [Vibrio sp. AND4]
 gi|159173687|gb|EDP58506.1| flagellar basal body rod modification protein D [Vibrio sp. AND4]
          Length = 235

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 3/79 (3%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL- 73
            +S  K+ L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MNS  + L 
Sbjct: 28  GESTGKQELKQEDFLSLLTKQLSQQDPFKPVGNDQMIAQMASFATVDGIGKMNSQFENLN 87

Query: 74  --LKSNNLAQASSYIGKNI 90
             + SN   QASS +G+++
Sbjct: 88  SSMTSNQALQASSLVGRDV 106


>gi|325921023|ref|ZP_08182905.1| flagellar hook capping protein [Xanthomonas gardneri ATCC 19865]
 gi|325548505|gb|EGD19477.1| flagellar hook capping protein [Xanthomonas gardneri ATCC 19865]
          Length = 223

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 49/84 (58%), Gaps = 3/84 (3%)

Query: 10 TQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST 69
          T    S  K +++LGQ  FLKL+  Q++HQDP +PM+ S  + QLA FS ++    +N+ 
Sbjct: 16 TSSAASTKKKEESLGQADFLKLMTEQLQHQDPLKPMENSAFLGQLAQFSTVQGIGDLNTK 75

Query: 70 LQEL---LKSNNLAQASSYIGKNI 90
          +      + S+ + + ++ +G N+
Sbjct: 76 VGNFSDSMNSDQVLKGAALVGHNV 99


>gi|323495378|ref|ZP_08100455.1| flagellar basal body rod modification protein [Vibrio brasiliensis
           LMG 20546]
 gi|323310301|gb|EGA63488.1| flagellar basal body rod modification protein [Vibrio brasiliensis
           LMG 20546]
          Length = 237

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 53/94 (56%), Gaps = 11/94 (11%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS---TLQELLK 75
            K+ L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN+   TL   + 
Sbjct: 34  GKQDLKQEDFLSLLTKQLAQQDPFKPVSNDQMIAQMASFATVDGIGKMNNQFETLNASMT 93

Query: 76  SNNLAQASSYIGKN--------ITNADGSISGVV 101
           SN   QASS +G++        + N DGS++ +V
Sbjct: 94  SNQALQASSLVGRDVLVPGAAGVKNDDGSMAAMV 127


>gi|238755325|ref|ZP_04616668.1| Flagellar hook capping protein [Yersinia ruckeri ATCC 29473]
 gi|238706461|gb|EEP98835.1| Flagellar hook capping protein [Yersinia ruckeri ATCC 29473]
          Length = 229

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 54/87 (62%), Gaps = 11/87 (12%)

Query: 15  SKSKSKKTLG--------QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQM 66
           +K ++K+TLG        Q++FL LL+ Q+K+QDPT P++ +E  +QLA  S ++   ++
Sbjct: 14  AKLETKQTLGGAGSSEEMQNSFLTLLVAQLKNQDPTNPLQNNELTSQLAQISTVQGIEKL 73

Query: 67  NSTLQEL---LKSNNLAQASSYIGKNI 90
           N+TL  +   + SN   QAS+ +G  +
Sbjct: 74  NTTLGSISGQIDSNQSLQASALLGHGV 100


>gi|255099421|ref|ZP_05328398.1| putative basal-body rod modification protein [Clostridium difficile
           QCD-63q42]
          Length = 202

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 12/94 (12%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN------ 78
           +D F+K+L+ Q+ +QDP  P   +E V+QLA F+ +E+   MN  L  LL  +N      
Sbjct: 59  KDLFMKILVAQMGNQDPMNPQDPTEYVSQLAQFATLEKMSAMNEKLDVLLALSNSTLINS 118

Query: 79  -LAQASSYIGKNI-----TNADGSISGVVNAIQV 106
            L+ A+S IGK +        D +I GVV +  +
Sbjct: 119 ALSMATSLIGKEVEVSGEEKEDENIVGVVKSTYI 152


>gi|126697825|ref|YP_001086722.1| putative basal-body rod modification protein [Clostridium difficile
           630]
 gi|115249262|emb|CAJ67075.1| Basal-body rod modification protein FlgD [Clostridium difficile]
          Length = 202

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 12/94 (12%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN------ 78
           +D F+K+L+ Q+ +QDP  P   +E V+QLA F+ +E+   MN  L  LL  +N      
Sbjct: 59  KDLFMKILVAQMGNQDPMNPQDPTEYVSQLAQFATLEKMSAMNEKLDVLLALSNSTLINS 118

Query: 79  -LAQASSYIGKNI-----TNADGSISGVVNAIQV 106
            L+ A+S IGK +        D +I GVV +  +
Sbjct: 119 ALSMATSLIGKEVEVSGEEKEDENIVGVVKSTYI 152


>gi|67641537|ref|ZP_00440314.1| basal-body rod modification protein FlgD [Burkholderia mallei GB8
           horse 4]
 gi|121598638|ref|YP_994290.1| flagellar basal body rod modification protein [Burkholderia mallei
           SAVP1]
 gi|124386481|ref|YP_001028061.1| flagellar basal body rod modification protein [Burkholderia mallei
           NCTC 10229]
 gi|126451230|ref|YP_001082868.1| flagellar basal body rod modification protein [Burkholderia mallei
           NCTC 10247]
 gi|161579514|ref|YP_104797.2| flagellar basal body rod modification protein [Burkholderia mallei
           ATCC 23344]
 gi|167001536|ref|ZP_02267331.1| basal-body rod modification protein FlgD [Burkholderia mallei
           PRL-20]
 gi|254175221|ref|ZP_04881882.1| basal-body rod modification protein FlgD [Burkholderia mallei ATCC
           10399]
 gi|254201895|ref|ZP_04908259.1| basal-body rod modification protein FlgD [Burkholderia mallei FMH]
 gi|254207229|ref|ZP_04913580.1| basal-body rod modification protein FlgD [Burkholderia mallei JHU]
 gi|254359731|ref|ZP_04976002.1| basal-body rod modification protein FlgD [Burkholderia mallei
           2002721280]
 gi|121227448|gb|ABM49966.1| basal-body rod modification protein FlgD [Burkholderia mallei
           SAVP1]
 gi|124294501|gb|ABN03770.1| basal-body rod modification protein FlgD [Burkholderia mallei NCTC
           10229]
 gi|126244100|gb|ABO07193.1| basal-body rod modification protein FlgD [Burkholderia mallei NCTC
           10247]
 gi|147747789|gb|EDK54865.1| basal-body rod modification protein FlgD [Burkholderia mallei FMH]
 gi|147752771|gb|EDK59837.1| basal-body rod modification protein FlgD [Burkholderia mallei JHU]
 gi|148028945|gb|EDK86877.1| basal-body rod modification protein FlgD [Burkholderia mallei
           2002721280]
 gi|160696266|gb|EDP86236.1| basal-body rod modification protein FlgD [Burkholderia mallei ATCC
           10399]
 gi|238522488|gb|EEP85932.1| basal-body rod modification protein FlgD [Burkholderia mallei GB8
           horse 4]
 gi|243062737|gb|EES44923.1| basal-body rod modification protein FlgD [Burkholderia mallei
           PRL-20]
          Length = 277

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N+ L  L   L +    Q
Sbjct: 69  QTTFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTALTSLSSQLTAGQQTQ 128

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 129 AAMLIGSNV 137


>gi|161723213|ref|YP_106899.2| flagellar basal body rod modification protein [Burkholderia
           pseudomallei K96243]
          Length = 283

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N+ L  L   L +    Q
Sbjct: 72  QTTFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTALTSLSSQLTAGQQTQ 131

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 132 AAMLIGSNV 140


>gi|167813801|ref|ZP_02445481.1| flagellar basal body rod modification protein [Burkholderia
           pseudomallei 91]
          Length = 283

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N+ L  L   L +    Q
Sbjct: 72  QTTFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTALTSLSSQLTAGQQTQ 131

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 132 AAMLIGSNV 140


>gi|54308096|ref|YP_129116.1| flagellar basal body rod modification protein [Photobacterium
           profundum SS9]
 gi|46912522|emb|CAG19314.1| Putative basal-body rod modification protein FlgD [Photobacterium
           profundum SS9]
          Length = 238

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 53/98 (54%), Gaps = 11/98 (11%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQ 71
           SK   +  L QD FL LL  Q+  QDP +P+   + +AQ+A F+ ++   QMN    +L 
Sbjct: 31  SKVTGQNELKQDDFLSLLTKQLAQQDPFKPVGNDQMIAQMASFATVDGINQMNEQFGSLN 90

Query: 72  ELLKSNNLAQASSYIGKN--------ITNADGSISGVV 101
             + S+   QASS +G++        +  A+G I+G+V
Sbjct: 91  SAMTSSQALQASSLVGRDVLIPGATGVKKAEGGITGMV 128


>gi|126440236|ref|YP_001057321.1| flagellar basal body rod modification protein [Burkholderia
           pseudomallei 668]
 gi|162210025|ref|YP_331877.2| flagellar basal body rod modification protein [Burkholderia
           pseudomallei 1710b]
 gi|167736702|ref|ZP_02409476.1| flagellar basal body rod modification protein [Burkholderia
           pseudomallei 14]
 gi|167822317|ref|ZP_02453788.1| flagellar basal body rod modification protein [Burkholderia
           pseudomallei 9]
 gi|167843907|ref|ZP_02469415.1| flagellar basal body rod modification protein [Burkholderia
           pseudomallei B7210]
 gi|167892409|ref|ZP_02479811.1| flagellar basal body rod modification protein [Burkholderia
           pseudomallei 7894]
 gi|167900907|ref|ZP_02488112.1| flagellar basal body rod modification protein [Burkholderia
           pseudomallei NCTC 13177]
 gi|167909126|ref|ZP_02496217.1| flagellar basal body rod modification protein [Burkholderia
           pseudomallei 112]
 gi|167917163|ref|ZP_02504254.1| flagellar basal body rod modification protein [Burkholderia
           pseudomallei BCC215]
 gi|217425024|ref|ZP_03456520.1| flagellar hook capping protein [Burkholderia pseudomallei 576]
 gi|226199857|ref|ZP_03795408.1| flagellar hook capping protein [Burkholderia pseudomallei Pakistan
           9]
 gi|254188071|ref|ZP_04894583.1| flagellar hook capping protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254196785|ref|ZP_04903209.1| flagellar hook capping protein [Burkholderia pseudomallei S13]
 gi|254259219|ref|ZP_04950273.1| flagellar hook capping protein [Burkholderia pseudomallei 1710a]
 gi|254295813|ref|ZP_04963270.1| flagellar hook capping protein [Burkholderia pseudomallei 406e]
 gi|126219729|gb|ABN83235.1| flagellar hook capping protein [Burkholderia pseudomallei 668]
 gi|157805801|gb|EDO82971.1| flagellar hook capping protein [Burkholderia pseudomallei 406e]
 gi|157935751|gb|EDO91421.1| flagellar hook capping protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|169653528|gb|EDS86221.1| flagellar hook capping protein [Burkholderia pseudomallei S13]
 gi|217392044|gb|EEC32070.1| flagellar hook capping protein [Burkholderia pseudomallei 576]
 gi|225928208|gb|EEH24244.1| flagellar hook capping protein [Burkholderia pseudomallei Pakistan
           9]
 gi|254217908|gb|EET07292.1| flagellar hook capping protein [Burkholderia pseudomallei 1710a]
          Length = 280

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N+ L  L   L +    Q
Sbjct: 69  QTTFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTALTSLSSQLTAGQQTQ 128

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 129 AAMLIGSNV 137


>gi|187778754|ref|ZP_02995227.1| hypothetical protein CLOSPO_02349 [Clostridium sporogenes ATCC
           15579]
 gi|187772379|gb|EDU36181.1| hypothetical protein CLOSPO_02349 [Clostridium sporogenes ATCC
           15579]
          Length = 279

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 7/71 (9%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           K  + L ++AF K+L  ++ +QDPT     +E V+QLA FS +EQ   +NS ++      
Sbjct: 53  KKGQDLDKNAFFKILAAELANQDPTNAKDGTEYVSQLAQFSSLEQMANLNSMMK------ 106

Query: 78  NLAQASSYIGK 88
            L  AS++IGK
Sbjct: 107 -LTGASNFIGK 116


>gi|126734092|ref|ZP_01749839.1| flagellar basal-body rod modification protein, putative
          [Roseobacter sp. CCS2]
 gi|126716958|gb|EBA13822.1| flagellar basal-body rod modification protein, putative
          [Roseobacter sp. CCS2]
          Length = 220

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 50/91 (54%), Gaps = 9/91 (9%)

Query: 9  PTQQEFS----KSKSKKTLGQD--AFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
          PTQQ  S     S +   +G D   FL++L  Q+K+QDP  P+ +++   QLA FS +EQ
Sbjct: 6  PTQQVASTPPAPSAASTQIGSDFEVFLQMLTAQMKYQDPLNPVDSTDYATQLATFSGVEQ 65

Query: 63 SVQMNSTLQEL---LKSNNLAQASSYIGKNI 90
          +V  N  L+ L   + +  L   ++ +GK +
Sbjct: 66 AVLTNDLLKSLTTQMNTGGLVDMAALVGKQV 96


>gi|254251190|ref|ZP_04944508.1| Flagellar hook capping protein [Burkholderia dolosa AUO158]
 gi|124893799|gb|EAY67679.1| Flagellar hook capping protein [Burkholderia dolosa AUO158]
          Length = 245

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N++L  L   L +    Q
Sbjct: 39  QATFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTSLTSLSTQLAAGQQTQ 98

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 99  AALLIGSNV 107


>gi|254460266|ref|ZP_05073682.1| flagellar scaffolding protein FlgD [Rhodobacterales bacterium
           HTCC2083]
 gi|206676855|gb|EDZ41342.1| flagellar scaffolding protein FlgD [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 230

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 49/95 (51%), Gaps = 11/95 (11%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK--- 75
           +K+ LGQD FLKL+  Q+++QDP  PM   + +AQ+A FS +     M  TL  +     
Sbjct: 30  AKEELGQDDFLKLMTAQLQNQDPFAPMDNGDFIAQMAQFSSVAGISDMGKTLNTIADQLG 89

Query: 76  ------SNNLAQASSYIGKNITNAD--GSISGVVN 102
                 S N+   S  +  NI  AD  G + GV++
Sbjct: 90  QFRVGSSVNMLGHSVLLPGNIARADDKGEVHGVLD 124


>gi|170754574|ref|YP_001782273.1| flagellar hook capping protein [Clostridium botulinum B1 str. Okra]
 gi|169119786|gb|ACA43622.1| flagellar hook capping protein [Clostridium botulinum B1 str. Okra]
          Length = 273

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 7/71 (9%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           K  + L ++AF K+L  ++ +QDPT     +E V+QLA FS +EQ   +NS ++      
Sbjct: 56  KKGQDLDKNAFFKILAAELANQDPTNAKDGTEYVSQLAQFSSLEQMANLNSMMK------ 109

Query: 78  NLAQASSYIGK 88
            L  AS++IGK
Sbjct: 110 -LTGASNFIGK 119


>gi|170734375|ref|YP_001766322.1| flagellar basal body rod modification protein [Burkholderia
           cenocepacia MC0-3]
 gi|254246964|ref|ZP_04940285.1| Flagellar hook capping protein [Burkholderia cenocepacia PC184]
 gi|124871740|gb|EAY63456.1| Flagellar hook capping protein [Burkholderia cenocepacia PC184]
 gi|169817617|gb|ACA92200.1| flagellar hook capping protein [Burkholderia cenocepacia MC0-3]
          Length = 248

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N++L  L   L +    Q
Sbjct: 40  QATFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTSLTSLSTQLAAGQQTQ 99

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 100 AALLIGTNV 108


>gi|153941387|ref|YP_001391957.1| flagellar hook capping protein [Clostridium botulinum F str.
           Langeland]
 gi|152937283|gb|ABS42781.1| flagellar hook capping protein [Clostridium botulinum F str.
           Langeland]
 gi|295319976|gb|ADG00354.1| flagellar hook capping protein [Clostridium botulinum F str.
           230613]
          Length = 273

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 7/71 (9%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           K  + L ++AF K+L  ++ +QDPT     +E V+QLA FS +EQ   +NS ++      
Sbjct: 56  KKGQDLDKNAFFKILAAELANQDPTNAKDGTEYVSQLAQFSSLEQMANLNSMMK------ 109

Query: 78  NLAQASSYIGK 88
            L  AS++IGK
Sbjct: 110 -LTGASNFIGK 119


>gi|329849963|ref|ZP_08264809.1| basal-body rod modification protein flgD [Asticcacaulis
          biprosthecum C19]
 gi|328841874|gb|EGF91444.1| basal-body rod modification protein flgD [Asticcacaulis
          biprosthecum C19]
          Length = 218

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 52/90 (57%), Gaps = 7/90 (7%)

Query: 8  NPTQQEFSKSKSKKTLG--QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQ 65
          N T Q  + +K  K+L    + FL LL  QI++QDP  PM ++E   QL  +S +EQ ++
Sbjct: 8  NATTQT-TATKDAKSLAANYETFLSLLTAQIRNQDPLSPMDSTEWTNQLVQYSSVEQQLK 66

Query: 66 MNSTLQELLKS----NNLAQASSYIGKNIT 91
           N  L+++ K+    + +  A +YIGK ++
Sbjct: 67 GNDYLEKISKALDGGDTMNTAVNYIGKTVS 96


>gi|226950069|ref|YP_002805160.1| flagellar hook capping protein [Clostridium botulinum A2 str.
           Kyoto]
 gi|226843577|gb|ACO86243.1| flagellar hook capping protein [Clostridium botulinum A2 str.
           Kyoto]
          Length = 273

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 7/71 (9%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           K  + L ++AF K+L  ++ +QDPT     +E V+QLA FS +EQ   +NS ++      
Sbjct: 56  KKGQDLDKNAFFKILAAELANQDPTNAKDGTEYVSQLAQFSSLEQMANLNSMMK------ 109

Query: 78  NLAQASSYIGK 88
            L  AS++IGK
Sbjct: 110 -LTGASNFIGK 119


>gi|52427987|gb|AAU48580.1| basal-body rod modification protein FlgD [Burkholderia mallei ATCC
           23344]
          Length = 255

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N+ L  L   L +    Q
Sbjct: 47  QTTFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTALTSLSSQLTAGQQTQ 106

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 107 AAMLIGSNV 115


>gi|268680905|ref|YP_003305336.1| flagellar hook capping protein [Sulfurospirillum deleyianum DSM
           6946]
 gi|268618936|gb|ACZ13301.1| flagellar hook capping protein [Sulfurospirillum deleyianum DSM
           6946]
          Length = 229

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 55/93 (59%), Gaps = 14/93 (15%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSY 85
           D FL+LL+T+++HQDPT+PM + + + Q A  S +E S    + L+EL  S+ L+     
Sbjct: 32  DDFLQLLLTELEHQDPTDPMDSDKILTQTAQLSSLEASQNTTAALEEL--SDQLS----- 84

Query: 86  IGKNITNADGSISGVVNAIQVSSTGLTAITVDN 118
                 N + S  GV+   Q++S G +AIT++N
Sbjct: 85  -----ANTNFSAIGVIG--QMASLGSSAITLEN 110


>gi|52208327|emb|CAH34260.1| putative basal-body rod modification protein [Burkholderia
           pseudomallei K96243]
          Length = 261

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N+ L  L   L +    Q
Sbjct: 50  QTTFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTALTSLSSQLTAGQQTQ 109

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 110 AAMLIGSNV 118


>gi|119384362|ref|YP_915418.1| flagellar basal body rod modification protein [Paracoccus
           denitrificans PD1222]
 gi|119374129|gb|ABL69722.1| flagellar hook capping protein [Paracoccus denitrificans PD1222]
          Length = 221

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 4/83 (4%)

Query: 12  QEFSKSKSKKTLGQ-DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSV---QMN 67
           Q FS      +  Q + FLK+L TQIK+QDP  PM +++   QLA FS +EQ V    + 
Sbjct: 18  QSFSAPSESGSADQFEMFLKMLTTQIKNQDPLNPMNSTDFAVQLATFSGVEQQVQTNLLL 77

Query: 68  STLQELLKSNNLAQASSYIGKNI 90
           + L + +    L Q S++IG+ +
Sbjct: 78  TQLLQNINGGELGQFSNWIGREV 100


>gi|42780845|ref|NP_978092.1| flagellar basal body rod modification protein [Bacillus cereus ATCC
           10987]
 gi|42736765|gb|AAS40700.1| flagellar hook assembly protein family protein [Bacillus cereus
           ATCC 10987]
          Length = 192

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 58/120 (48%), Gaps = 6/120 (5%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---L 74
           K+   +G+D FLKL ++  +HQDP   M  ++ + Q A  S MEQ   M   +  L   +
Sbjct: 46  KTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDSLRTTM 105

Query: 75  KSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            S  L     ++GK +   DG    ++G V  ++++      + +DN  + +    R+S+
Sbjct: 106 YSTALDGGMKFLGKYVRGIDGDGKKVTGQVETVRLAENNDVQLVIDNKIVSLRFVERVSD 165


>gi|269103191|ref|ZP_06155888.1| flagellar basal-body rod modification protein FlgD [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268163089|gb|EEZ41585.1| flagellar basal-body rod modification protein FlgD [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 243

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 54/102 (52%), Gaps = 12/102 (11%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN--- 67
           QQE  K+  +  L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN   
Sbjct: 27  QQE-QKTTGQNALKQEDFLSLLTKQLAQQDPFKPVSNDQMIAQMASFATVDGITKMNDQF 85

Query: 68  STLQELLKSNNLAQASSYIGKNI--------TNADGSISGVV 101
             L   L SN   QASS +G ++           DG++SGVV
Sbjct: 86  GVLNTALTSNQALQASSLVGLDVLIPSATAMKTQDGAMSGVV 127


>gi|229058386|ref|ZP_04196770.1| Flagellar hook assembly protein [Bacillus cereus AH603]
 gi|229132565|ref|ZP_04261414.1| Flagellar hook assembly protein [Bacillus cereus BDRD-ST196]
 gi|229166593|ref|ZP_04294345.1| Flagellar hook assembly protein [Bacillus cereus AH621]
 gi|228616847|gb|EEK73920.1| Flagellar hook assembly protein [Bacillus cereus AH621]
 gi|228650911|gb|EEL06897.1| Flagellar hook assembly protein [Bacillus cereus BDRD-ST196]
 gi|228719895|gb|EEL71485.1| Flagellar hook assembly protein [Bacillus cereus AH603]
          Length = 192

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 61/120 (50%), Gaps = 6/120 (5%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELL 74
           K+   +G+D FLKL ++  +HQDP   M  ++   Q AQL++  Q++   +   +L+  +
Sbjct: 46  KTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDSLRTTM 105

Query: 75  KSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            S  L     ++GK +   DG    ++G V  ++++      + +DN  + +    R+S+
Sbjct: 106 YSTALDGGMKFLGKYVRGIDGDGKKVTGQVETVRLAENNDVQLVIDNKIVSLRFVERVSD 165


>gi|126454100|ref|YP_001064563.1| flagellar basal body rod modification protein [Burkholderia
           pseudomallei 1106a]
 gi|134283615|ref|ZP_01770314.1| flagellar hook capping protein [Burkholderia pseudomallei 305]
 gi|167717659|ref|ZP_02400895.1| flagellar basal body rod modification protein [Burkholderia
           pseudomallei DM98]
 gi|242315536|ref|ZP_04814552.1| flagellar hook capping protein [Burkholderia pseudomallei 1106b]
 gi|126227742|gb|ABN91282.1| flagellar hook capping protein [Burkholderia pseudomallei 1106a]
 gi|134245024|gb|EBA45119.1| flagellar hook capping protein [Burkholderia pseudomallei 305]
 gi|242138775|gb|EES25177.1| flagellar hook capping protein [Burkholderia pseudomallei 1106b]
          Length = 280

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N+ L  L   L +    Q
Sbjct: 69  QTTFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTALTSLSSQLTAGQQTQ 128

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 129 AAMLIGSNV 137


>gi|254182141|ref|ZP_04888738.1| flagellar hook capping protein [Burkholderia pseudomallei 1655]
 gi|184212679|gb|EDU09722.1| flagellar hook capping protein [Burkholderia pseudomallei 1655]
          Length = 280

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N+ L  L   L +    Q
Sbjct: 69  QTTFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTALTSLSSQLTAGQQTQ 128

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 129 AAMLIGSNV 137


>gi|284925345|gb|ADC27697.1| flagellar basal body rod modification protein [Campylobacter
          jejuni subsp. jejuni IA3902]
          Length = 294

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 39/54 (72%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
          L +DAFLKLL+ +++HQDPT+PM + + + Q +  S +E     N+T+Q+++++
Sbjct: 46 LDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQLSALEMQQNTNTTMQKMVET 99


>gi|237810460|ref|YP_002894911.1| flagellar basal body rod modification protein [Burkholderia
           pseudomallei MSHR346]
 gi|237503425|gb|ACQ95743.1| flagellar basal body rod modification protein [Burkholderia
           pseudomallei MSHR346]
          Length = 280

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N+ L  L   L +    Q
Sbjct: 69  QTTFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTALTSLSSQLTAGQQTQ 128

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 129 AAMLIGSNV 137


>gi|242238968|ref|YP_002987149.1| flagellar hook capping protein [Dickeya dadantii Ech703]
 gi|242131025|gb|ACS85327.1| flagellar hook capping protein [Dickeya dadantii Ech703]
          Length = 225

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
          Q+ F+ LL+ Q+++QDPT+PM  S+   QLA  S +    ++N+TL  +   L +N + Q
Sbjct: 31 QNEFMTLLVAQLQNQDPTDPMDNSQLTTQLAQISMLSGIEEINTTLGSITSQLDTNEMLQ 90

Query: 82 ASSYIGKNI 90
          AS+ IG  +
Sbjct: 91 ASTLIGNGV 99


>gi|167579487|ref|ZP_02372361.1| flagellar basal body rod modification protein [Burkholderia
           thailandensis TXDOH]
          Length = 289

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N+ L  L   L +    Q
Sbjct: 78  QTTFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTALTSLSSQLTAGQQTQ 137

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 138 AAMLIGSNV 146


>gi|322806986|emb|CBZ04556.1| flagellar basal-body rod modification protein FlgD [Clostridium
           botulinum H04402 065]
          Length = 270

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 7/71 (9%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           K  + L ++AF K+L  ++ +QDPT     +E V+QLA FS +EQ   +NS ++      
Sbjct: 53  KKGQDLDKNAFFKILAAELANQDPTNAKDGTEYVSQLAQFSSLEQMANLNSMMK------ 106

Query: 78  NLAQASSYIGK 88
            L  AS++IGK
Sbjct: 107 -LTGASNFIGK 116


>gi|251772437|gb|EES53004.1| flagellar hook capping protein [Leptospirillum ferrodiazotrophum]
          Length = 278

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 44/74 (59%), Gaps = 3/74 (4%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KS 76
           KK LG + ++ ++I Q+++QDP  PM   +  +QLA FSQ++Q V MN  ++ +    + 
Sbjct: 31  KKKLGMEDYMNIMIRQLQYQDPFHPMDNRKFASQLAQFSQLDQLVHMNKKMEGMANQGRE 90

Query: 77  NNLAQASSYIGKNI 90
            +  Q   ++G+ +
Sbjct: 91  TDALQMVGFLGREV 104


>gi|161526187|ref|YP_001581199.1| flagellar basal body rod modification protein [Burkholderia
           multivorans ATCC 17616]
 gi|189349097|ref|YP_001944725.1| flagellar basal body rod modification protein [Burkholderia
           multivorans ATCC 17616]
 gi|160343616|gb|ABX16702.1| flagellar hook capping protein [Burkholderia multivorans ATCC
           17616]
 gi|189333119|dbj|BAG42189.1| flagellar basal-body rod modification protein [Burkholderia
           multivorans ATCC 17616]
          Length = 247

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N++L  L   L +    Q
Sbjct: 39  QATFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTSLTSLSTQLAAGQQTQ 98

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 99  AALLIGSNV 107


>gi|323527714|ref|YP_004229867.1| flagellar hook capping protein [Burkholderia sp. CCGE1001]
 gi|323384716|gb|ADX56807.1| flagellar hook capping protein [Burkholderia sp. CCGE1001]
          Length = 243

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FL LL+ Q+K+QDPT PM +S+  +QLA  + +    Q+N+TL  L   + +   +Q
Sbjct: 50  QNTFLSLLVAQLKNQDPTNPMDSSQMTSQLAQINTVSGISQLNTTLSSLATQMSAGQQSQ 109

Query: 82  ASSYIGKNITNADGSIS 98
           A+  IG  +     SIS
Sbjct: 110 AALLIGSTVLAPGSSIS 126


>gi|251789167|ref|YP_003003888.1| flagellar basal body rod modification protein [Dickeya zeae
          Ech1591]
 gi|247537788|gb|ACT06409.1| flagellar hook capping protein [Dickeya zeae Ech1591]
          Length = 223

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
          Q++FL LL+ Q+K+QDPT PM  ++ V+QLA  + +    ++N+TL  +   + SN   Q
Sbjct: 31 QNSFLTLLVAQLKNQDPTNPMDNNQLVSQLAQLNTVSGIEKLNTTLGSISTQINSNQSVQ 90

Query: 82 ASSYIGKNI 90
          A+S IG  +
Sbjct: 91 AASLIGHGV 99


>gi|221199738|ref|ZP_03572781.1| basal-body rod modification protein FlgD [Burkholderia multivorans
           CGD2M]
 gi|221208657|ref|ZP_03581657.1| basal-body rod modification protein FlgD [Burkholderia multivorans
           CGD2]
 gi|221215570|ref|ZP_03588533.1| basal-body rod modification protein FlgD [Burkholderia multivorans
           CGD1]
 gi|221164558|gb|EED97041.1| basal-body rod modification protein FlgD [Burkholderia multivorans
           CGD1]
 gi|221171468|gb|EEE03915.1| basal-body rod modification protein FlgD [Burkholderia multivorans
           CGD2]
 gi|221179977|gb|EEE12381.1| basal-body rod modification protein FlgD [Burkholderia multivorans
           CGD2M]
          Length = 247

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N++L  L   L +    Q
Sbjct: 39  QATFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTSLTSLSTQLAAGQQTQ 98

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 99  AALLIGSNV 107


>gi|107023954|ref|YP_622281.1| flagellar basal body rod modification protein [Burkholderia
           cenocepacia AU 1054]
 gi|116691041|ref|YP_836664.1| flagellar basal body rod modification protein [Burkholderia
           cenocepacia HI2424]
 gi|105894143|gb|ABF77308.1| flagellar hook capping protein [Burkholderia cenocepacia AU 1054]
 gi|116649130|gb|ABK09771.1| flagellar hook capping protein [Burkholderia cenocepacia HI2424]
          Length = 248

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N++L  L   L +    Q
Sbjct: 40  QATFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTSLTSLSTQLAAGQQTQ 99

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 100 AALLIGTNV 108


>gi|34558067|ref|NP_907882.1| flagellar basal body rod modification protein [Wolinella
          succinogenes DSM 1740]
 gi|34483785|emb|CAE10782.1| FLAGELLAR BIOSYNTHESIS PROTEIN [Wolinella succinogenes]
          Length = 270

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 34/49 (69%)

Query: 22 TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
          TL +DAF++L + Q+K QDPT PM+  + + Q A+ +Q+EQ  +M  TL
Sbjct: 26 TLDKDAFMRLFLEQLKSQDPTSPMETEKILEQTAMLTQLEQQEEMKKTL 74


>gi|168180919|ref|ZP_02615583.1| flagellar hook capping protein [Clostridium botulinum NCTC 2916]
 gi|182668206|gb|EDT80185.1| flagellar hook capping protein [Clostridium botulinum NCTC 2916]
          Length = 270

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 7/71 (9%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           K  + L ++AF K+L  ++ +QDPT     +E V+QLA FS +EQ   +NS ++      
Sbjct: 53  KKGQDLDKNAFFKILAAELANQDPTNAKDGTEYVSQLAQFSSLEQMANLNSMMK------ 106

Query: 78  NLAQASSYIGK 88
            L  AS++IGK
Sbjct: 107 -LTGASNFIGK 116


>gi|77165839|ref|YP_344364.1| flagellar hook capping protein [Nitrosococcus oceani ATCC 19707]
 gi|254433359|ref|ZP_05046867.1| flagellar hook capping protein, putative [Nitrosococcus oceani
           AFC27]
 gi|76884153|gb|ABA58834.1| Flagellar hook capping protein [Nitrosococcus oceani ATCC 19707]
 gi|207089692|gb|EDZ66963.1| flagellar hook capping protein, putative [Nitrosococcus oceani
           AFC27]
          Length = 226

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 50/90 (55%), Gaps = 11/90 (12%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNL 79
           LG + FLKL+  Q+ +QDP EPM  S  ++Q+A F  ++    + ++ QE+   L+SN  
Sbjct: 30  LGLEQFLKLMTAQLSNQDPFEPMDNSTFLSQVAQFGTVKGIQDLQASFQEVSGSLQSNQA 89

Query: 80  AQASSYIGKNI--------TNADGSISGVV 101
            QAS  +G+++          A GSI G V
Sbjct: 90  LQASGLVGRSVLVPSAESSLEAGGSIRGAV 119


>gi|209521588|ref|ZP_03270286.1| flagellar hook capping protein [Burkholderia sp. H160]
 gi|209497971|gb|EDZ98128.1| flagellar hook capping protein [Burkholderia sp. H160]
          Length = 237

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 48/77 (62%), Gaps = 3/77 (3%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FL+LL+ Q+K+QDPT PM +S+  +QLA  S ++    +N++L  L   L +   +Q
Sbjct: 44  QNTFLQLLVAQMKNQDPTNPMDSSQMTSQLAQISTVQGISNLNTSLSSLSTQLTAGQQSQ 103

Query: 82  ASSYIGKNITNADGSIS 98
           A+  IG  + ++  SI+
Sbjct: 104 AALLIGSTVLSSGNSIT 120


>gi|74317653|ref|YP_315393.1| flagellar basal body rod modification protein [Thiobacillus
          denitrificans ATCC 25259]
 gi|74057148|gb|AAZ97588.1| flagellar basal-body rod modification protein FlgD [Thiobacillus
          denitrificans ATCC 25259]
          Length = 221

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 48/79 (60%), Gaps = 5/79 (6%)

Query: 15 SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL- 73
          SKS S  T  QD FL LL+ Q+K+QDP  P+  +E  +Q+A  S +E    MN +L+ L 
Sbjct: 22 SKSGSSDT--QDRFLSLLVAQMKNQDPLNPLDNAEVTSQMAQLSTVEGIENMNKSLEALA 79

Query: 74 --LKSNNLAQASSYIGKNI 90
            + ++ ++QA++ IG  +
Sbjct: 80 SSMGASQMSQAANLIGHAV 98


>gi|83720138|ref|YP_440800.1| flagellar basal body rod modification protein [Burkholderia
           thailandensis E264]
 gi|167617584|ref|ZP_02386215.1| flagellar basal body rod modification protein [Burkholderia
           thailandensis Bt4]
 gi|257140549|ref|ZP_05588811.1| flagellar basal body rod modification protein [Burkholderia
           thailandensis E264]
 gi|83653963|gb|ABC38026.1| basal-body rod modification protein FlgD [Burkholderia
           thailandensis E264]
          Length = 278

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N+ L  L   L +    Q
Sbjct: 67  QTTFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTALTSLSSQLTAGQQTQ 126

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 127 AAMLIGSNV 135


>gi|148976393|ref|ZP_01813099.1| flagellar basal body rod modification protein D [Vibrionales
           bacterium SWAT-3]
 gi|145964216|gb|EDK29472.1| flagellar basal body rod modification protein D [Vibrionales
           bacterium SWAT-3]
          Length = 237

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LK 75
            K+ L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MNS  + L   + 
Sbjct: 34  GKQDLKQEDFLSLLTKQLAQQDPFKPVSNDQMIAQMASFATVDGIGKMNSQFESLNSSMT 93

Query: 76  SNNLAQASSYIGKNI 90
           SN   QASS +G+++
Sbjct: 94  SNQALQASSLVGRDV 108


>gi|229078935|ref|ZP_04211487.1| Flagellar hook assembly protein [Bacillus cereus Rock4-2]
 gi|228704349|gb|EEL56783.1| Flagellar hook assembly protein [Bacillus cereus Rock4-2]
          Length = 192

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 60/120 (50%), Gaps = 6/120 (5%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELL 74
           K+   +G+D FLKL ++  +HQDP   M  ++   Q AQL++  Q++   +    LQ  +
Sbjct: 46  KTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQSTM 105

Query: 75  KSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            S  L     ++GK +   DG    ++G V  ++++      + ++N  + +    R+S+
Sbjct: 106 YSTALDGGMKFLGKYVRGVDGDGNKVTGQVETVRLAENNDVQLVINNKVVSLRFVERVSD 165


>gi|91791428|ref|YP_561079.1| flagellar hook capping protein [Shewanella denitrificans OS217]
 gi|91713430|gb|ABE53356.1| flagellar hook capping protein [Shewanella denitrificans OS217]
          Length = 135

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 56/108 (51%), Gaps = 4/108 (3%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSY 85
           D FL+L + Q+ +QDP EP+  SE +AQLA FS +E + Q N     LL   +  QA   
Sbjct: 23  DDFLQLFVAQLNYQDPLEPVNNSEFLAQLAQFSSLEINRQSNDNSLSLLAIGSSDQALGL 82

Query: 86  IGKNI---TNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           IG+++   T +  +  G V  +  +  G   +TV   +  + T I++ 
Sbjct: 83  IGRSVEVNTQSGQAFIGDVTGVNFTQQG-PMLTVKGADDSLLTDIKLG 129


>gi|170288060|ref|YP_001738298.1| flagellar hook capping protein [Thermotoga sp. RQ2]
 gi|281411900|ref|YP_003345979.1| flagellar hook capping protein [Thermotoga naphthophila RKU-10]
 gi|170175563|gb|ACB08615.1| flagellar hook capping protein [Thermotoga sp. RQ2]
 gi|281373003|gb|ADA66565.1| flagellar hook capping protein [Thermotoga naphthophila RKU-10]
          Length = 224

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 47/72 (65%), Gaps = 3/72 (4%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK---SNNL 79
          L ++AFL+LL+ +++ QDP EPM+  + ++QL+  + +EQ   + S +++ ++   S N 
Sbjct: 27 LDKEAFLRLLLQELEMQDPLEPMETKDMISQLSQLTSLEQITNLTSAVKDFVEAQTSVNP 86

Query: 80 AQASSYIGKNIT 91
          AQ +S IGK + 
Sbjct: 87 AQLASLIGKYVV 98


>gi|95929856|ref|ZP_01312597.1| flagellar hook capping protein [Desulfuromonas acetoxidans DSM
          684]
 gi|95134152|gb|EAT15810.1| flagellar hook capping protein [Desulfuromonas acetoxidans DSM
          684]
          Length = 222

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 17 SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          S     LG+  FL L++ Q+K+QDP  P  A+E  AQLA FS +EQ   +N  L+ +
Sbjct: 22 SSGANALGKQDFLTLMVEQLKNQDPMNPSDATEFTAQLAQFSSLEQLFNVNDNLESM 78


>gi|148269403|ref|YP_001243863.1| flagellar hook capping protein [Thermotoga petrophila RKU-1]
 gi|147734947|gb|ABQ46287.1| flagellar hook capping protein [Thermotoga petrophila RKU-1]
          Length = 224

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 47/72 (65%), Gaps = 3/72 (4%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK---SNNL 79
          L ++AFL+LL+ +++ QDP EPM+  + ++QL+  + +EQ   + S +++ ++   S N 
Sbjct: 27 LDKEAFLRLLLQELEMQDPLEPMETKDMISQLSQLASLEQITNLTSAVKDFVEAQTSVNP 86

Query: 80 AQASSYIGKNIT 91
          AQ +S IGK + 
Sbjct: 87 AQLASLIGKYVV 98


>gi|255305279|ref|ZP_05349451.1| putative basal-body rod modification protein [Clostridium difficile
           ATCC 43255]
          Length = 202

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (58%), Gaps = 7/73 (9%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN------ 78
           +D F+K+L+ Q+ +QDP  P   +E V+QLA F+ +E+   MN  L  LL  +N      
Sbjct: 59  KDLFMKILVAQMGNQDPMNPQDPTEYVSQLAQFATLEKMSAMNEKLDVLLALSNSTLINS 118

Query: 79  -LAQASSYIGKNI 90
            L+ A+S IGK +
Sbjct: 119 ALSMATSLIGKEV 131


>gi|206558967|ref|YP_002229727.1| flagellar basal body rod modification protein [Burkholderia
          cenocepacia J2315]
 gi|198035004|emb|CAR50876.1| basal-body rod modification protein FlgD [Burkholderia
          cenocepacia J2315]
          Length = 234

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
          Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N++L  L   L +    Q
Sbjct: 26 QATFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTSLTSLSTQLAAGQQTQ 85

Query: 82 ASSYIGKNI 90
          A+  IG N+
Sbjct: 86 AALLIGTNV 94


>gi|255598719|ref|XP_002537066.1| Basal-body rod modification protein flgD, putative [Ricinus
          communis]
 gi|223517601|gb|EEF25315.1| Basal-body rod modification protein flgD, putative [Ricinus
          communis]
          Length = 222

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA---Q 81
          QD F+ LL+TQ+K+QDP  PM  ++  +Q+A  + +    ++N T+  L+ S  L    Q
Sbjct: 31 QDRFMTLLVTQMKNQDPLNPMDNAQVTSQMAQLNTVTGINKLNETMSSLIGSVQLGQSYQ 90

Query: 82 ASSYIGKNI 90
          A+S IG+N+
Sbjct: 91 ATSMIGRNV 99


>gi|254450579|ref|ZP_05064016.1| basal-body rod modification protein FlgD [Octadecabacter
           antarcticus 238]
 gi|198264985|gb|EDY89255.1| basal-body rod modification protein FlgD [Octadecabacter
           antarcticus 238]
          Length = 226

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 3/66 (4%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN---LAQA 82
           + FLK+L  Q+++QDP  P  +SE   QLA FS +EQ+V  N  L  L+   N   +AQ 
Sbjct: 37  ETFLKMLTVQMENQDPLNPTDSSEYAQQLATFSGVEQAVLTNDLLSALMVQMNTTGMAQM 96

Query: 83  SSYIGK 88
           + ++GK
Sbjct: 97  ADWVGK 102


>gi|171321837|ref|ZP_02910738.1| flagellar hook capping protein [Burkholderia ambifaria MEX-5]
 gi|171092875|gb|EDT38127.1| flagellar hook capping protein [Burkholderia ambifaria MEX-5]
          Length = 248

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N++L  L   L +    Q
Sbjct: 39  QATFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTSLTSLSTQLAAGQQTQ 98

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 99  AALLIGTNV 107


>gi|115353119|ref|YP_774958.1| flagellar basal body rod modification protein [Burkholderia
           ambifaria AMMD]
 gi|115283107|gb|ABI88624.1| flagellar hook capping protein [Burkholderia ambifaria AMMD]
          Length = 248

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N++L  L   L +    Q
Sbjct: 39  QATFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTSLTSLSSQLAAGQQTQ 98

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 99  AALLIGTNV 107


>gi|206970764|ref|ZP_03231716.1| flagellar hook assembly protein family protein [Bacillus cereus
           AH1134]
 gi|228920463|ref|ZP_04083808.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|229069304|ref|ZP_04202594.1| Flagellar hook assembly protein [Bacillus cereus F65185]
 gi|229178161|ref|ZP_04305532.1| Flagellar hook assembly protein [Bacillus cereus 172560W]
 gi|206734400|gb|EDZ51570.1| flagellar hook assembly protein family protein [Bacillus cereus
           AH1134]
 gi|228605291|gb|EEK62741.1| Flagellar hook assembly protein [Bacillus cereus 172560W]
 gi|228713791|gb|EEL65676.1| Flagellar hook assembly protein [Bacillus cereus F65185]
 gi|228839093|gb|EEM84389.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 192

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 60/120 (50%), Gaps = 6/120 (5%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELL 74
           K+   +G+D FLKL ++  +HQDP   M  ++   Q AQL++  Q++   +    LQ  +
Sbjct: 46  KTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQSTM 105

Query: 75  KSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            S  L     ++GK +   DG    ++G V  ++++      + ++N  + +    R+S+
Sbjct: 106 YSTALDGGMKFLGKYVRGVDGDGNKVTGQVETVRLAENNDVQLVINNKVVSLRFVERVSD 165


>gi|78067838|ref|YP_370607.1| flagellar basal body rod modification protein [Burkholderia sp.
           383]
 gi|77968583|gb|ABB09963.1| Flagellar hook capping protein [Burkholderia sp. 383]
          Length = 251

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N++L  L   L +    Q
Sbjct: 39  QATFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTSLTSLSTQLTAGQQTQ 98

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 99  AALLIGTNV 107


>gi|228938866|ref|ZP_04101466.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228971747|ref|ZP_04132368.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228978356|ref|ZP_04138733.1| Flagellar hook assembly protein [Bacillus thuringiensis Bt407]
 gi|228781373|gb|EEM29574.1| Flagellar hook assembly protein [Bacillus thuringiensis Bt407]
 gi|228787837|gb|EEM35795.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228820715|gb|EEM66740.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|326939366|gb|AEA15262.1| flagellar basal body rod modification protein [Bacillus
           thuringiensis serovar chinensis CT-43]
          Length = 192

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 60/120 (50%), Gaps = 6/120 (5%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELL 74
           K+   +G+D FLKL ++  +HQDP   M  ++   Q AQL++  Q++   +    LQ  +
Sbjct: 46  KTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQSTM 105

Query: 75  KSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            S  L     ++GK +   DG    ++G V  ++++      + ++N  + +    R+S+
Sbjct: 106 YSTALDGGMKFLGKYVRGVDGDGNKVTGQVETVRLAENNDVQLVINNKVVSLRFVERVSD 165


>gi|172061973|ref|YP_001809625.1| flagellar basal body rod modification protein [Burkholderia
           ambifaria MC40-6]
 gi|171994490|gb|ACB65409.1| flagellar hook capping protein [Burkholderia ambifaria MC40-6]
          Length = 248

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N++L  L   L +    Q
Sbjct: 39  QATFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTSLTSLSSQLAAGQQTQ 98

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 99  AALLIGTNV 107


>gi|75761136|ref|ZP_00741128.1| Basal-body rod modification protein flgD [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|218896685|ref|YP_002445096.1| flagellar hook assembly protein family protein [Bacillus cereus
           G9842]
 gi|228900334|ref|ZP_04064564.1| Flagellar hook assembly protein [Bacillus thuringiensis IBL 4222]
 gi|228907386|ref|ZP_04071244.1| Flagellar hook assembly protein [Bacillus thuringiensis IBL 200]
 gi|228964736|ref|ZP_04125843.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|74491364|gb|EAO54588.1| Basal-body rod modification protein flgD [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|218540760|gb|ACK93154.1| flagellar hook assembly protein family protein [Bacillus cereus
           G9842]
 gi|228794986|gb|EEM42485.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228852247|gb|EEM97043.1| Flagellar hook assembly protein [Bacillus thuringiensis IBL 200]
 gi|228859369|gb|EEN03799.1| Flagellar hook assembly protein [Bacillus thuringiensis IBL 4222]
          Length = 192

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 60/120 (50%), Gaps = 6/120 (5%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELL 74
           K+   +G+D FLKL ++  +HQDP   M  ++   Q AQL++  Q++   +    LQ  +
Sbjct: 46  KTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQSTM 105

Query: 75  KSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            S  L     ++GK +   DG    ++G V  ++++      + ++N  + +    R+S+
Sbjct: 106 YSTALDGGMKFLGKYVRGVDGDGNKVTGQVETVRLAENNDVQLVINNKVVSLRFVERVSD 165


>gi|325529013|gb|EGD06026.1| flagellar basal body rod modification protein [Burkholderia sp.
          TJI49]
          Length = 229

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
          Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N++L  L   L +    Q
Sbjct: 17 QATFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTSLTSLSTQLAAGQQTQ 76

Query: 82 ASSYIGKNI 90
          A+  IG N+
Sbjct: 77 AALLIGSNV 85


>gi|170703095|ref|ZP_02893915.1| flagellar hook capping protein [Burkholderia ambifaria IOP40-10]
 gi|170131992|gb|EDT00500.1| flagellar hook capping protein [Burkholderia ambifaria IOP40-10]
          Length = 248

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N++L  L   L +    Q
Sbjct: 39  QATFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTSLTSLSSQLAAGQQTQ 98

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 99  AALLIGTNV 107


>gi|209964700|ref|YP_002297615.1| basal-body rod modification protein FlgD, putative [Rhodospirillum
           centenum SW]
 gi|209958166|gb|ACI98802.1| basal-body rod modification protein FlgD, putative [Rhodospirillum
           centenum SW]
          Length = 309

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 39/68 (57%), Gaps = 3/68 (4%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQAS-- 83
           + FL+LL  Q+K+QDP +P + SE   QL  FSQ+EQ +  NS L  L       QA+  
Sbjct: 35  ETFLQLLTAQLKNQDPLQPQETSEFTNQLVQFSQVEQQISTNSKLDNLTGVVQQGQATVA 94

Query: 84  -SYIGKNI 90
             YIGK +
Sbjct: 95  LQYIGKTV 102


>gi|255261779|ref|ZP_05341121.1| flagellar basal body rod modification protein [Thalassiobium sp.
          R2A62]
 gi|255104114|gb|EET46788.1| flagellar basal body rod modification protein [Thalassiobium sp.
          R2A62]
          Length = 220

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 43/65 (66%), Gaps = 3/65 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQASS 84
          FLK++  QI++QDP +P+ +++   QLA FS +EQ V+ N  L  L   L+ + +A+ ++
Sbjct: 31 FLKMMTAQIENQDPLDPIDSADYAVQLATFSSVEQQVKTNDLLSALGGQLQLSGMAEMAA 90

Query: 85 YIGKN 89
          ++G +
Sbjct: 91 WVGMD 95


>gi|260767770|ref|ZP_05876705.1| flagellar basal-body rod modification protein FlgD [Vibrio
           furnissii CIP 102972]
 gi|260617279|gb|EEX42463.1| flagellar basal-body rod modification protein FlgD [Vibrio
           furnissii CIP 102972]
 gi|315179398|gb|ADT86312.1| flagellar basal body rod modification protein D [Vibrio furnissii
           NCTC 11218]
          Length = 235

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LK 75
            K+ L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MNS  + L   + 
Sbjct: 32  GKQDLKQEDFLSLLTKQLAQQDPFKPVSNDQMIAQMASFATVDGIGKMNSQFENLNSSMT 91

Query: 76  SNNLAQASSYIGKNI 90
           SN   QASS +G+++
Sbjct: 92  SNQALQASSLVGRDV 106


>gi|83859392|ref|ZP_00952913.1| flagellar hook assembly protein FlgD [Oceanicaulis alexandrii
          HTCC2633]
 gi|83852839|gb|EAP90692.1| flagellar hook assembly protein FlgD [Oceanicaulis alexandrii
          HTCC2633]
          Length = 242

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KSNNLAQA 82
          D FL LL  Q+K+QDP +P+++ + V QL  FS +EQ +  N +L+ LL   +S+   +A
Sbjct: 29 DTFLTLLTEQLKNQDPLDPLESEQFVQQLVQFSSVEQQIASNESLEALLALQQSDAQLKA 88

Query: 83 SSYIGKNIT 91
            +IGK  T
Sbjct: 89 LDFIGKEAT 97


>gi|229524193|ref|ZP_04413598.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           bv. albensis VL426]
 gi|229337774|gb|EEO02791.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           bv. albensis VL426]
          Length = 235

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 51/83 (61%), Gaps = 3/83 (3%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           Q++  ++  +K+L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN+  
Sbjct: 24  QKKPDETTGQKSLKQEDFLSLLTKQLAQQDPFKPVSNDQMIAQMASFATVDGIGKMNTQF 83

Query: 71  QEL---LKSNNLAQASSYIGKNI 90
           + L   + SN   QASS +G+++
Sbjct: 84  ESLSSSMTSNQALQASSLVGRDV 106


>gi|15642197|ref|NP_231829.1| flagellar basal body rod modification protein [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121586270|ref|ZP_01676060.1| basal-body rod modification protein FlgD [Vibrio cholerae 2740-80]
 gi|121726556|ref|ZP_01679805.1| basal-body rod modification protein FlgD [Vibrio cholerae V52]
 gi|147674438|ref|YP_001217715.1| flagellar basal body rod modification protein [Vibrio cholerae
           O395]
 gi|153213643|ref|ZP_01948916.1| basal-body rod modification protein FlgD [Vibrio cholerae 1587]
 gi|153817067|ref|ZP_01969734.1| basal-body rod modification protein FlgD [Vibrio cholerae NCTC
           8457]
 gi|153820890|ref|ZP_01973557.1| basal-body rod modification protein FlgD [Vibrio cholerae B33]
 gi|153825362|ref|ZP_01978029.1| basal-body rod modification protein FlgD [Vibrio cholerae MZO-2]
 gi|153829341|ref|ZP_01982008.1| basal-body rod modification protein FlgD [Vibrio cholerae 623-39]
 gi|183179564|ref|ZP_02957775.1| basal-body rod modification protein FlgD [Vibrio cholerae MZO-3]
 gi|227082322|ref|YP_002810873.1| basal-body rod modification protein FlgD [Vibrio cholerae M66-2]
 gi|229507725|ref|ZP_04397230.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           BX 330286]
 gi|229512080|ref|ZP_04401559.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           B33]
 gi|229513842|ref|ZP_04403304.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           TMA 21]
 gi|229519216|ref|ZP_04408659.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           RC9]
 gi|229522147|ref|ZP_04411564.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           TM 11079-80]
 gi|229528797|ref|ZP_04418187.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           12129(1)]
 gi|229607229|ref|YP_002877877.1| flagellar basal body rod modification protein [Vibrio cholerae
           MJ-1236]
 gi|254225800|ref|ZP_04919405.1| basal-body rod modification protein FlgD [Vibrio cholerae V51]
 gi|254849327|ref|ZP_05238677.1| basal-body rod modification protein FlgD [Vibrio cholerae MO10]
 gi|255747103|ref|ZP_05421048.1| flagellar basal-body rod modification protein FlgD [Vibrio cholera
           CIRS 101]
 gi|262161353|ref|ZP_06030463.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           INDRE 91/1]
 gi|262167776|ref|ZP_06035478.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           RC27]
 gi|262191690|ref|ZP_06049866.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           CT 5369-93]
 gi|297580844|ref|ZP_06942769.1| flagellar basal body rod modification protein [Vibrio cholerae
           RC385]
 gi|298500424|ref|ZP_07010229.1| flagellar basal body rod modification protein [Vibrio cholerae MAK
           757]
 gi|9656754|gb|AAF95343.1| basal-body rod modification protein FlgD [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121549536|gb|EAX59562.1| basal-body rod modification protein FlgD [Vibrio cholerae 2740-80]
 gi|121631009|gb|EAX63388.1| basal-body rod modification protein FlgD [Vibrio cholerae V52]
 gi|124115842|gb|EAY34662.1| basal-body rod modification protein FlgD [Vibrio cholerae 1587]
 gi|125621706|gb|EAZ50035.1| basal-body rod modification protein FlgD [Vibrio cholerae V51]
 gi|126512335|gb|EAZ74929.1| basal-body rod modification protein FlgD [Vibrio cholerae NCTC
           8457]
 gi|126521682|gb|EAZ78905.1| basal-body rod modification protein FlgD [Vibrio cholerae B33]
 gi|146316321|gb|ABQ20860.1| basal-body rod modification protein FlgD [Vibrio cholerae O395]
 gi|148875182|gb|EDL73317.1| basal-body rod modification protein FlgD [Vibrio cholerae 623-39]
 gi|149741046|gb|EDM55115.1| basal-body rod modification protein FlgD [Vibrio cholerae MZO-2]
 gi|183012975|gb|EDT88275.1| basal-body rod modification protein FlgD [Vibrio cholerae MZO-3]
 gi|227010210|gb|ACP06422.1| basal-body rod modification protein FlgD [Vibrio cholerae M66-2]
 gi|227014094|gb|ACP10304.1| basal-body rod modification protein FlgD [Vibrio cholerae O395]
 gi|229332571|gb|EEN98057.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           12129(1)]
 gi|229341072|gb|EEO06077.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           TM 11079-80]
 gi|229343905|gb|EEO08880.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           RC9]
 gi|229349023|gb|EEO13980.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           TMA 21]
 gi|229352045|gb|EEO16986.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           B33]
 gi|229355230|gb|EEO20151.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           BX 330286]
 gi|229369884|gb|ACQ60307.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           MJ-1236]
 gi|254845032|gb|EET23446.1| basal-body rod modification protein FlgD [Vibrio cholerae MO10]
 gi|255735505|gb|EET90905.1| flagellar basal-body rod modification protein FlgD [Vibrio cholera
           CIRS 101]
 gi|262023841|gb|EEY42540.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           RC27]
 gi|262028664|gb|EEY47318.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           INDRE 91/1]
 gi|262032429|gb|EEY50991.1| flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           CT 5369-93]
 gi|297534670|gb|EFH73506.1| flagellar basal body rod modification protein [Vibrio cholerae
           RC385]
 gi|297541117|gb|EFH77171.1| flagellar basal body rod modification protein [Vibrio cholerae MAK
           757]
 gi|327484717|gb|AEA79124.1| Flagellar basal-body rod modification protein FlgD [Vibrio cholerae
           LMA3894-4]
          Length = 235

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 51/83 (61%), Gaps = 3/83 (3%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           Q++  ++  +K+L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN+  
Sbjct: 24  QKKPDETTGQKSLKQEDFLSLLTKQLAQQDPFKPVSNDQMIAQMASFATVDGIGKMNTQF 83

Query: 71  QEL---LKSNNLAQASSYIGKNI 90
           + L   + SN   QASS +G+++
Sbjct: 84  ESLNSSMTSNQALQASSLVGRDV 106


>gi|256833234|ref|YP_003161961.1| flagellar hook capping protein [Jonesia denitrificans DSM 20603]
 gi|256686765|gb|ACV09658.1| flagellar hook capping protein [Jonesia denitrificans DSM 20603]
          Length = 161

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 52/89 (58%), Gaps = 3/89 (3%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K+ +  + FL LL+TQ+K+QDP+ PM  +E +AQ    + MEQ   +    QE       
Sbjct: 30  KQEMDGEMFLNLLVTQLKYQDPSSPMDTTEMMAQTTQLASMEQLTALTKVNQESFALQMR 89

Query: 80  AQASSYIGKNI--TNADG-SISGVVNAIQ 105
             +++ IG+++  TN+ G + +G V++I+
Sbjct: 90  VASAALIGQDVTFTNSHGDTTTGRVDSIR 118


>gi|261211323|ref|ZP_05925611.1| flagellar basal-body rod modification protein FlgD [Vibrio sp.
           RC341]
 gi|260839278|gb|EEX65904.1| flagellar basal-body rod modification protein FlgD [Vibrio sp.
           RC341]
          Length = 235

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 51/83 (61%), Gaps = 3/83 (3%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           Q++  ++  +K+L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN+  
Sbjct: 24  QKKPDETTGQKSLKQEDFLSLLTKQLAQQDPFKPVGNDQMIAQMASFATVDGIGKMNTQF 83

Query: 71  QEL---LKSNNLAQASSYIGKNI 90
           + L   + SN   QASS +G+++
Sbjct: 84  ESLNSSMTSNQALQASSLVGRDV 106


>gi|149912819|ref|ZP_01901353.1| Possible FlgD protein [Roseobacter sp. AzwK-3b]
 gi|149813225|gb|EDM73051.1| Possible FlgD protein [Roseobacter sp. AzwK-3b]
          Length = 233

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 47/78 (60%), Gaps = 5/78 (6%)

Query: 15  SKSKSKKTLGQD--AFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE 72
           +++  K  L  D   FLK+L  Q+++QDP  P+++++   QLA FS +EQ V+ N  L+ 
Sbjct: 29  AEAPPKPALSSDFETFLKMLTAQMRNQDPLNPVESADFAVQLATFSTVEQQVRTNDLLET 88

Query: 73  L---LKSNNLAQASSYIG 87
           L   + +  ++Q S ++G
Sbjct: 89  LGDRMGAMGMSQLSGWVG 106


>gi|225569973|ref|ZP_03778998.1| hypothetical protein CLOHYLEM_06068 [Clostridium hylemonae DSM
           15053]
 gi|225161443|gb|EEG74062.1| hypothetical protein CLOHYLEM_06068 [Clostridium hylemonae DSM
           15053]
          Length = 171

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 52/90 (57%), Gaps = 6/90 (6%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSV-QMNSTLQEL 73
           S SK    L  + F KLL  Q+++QD   PM  SE +AQ+ V +QM Q++ +M++   E+
Sbjct: 29  SSSKGSNELTINDFYKLLSAQLRYQDADNPMDTSEMMAQM-VQTQMIQAITEMSAINLEM 87

Query: 74  LKSNNLAQASSYIGKNITNA----DGSISG 99
              N ++ ASS +GK +T A    DG  +G
Sbjct: 88  YAINTISYASSMVGKTVTMAEVDEDGKFTG 117


>gi|218235843|ref|YP_002366438.1| flagellar basal body rod modification protein [Bacillus cereus
           B4264]
 gi|229109209|ref|ZP_04238808.1| Flagellar hook assembly protein [Bacillus cereus Rock1-15]
 gi|218163800|gb|ACK63792.1| flagellar hook assembly protein family protein [Bacillus cereus
           B4264]
 gi|228674219|gb|EEL29464.1| Flagellar hook assembly protein [Bacillus cereus Rock1-15]
          Length = 192

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 60/120 (50%), Gaps = 6/120 (5%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELL 74
           K+   +G+D FLKL ++  +HQDP   M  ++   Q AQL++  Q++   +    LQ  +
Sbjct: 46  KTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQSTM 105

Query: 75  KSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            S  L     ++GK +   DG    ++G V  ++++      + ++N  + +    R+S+
Sbjct: 106 YSTALDGGMKFLGKYVRGVDGEGNKVTGQVETVRLAENNDVQLVINNKVVSLRFVERVSD 165


>gi|47566135|ref|ZP_00237173.1| Basal-body rod modification protein flgD [Bacillus cereus G9241]
 gi|47557052|gb|EAL15382.1| Basal-body rod modification protein flgD [Bacillus cereus G9241]
          Length = 192

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 58/120 (48%), Gaps = 6/120 (5%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---L 74
           K+   +G+D FLKL +   +HQDP   M  ++ + Q A  S MEQ   M   +  L   +
Sbjct: 46  KTPGVMGKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDSLKTTM 105

Query: 75  KSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            S  +     ++GK +   DG+   ++G V  ++++      + +DN  + +    R+S+
Sbjct: 106 YSTAIDGGMKFLGKYVRGVDGNGKKVTGQVETVRLAENNEVQLVIDNKVVSLRFVERVSD 165


>gi|262404541|ref|ZP_06081096.1| flagellar basal-body rod modification protein FlgD [Vibrio sp.
           RC586]
 gi|262349573|gb|EEY98711.1| flagellar basal-body rod modification protein FlgD [Vibrio sp.
           RC586]
          Length = 235

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 51/83 (61%), Gaps = 3/83 (3%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           Q++  ++  +K+L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN+  
Sbjct: 24  QKKPDETTGQKSLKQEDFLSLLTKQLAQQDPFKPVGNDQMIAQMASFATVDGIGKMNTQF 83

Query: 71  QEL---LKSNNLAQASSYIGKNI 90
           + L   + SN   QASS +G+++
Sbjct: 84  ESLNSSMTSNQALQASSLVGRDV 106


>gi|260752885|ref|YP_003225778.1| flagellar hook capping protein [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258552248|gb|ACV75194.1| flagellar hook capping protein [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 230

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 50/84 (59%), Gaps = 10/84 (11%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST---LQELLKSNNLAQASS 84
           FL LL TQ+K+QDP  P+  ++  AQ+A FS +    Q+N+T   +Q  + ++ L   S+
Sbjct: 42  FLTLLTTQLKYQDPDSPVDNTQMAAQMAQFSSVAGINQLNTTVSSIQSDVSNSRLGNVSN 101

Query: 85  YIGK------NI-TNADGSISGVV 101
           +IGK      NI T+ DG+ +G V
Sbjct: 102 WIGKAGLVSSNIATSIDGTFAGQV 125


>gi|149195337|ref|ZP_01872424.1| Flagellar hook capping protein [Caminibacter mediatlanticus TB-2]
 gi|149134529|gb|EDM23018.1| Flagellar hook capping protein [Caminibacter mediatlanticus TB-2]
          Length = 223

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 3/82 (3%)

Query: 3  INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
          IN  V  +  +F  + + + L +DAF++L + Q++ QDPT+PM   + + Q A  S ME 
Sbjct: 6  INNNVTTSGNDFVYNPNSQ-LDKDAFMQLFLKQLEMQDPTDPMDTDKMLEQTAYLSTMEM 64

Query: 63 SVQMNSTLQELLKSNNLAQASS 84
          +  M +TL  L  +N L Q SS
Sbjct: 65 NQNMQTTLDNL--ANTLQQTSS 84


>gi|258621048|ref|ZP_05716082.1| flagellar basal body rod modification protein [Vibrio mimicus
           VM573]
 gi|258625276|ref|ZP_05720184.1| flagellar basal body rod modification protein [Vibrio mimicus
           VM603]
 gi|262166283|ref|ZP_06034020.1| flagellar basal-body rod modification protein FlgD [Vibrio mimicus
           VM223]
 gi|262170824|ref|ZP_06038502.1| flagellar basal-body rod modification protein FlgD [Vibrio mimicus
           MB-451]
 gi|258582449|gb|EEW07290.1| flagellar basal body rod modification protein [Vibrio mimicus
           VM603]
 gi|258586436|gb|EEW11151.1| flagellar basal body rod modification protein [Vibrio mimicus
           VM573]
 gi|261891900|gb|EEY37886.1| flagellar basal-body rod modification protein FlgD [Vibrio mimicus
           MB-451]
 gi|262025999|gb|EEY44667.1| flagellar basal-body rod modification protein FlgD [Vibrio mimicus
           VM223]
          Length = 235

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 51/83 (61%), Gaps = 3/83 (3%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           Q++  ++  +K+L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN+  
Sbjct: 24  QKKPDETTGQKSLKQEDFLSLLTKQLAQQDPFKPVGNDQMIAQMASFATVDGIGKMNTQF 83

Query: 71  QEL---LKSNNLAQASSYIGKNI 90
           + L   + SN   QASS +G+++
Sbjct: 84  ESLNSSMTSNQALQASSLVGRDV 106


>gi|27363706|ref|NP_759234.1| flagellar basal body rod modification protein [Vibrio vulnificus
           CMCP6]
 gi|37679146|ref|NP_933755.1| flagellar basal body rod modification protein [Vibrio vulnificus
           YJ016]
 gi|320157110|ref|YP_004189489.1| flagellar basal-body rod modification protein FlgD [Vibrio
           vulnificus MO6-24/O]
 gi|27359822|gb|AAO08761.1| Flagellar basal-body rod modification protein flgD [Vibrio
           vulnificus CMCP6]
 gi|37197888|dbj|BAC93726.1| flagellar hook capping protein FlgD [Vibrio vulnificus YJ016]
 gi|319932422|gb|ADV87286.1| flagellar basal-body rod modification protein FlgD [Vibrio
           vulnificus MO6-24/O]
          Length = 235

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LK 75
            K+ L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MNS  + L   + 
Sbjct: 32  GKQELKQEDFLSLLTKQLAQQDPFKPVSNDQMIAQMASFATVDGIGKMNSQFESLNSSMT 91

Query: 76  SNNLAQASSYIGKNI 90
           SN   QASS +G+++
Sbjct: 92  SNQALQASSLVGRDV 106


>gi|168703390|ref|ZP_02735667.1| Flagellar hook capping protein [Gemmata obscuriglobus UQM 2246]
          Length = 120

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 41/68 (60%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
          +GQD FL+LLI Q+++QDP +P+   + + QLA  + +     +N+   E+LK   + Q 
Sbjct: 11 VGQDQFLQLLIAQLQNQDPLDPVSNQDFIQQLATLNTVSGIQSLNANFSEMLKLQQITQG 70

Query: 83 SSYIGKNI 90
          +  +GK I
Sbjct: 71 ADLVGKTI 78


>gi|56551508|ref|YP_162347.1| flagellar hook capping protein [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241761152|ref|ZP_04759241.1| flagellar hook capping protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|56543082|gb|AAV89236.1| flagellar hook capping protein [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241374771|gb|EER64232.1| flagellar hook capping protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 230

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 50/84 (59%), Gaps = 10/84 (11%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST---LQELLKSNNLAQASS 84
           FL LL TQ+K+QDP  P+  ++  AQ+A FS +    Q+N+T   +Q  + ++ L   S+
Sbjct: 42  FLTLLTTQLKYQDPDSPVDNTQMAAQMAQFSSVAGINQLNTTVSSIQSDVSNSRLGNVSN 101

Query: 85  YIGK------NI-TNADGSISGVV 101
           +IGK      NI T+ DG+ +G V
Sbjct: 102 WIGKAGLVSSNIATSIDGTFAGQV 125


>gi|118581833|ref|YP_903083.1| flagellar hook capping protein [Pelobacter propionicus DSM 2379]
 gi|118504543|gb|ABL01026.1| flagellar hook capping protein [Pelobacter propionicus DSM 2379]
          Length = 220

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (60%), Gaps = 5/76 (6%)

Query: 20 KKTLGQDA--FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS- 76
          K +LG D+  FL+L I Q+++QDP  P  A+  + QL+  S +EQS    + L  LL + 
Sbjct: 19 KSSLGMDSSDFLQLFIAQMQYQDPLAPTDATAMMNQLSQLSLVEQSYNQTTALSNLLAAQ 78

Query: 77 -NNLAQAS-SYIGKNI 90
           N+L+  S S+IGK +
Sbjct: 79 NNSLSMGSVSFIGKTV 94


>gi|91785635|ref|YP_560841.1| flagellar basal body rod modification protein [Burkholderia
           xenovorans LB400]
 gi|91689589|gb|ABE32789.1| putative flagellar hook capping protein [Burkholderia xenovorans
           LB400]
          Length = 240

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 46/77 (59%), Gaps = 3/77 (3%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FL+LL+ Q+K+QDPT PM +S+  +QLA  + +    Q+N+TL  L   + +   +Q
Sbjct: 47  QNTFLQLLVAQLKNQDPTNPMDSSQMTSQLAQINTVSGISQLNTTLTSLATQMSAGQQSQ 106

Query: 82  ASSYIGKNITNADGSIS 98
           A+  IG  +     S+S
Sbjct: 107 AALLIGSTVLAPGSSVS 123


>gi|254230141|ref|ZP_04923536.1| Flagellar hook capping protein [Vibrio sp. Ex25]
 gi|262394940|ref|YP_003286794.1| flagellar basal-body rod modification protein FlgD [Vibrio sp.
           Ex25]
 gi|151937334|gb|EDN56197.1| Flagellar hook capping protein [Vibrio sp. Ex25]
 gi|262338534|gb|ACY52329.1| flagellar basal-body rod modification protein FlgD [Vibrio sp.
           Ex25]
          Length = 236

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 47/78 (60%), Gaps = 3/78 (3%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL-- 73
           +S  K+ L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN+  + L  
Sbjct: 30  ESTGKQDLKQEDFLSLLTKQLSQQDPFKPVSNDQMIAQMASFATVDGIGKMNTQFESLNS 89

Query: 74  -LKSNNLAQASSYIGKNI 90
            + SN   QASS +G+++
Sbjct: 90  SMTSNQALQASSLVGRDV 107


>gi|84683989|ref|ZP_01011891.1| Possible FlgD protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84667742|gb|EAQ14210.1| Possible FlgD protein [Rhodobacterales bacterium HTCC2654]
          Length = 227

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 3/78 (3%)

Query: 13  EFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE 72
           E  KSKS  +   + FLK+L  Q+++QDP  P+++S+   QLA FS +EQ VQ N  L+ 
Sbjct: 23  EDPKSKSAISSDFETFLKMLTVQMENQDPLNPIESSDYAVQLATFSGVEQQVQTNDLLKA 82

Query: 73  L---LKSNNLAQASSYIG 87
           L   L   +++  + ++G
Sbjct: 83  LQTQLGVMSMSDLAGWVG 100


>gi|307731364|ref|YP_003908588.1| flagellar hook capping protein [Burkholderia sp. CCGE1003]
 gi|307585899|gb|ADN59297.1| flagellar hook capping protein [Burkholderia sp. CCGE1003]
          Length = 240

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FL LL+ Q+K+QDPT PM +S+  +QLA  + +    Q+N+TL  L   + +   +Q
Sbjct: 47  QNTFLSLLVAQLKNQDPTNPMDSSQMTSQLAQINTVSGISQLNTTLSSLATQMSAGQQSQ 106

Query: 82  ASSYIGKNITNADGSIS 98
           A+  IG  +     S+S
Sbjct: 107 AALLIGSTVLAPGSSVS 123


>gi|296157457|ref|ZP_06840292.1| flagellar hook capping protein [Burkholderia sp. Ch1-1]
 gi|295892229|gb|EFG72012.1| flagellar hook capping protein [Burkholderia sp. Ch1-1]
          Length = 240

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 46/77 (59%), Gaps = 3/77 (3%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FL+LL+ Q+K+QDPT PM +S+  +QLA  + +    Q+N+TL  L   + +   +Q
Sbjct: 47  QNTFLQLLVAQLKNQDPTNPMDSSQMTSQLAQINTVSGISQLNTTLTSLATQMSAGQQSQ 106

Query: 82  ASSYIGKNITNADGSIS 98
           A+  IG  +     S+S
Sbjct: 107 AALLIGSTVLAPGSSVS 123


>gi|91225872|ref|ZP_01260841.1| flagellar basal-body rod modification protein D [Vibrio
           alginolyticus 12G01]
 gi|269965425|ref|ZP_06179544.1| flagellar basal body rod modification protein [Vibrio alginolyticus
           40B]
 gi|91189522|gb|EAS75798.1| flagellar basal-body rod modification protein D [Vibrio
           alginolyticus 12G01]
 gi|269829904|gb|EEZ84134.1| flagellar basal body rod modification protein [Vibrio alginolyticus
           40B]
          Length = 236

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 47/78 (60%), Gaps = 3/78 (3%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL-- 73
           +S  K+ L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN+  + L  
Sbjct: 30  ESTGKQDLKQEDFLSLLTKQLSQQDPFKPVSNDQMIAQMASFATVDGIGKMNTQFESLNS 89

Query: 74  -LKSNNLAQASSYIGKNI 90
            + SN   QASS +G+++
Sbjct: 90  SMTSNQALQASSLVGRDV 107


>gi|170694391|ref|ZP_02885545.1| flagellar hook capping protein [Burkholderia graminis C4D1M]
 gi|170140814|gb|EDT08988.1| flagellar hook capping protein [Burkholderia graminis C4D1M]
          Length = 243

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FL LL+ Q+K+QDPT PM +S+  +QLA  + +    Q+N+TL  L   + +   +Q
Sbjct: 50  QNTFLSLLVAQLKNQDPTNPMDSSQMTSQLAQINTVSGISQLNTTLSSLATQMSAGQQSQ 109

Query: 82  ASSYIGKNITNADGSIS 98
           A+  IG  +     S+S
Sbjct: 110 AALLIGSTVLAPGSSVS 126


>gi|167568106|ref|ZP_02361022.1| flagellar basal body rod modification protein [Burkholderia
           oklahomensis EO147]
          Length = 282

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +++  +QLA  + +    Q+N++L  L   L +    Q
Sbjct: 71  QTTFLKLLVTQLQNQDPTSPVDSAQMTSQLAQINTVSGIAQLNTSLTSLSSQLTAGQQTQ 130

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 131 AAMLIGSNV 139


>gi|254973918|ref|ZP_05270390.1| putative basal-body rod modification protein [Clostridium difficile
           QCD-66c26]
 gi|255091305|ref|ZP_05320783.1| putative basal-body rod modification protein [Clostridium difficile
           CIP 107932]
 gi|255312962|ref|ZP_05354545.1| putative basal-body rod modification protein [Clostridium difficile
           QCD-76w55]
 gi|255515721|ref|ZP_05383397.1| putative basal-body rod modification protein [Clostridium difficile
           QCD-97b34]
 gi|255648815|ref|ZP_05395717.1| putative basal-body rod modification protein [Clostridium difficile
           QCD-37x79]
 gi|260682034|ref|YP_003213319.1| putative basal-body rod modification protein [Clostridium difficile
           CD196]
 gi|260685632|ref|YP_003216765.1| putative basal-body rod modification protein [Clostridium difficile
           R20291]
 gi|306518930|ref|ZP_07405277.1| putative basal-body rod modification protein [Clostridium difficile
           QCD-32g58]
 gi|260208197|emb|CBA60540.1| putative basal-body rod modification protein [Clostridium difficile
           CD196]
 gi|260211648|emb|CBE01905.1| putative basal-body rod modification protein [Clostridium difficile
           R20291]
          Length = 202

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 7/71 (9%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN------ 78
           +D F+K+L+ Q+ +QDP  P   +E V+QLA F+ +E+   MN  L  LL  +N      
Sbjct: 59  KDLFMKILVAQMGNQDPMNPQDPTEYVSQLAQFATLEKMSAMNDKLDILLALSNSTLINS 118

Query: 79  -LAQASSYIGK 88
            L+ A+S IGK
Sbjct: 119 ALSMATSLIGK 129


>gi|239817166|ref|YP_002946076.1| flagellar hook capping protein [Variovorax paradoxus S110]
 gi|239803743|gb|ACS20810.1| flagellar hook capping protein [Variovorax paradoxus S110]
          Length = 228

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 46/74 (62%), Gaps = 3/74 (4%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK---SNNLAQASS 84
           FLKLL+TQ+ +QDP  PM+ +E  +QLA  S +    ++N+ L  L+    +N + QA+S
Sbjct: 33  FLKLLVTQLNNQDPLNPMENAELTSQLAQMSTVSGIERLNTALSGLVNQTGANQVLQAAS 92

Query: 85  YIGKNITNADGSIS 98
            IG N+ +   ++S
Sbjct: 93  LIGYNVLSPGNALS 106


>gi|51894132|ref|YP_076823.1| flagellar hook assembly protein [Symbiobacterium thermophilum IAM
           14863]
 gi|51857821|dbj|BAD41979.1| flagellar hook assembly protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 139

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 60/112 (53%), Gaps = 13/112 (11%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           LG+  FL+LL+TQ+++QDP  P+   E +AQLA FS +EQ       + E ++   L+  
Sbjct: 30  LGKMEFLQLLVTQLRYQDPLNPIDDREFMAQLAQFSALEQ-------MTENVRWARLSYG 82

Query: 83  SSYIGKNI----TNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            S +G  +    T     I G+V A+++ S G   + + N EI +   I ++
Sbjct: 83  LSLVGAAVKYWGTEGQPEI-GIVYAVRIDS-GEPLLNLGNREIRLEQVIEVA 132


>gi|330830304|ref|YP_004393256.1| flagellar hook capping protein [Aeromonas veronii B565]
 gi|328805440|gb|AEB50639.1| Flagellar hook capping protein [Aeromonas veronii B565]
          Length = 246

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 53/94 (56%), Gaps = 13/94 (13%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ----SVQMNSTLQELLK 75
           KK L Q +FLKLL  Q+ +QDP +P+  ++ ++Q+   S  E     S QM + L  L+ 
Sbjct: 26  KKELDQASFLKLLTMQLSYQDPFKPVDNAQMLSQMTSMSTSEGINSLSTQMGN-LNTLMT 84

Query: 76  SNNLAQASSYIGKNI--------TNADGSISGVV 101
           S+   QAS+ +G+N+           +GSISGVV
Sbjct: 85  SSQALQASALVGQNVLLPSNIGYLEKEGSISGVV 118


>gi|254462177|ref|ZP_05075593.1| possible FlgD protein [Rhodobacterales bacterium HTCC2083]
 gi|206678766|gb|EDZ43253.1| possible FlgD protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 224

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 48/85 (56%), Gaps = 5/85 (5%)

Query: 11  QQEFSKSKSKKTLGQD--AFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
           Q++ ++++    LG D   FLK+L  Q+++QDP  P+ +++   QLA FS +EQ V+ N 
Sbjct: 17  QRDTNQAQKTAALGSDFETFLKMLTVQMENQDPLNPVDSADYAVQLATFSSVEQQVRTND 76

Query: 69  TLQEL---LKSNNLAQASSYIGKNI 90
            L  L   + S  +     ++G ++
Sbjct: 77  LLSSLAATMASGGVESLGHWVGMDV 101


>gi|297183503|gb|ADI19633.1| flagellar hook capping protein [uncultured delta proteobacterium
           HF0770_45N15]
          Length = 262

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 49/81 (60%), Gaps = 3/81 (3%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KSN 77
           + LG+  FL LL+TQ+ +QDPT+PMK  + + Q+A    +EQ   +N+  ++++   K  
Sbjct: 29  RELGKQDFLNLLMTQLANQDPTDPMKPEQMMQQMASLGTVEQLQNLNAQTRQVIGLQKQI 88

Query: 78  NLAQASSYIGKNITNADGSIS 98
             A ASS +G+++     S+S
Sbjct: 89  ARASASSLLGRDVEVGSTSLS 109


>gi|28897551|ref|NP_797156.1| flagellar basal body rod modification protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153839686|ref|ZP_01992353.1| flagellar basal body rod modification protein [Vibrio
           parahaemolyticus AQ3810]
 gi|260364610|ref|ZP_05777212.1| flagellar basal body rod modification protein [Vibrio
           parahaemolyticus K5030]
 gi|260878285|ref|ZP_05890640.1| flagellar basal body rod modification protein [Vibrio
           parahaemolyticus AN-5034]
 gi|260898115|ref|ZP_05906611.1| flagellar basal body rod modification protein [Vibrio
           parahaemolyticus Peru-466]
 gi|260901952|ref|ZP_05910347.1| flagellar basal body rod modification protein [Vibrio
           parahaemolyticus AQ4037]
 gi|5361007|gb|AAD42914.1|U12817_8 polar flagellar FlgD homolog [Vibrio parahaemolyticus]
 gi|28805763|dbj|BAC59040.1| polar flagellar FlgD [Vibrio parahaemolyticus RIMD 2210633]
 gi|149746796|gb|EDM57784.1| flagellar basal body rod modification protein [Vibrio
           parahaemolyticus AQ3810]
 gi|308086108|gb|EFO35803.1| flagellar basal body rod modification protein [Vibrio
           parahaemolyticus Peru-466]
 gi|308090177|gb|EFO39872.1| flagellar basal body rod modification protein [Vibrio
           parahaemolyticus AN-5034]
 gi|308106778|gb|EFO44318.1| flagellar basal body rod modification protein [Vibrio
           parahaemolyticus AQ4037]
 gi|308115091|gb|EFO52631.1| flagellar basal body rod modification protein [Vibrio
           parahaemolyticus K5030]
 gi|328473454|gb|EGF44302.1| flagellar basal body rod modification protein [Vibrio
           parahaemolyticus 10329]
          Length = 235

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (59%), Gaps = 3/77 (3%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL--- 73
           S  K+ L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN+  + L   
Sbjct: 30  STGKQDLKQEDFLSLLTKQLSQQDPFKPVSNDQMIAQMASFATVDGIGKMNTQFESLNSS 89

Query: 74  LKSNNLAQASSYIGKNI 90
           + SN   QASS +G+++
Sbjct: 90  MTSNQALQASSLVGRDV 106


>gi|187925762|ref|YP_001897404.1| flagellar basal body rod modification protein [Burkholderia
           phytofirmans PsJN]
 gi|187716956|gb|ACD18180.1| flagellar hook capping protein [Burkholderia phytofirmans PsJN]
          Length = 240

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FL+LL+ Q+K+QDPT PM +S+  +QLA  + +    Q+N+TL  L   + +   +Q
Sbjct: 47  QNTFLQLLVAQLKNQDPTNPMDSSQMTSQLAQINTVSGISQLNTTLSSLATQMSAGQQSQ 106

Query: 82  ASSYIGKNI 90
           A+  IG  +
Sbjct: 107 AALLIGSTV 115


>gi|167574224|ref|ZP_02367098.1| flagellar basal body rod modification protein [Burkholderia
           oklahomensis C6786]
          Length = 282

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +++  +QLA  + +    Q+N++L  L   L +    Q
Sbjct: 71  QTTFLKLLVTQLQNQDPTSPVDSAQMTSQLAQINTVSGIAQLNTSLTSLSSQLTAGQQTQ 130

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 131 AAMLIGSNV 139


>gi|291519590|emb|CBK74811.1| Flagellar hook capping protein [Butyrivibrio fibrisolvens 16/4]
          Length = 273

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 55/99 (55%), Gaps = 17/99 (17%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME--QSVQMNSTLQELLKSNNLA-- 80
           Q+ FL+LL+ ++++QDP EP    + VAQLA F+Q+E  QSVQ           N++A  
Sbjct: 46  QEMFLQLLVAEMQYQDPLEPTDNGQYVAQLASFTQIEAIQSVQ-----------NDMATI 94

Query: 81  QASSYIGKNITNADGS--ISGVVNAIQVSSTGLTAITVD 117
           +A+S +GK +   D +  + G VN +     G   + V+
Sbjct: 95  EANSLVGKYVVINDNNKEVRGKVNFVSQDDDGTMYVNVN 133


>gi|253998489|ref|YP_003050552.1| flagellar hook capping protein [Methylovorus sp. SIP3-4]
 gi|253985168|gb|ACT50025.1| flagellar hook capping protein [Methylovorus sp. SIP3-4]
          Length = 218

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 3/79 (3%)

Query: 15 SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
          S S S     QD F+ LLITQ+K QDP  PM  ++  +QLA  S +    ++NST++ ++
Sbjct: 17 SGSGSTAADAQDRFMTLLITQMKSQDPLNPMDNAQVTSQLAQLSTVTGIDKLNSTMESMI 76

Query: 75 ---KSNNLAQASSYIGKNI 90
             +S+   QAS+ IG+ +
Sbjct: 77 SNVQSSQTYQASNMIGRYV 95


>gi|90408059|ref|ZP_01216230.1| flagellar basal body rod modification protein [Psychromonas sp.
           CNPT3]
 gi|90310816|gb|EAS38930.1| flagellar basal body rod modification protein [Psychromonas sp.
           CNPT3]
          Length = 232

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 4/94 (4%)

Query: 1   MEINTEVNPTQQEFSKSKSKKT-LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           + +N  + P Q   +K   KK  L Q+ F  LL  Q+ +QDP +P+  SE +AQ+A F+ 
Sbjct: 10  LNLNKPLTPEQVSANKDVDKKQQLEQEDFFALLSQQLAYQDPFKPVDNSEMIAQMASFTT 69

Query: 60  MEQSVQMN---STLQELLKSNNLAQASSYIGKNI 90
            E   +M    + L+ +L S+   +ASS +GK +
Sbjct: 70  AEGITKMGNEFAGLKGVLSSSQALEASSLVGKKV 103


>gi|157373208|ref|YP_001471808.1| flagellar hook capping protein [Shewanella sediminis HAW-EB3]
 gi|157315582|gb|ABV34680.1| flagellar hook capping protein [Shewanella sediminis HAW-EB3]
          Length = 221

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 45/65 (69%), Gaps = 3/65 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME--QSVQMNSTLQELLKSN-NLAQASS 84
          F+ L+I QI++QDPT P+ ++E V QLA FSQ+E  + +++N + Q ++  N  + Q++ 
Sbjct: 33 FMTLMIAQIQNQDPTNPIDSTEYVTQLAQFSQVESLEQMRLNQSTQMVMMENLGIVQSAQ 92

Query: 85 YIGKN 89
           IGK+
Sbjct: 93 LIGKD 97


>gi|302874595|ref|YP_003843228.1| flagellar hook capping protein [Clostridium cellulovorans 743B]
 gi|307690794|ref|ZP_07633240.1| flagellar hook capping protein [Clostridium cellulovorans 743B]
 gi|302577452|gb|ADL51464.1| flagellar hook capping protein [Clostridium cellulovorans 743B]
          Length = 217

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 44/70 (62%), Gaps = 7/70 (10%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA 80
           KT  ++ F++LL  Q+K+QDP+ P  +++ VAQ+A FS +EQ   +N+T+         +
Sbjct: 39  KTTDKNMFVRLLSAQLKNQDPSNPADSTQYVAQMAQFSALEQMTNLNTTM-------TFS 91

Query: 81  QASSYIGKNI 90
            A++ +GK +
Sbjct: 92  SANNLVGKTV 101


>gi|271500065|ref|YP_003333090.1| flagellar hook capping protein [Dickeya dadantii Ech586]
 gi|270343620|gb|ACZ76385.1| flagellar hook capping protein [Dickeya dadantii Ech586]
          Length = 223

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
          Q++FL LL+ Q+K+QDPT PM  ++ V+QLA  + +    ++N+TL  +   + SN   Q
Sbjct: 31 QNSFLTLLVAQLKNQDPTNPMDNNQLVSQLAQLNTVSGIEKLNTTLGSISTQINSNQSIQ 90

Query: 82 ASSYIGKNI 90
          A+S IG  +
Sbjct: 91 AASLIGHGV 99


>gi|307131610|ref|YP_003883626.1| flagellar basal-body rod modification protein flgD [Dickeya
          dadantii 3937]
 gi|306529139|gb|ADM99069.1| Flagellar basal-body rod modification protein flgD [Dickeya
          dadantii 3937]
          Length = 223

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
          Q++FL LL+ Q+K+QDPT PM  ++ V+QLA  + +    ++N+TL  +   + SN   Q
Sbjct: 31 QNSFLTLLVAQLKNQDPTNPMDNNQLVSQLAQLNTVSGIEKLNTTLGSISTQINSNQSIQ 90

Query: 82 ASSYIGKNI 90
          A+S IG  +
Sbjct: 91 AASLIGHGV 99


>gi|222824501|ref|YP_002576075.1| flagellar hook assembly protein FlgD [Campylobacter lari RM2100]
 gi|222539722|gb|ACM64823.1| flagellar hook assembly protein FlgD [Campylobacter lari RM2100]
          Length = 335

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 35/54 (64%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
          L +DAFLKLL+ +++HQDPT+PM   + + Q A  S +E     N T+ +L+ +
Sbjct: 45 LDKDAFLKLLLIELQHQDPTDPMDTEKMLTQTAQLSALEMQDNTNKTMTQLVDA 98


>gi|238919258|ref|YP_002932773.1| basal-body rod modification protein FlgD [Edwardsiella ictaluri
           93-146]
 gi|238868827|gb|ACR68538.1| basal-body rod modification protein FlgD [Edwardsiella ictaluri
           93-146]
          Length = 244

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q++FL LL+ Q+++QDPT P+K +E   QLA  S +    ++N+TL  +   + SN   Q
Sbjct: 34  QNSFLTLLVAQLRNQDPTNPLKNNELTTQLAQISTVSGIEKLNTTLGSISGQINSNQSIQ 93

Query: 82  ASSYIGKNI 90
           A+S IG  +
Sbjct: 94  ATSLIGHGV 102


>gi|186477696|ref|YP_001859166.1| flagellar basal body rod modification protein [Burkholderia
           phymatum STM815]
 gi|184194155|gb|ACC72120.1| flagellar hook capping protein [Burkholderia phymatum STM815]
          Length = 237

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (64%), Gaps = 3/65 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FL+LLI Q+K+QDPT PM +S+  +QLA  + +    Q+NS+L  L   L +N   Q
Sbjct: 44  QNTFLQLLIAQMKNQDPTSPMDSSQMTSQLAQINTVTGIGQLNSSLTSLASQLTTNQQTQ 103

Query: 82  ASSYI 86
           A++ I
Sbjct: 104 AANLI 108


>gi|312882660|ref|ZP_07742397.1| flagellar basal body rod modification protein [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309369621|gb|EFP97136.1| flagellar basal body rod modification protein [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 236

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 52/94 (55%), Gaps = 11/94 (11%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LK 75
            K+ L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN+  + L   + 
Sbjct: 33  GKQDLKQEDFLSLLTKQLAQQDPFKPVSNDQMIAQMASFATVDGIGKMNNQFETLNASMT 92

Query: 76  SNNLAQASSYIGKN--------ITNADGSISGVV 101
           SN   QASS +G++        +   DGS++ +V
Sbjct: 93  SNQALQASSLVGRDVLVPGASGVKTGDGSMAAMV 126


>gi|23092314|gb|AAN08639.1| FlgD [Aeromonas hydrophila]
          Length = 244

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 54/94 (57%), Gaps = 13/94 (13%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ----SVQMNSTLQELLK 75
           KK L Q +FLKLL  Q+ +QDP +P+  ++ ++Q++  S  E     S QM     +++ 
Sbjct: 25  KKELDQASFLKLLTMQLSYQDPFKPVDNAQMLSQMSSMSTSEGIASLSTQMGKLNDQMIS 84

Query: 76  SNNLAQASSYIGKNI--------TNADGSISGVV 101
           S  L QASS +G+N+         + +GS+SGVV
Sbjct: 85  SQAL-QASSLVGQNVLLQSNMGYLDKEGSLSGVV 117


>gi|84388090|ref|ZP_00990986.1| flagellar basal body rod modification protein [Vibrio splendidus
           12B01]
 gi|84377157|gb|EAP94027.1| flagellar basal body rod modification protein [Vibrio splendidus
           12B01]
          Length = 237

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LK 75
            K+ L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN+  + L   + 
Sbjct: 34  GKQDLKQEDFLSLLTKQLAQQDPFKPVSNDQMIAQMASFATVDGIGKMNTQFESLNSSMT 93

Query: 76  SNNLAQASSYIGKNI 90
           SN   QASS +G+++
Sbjct: 94  SNQALQASSLVGRDV 108


>gi|30248321|ref|NP_840391.1| flagellar basal body rod modification protein [Nitrosomonas
           europaea ATCC 19718]
 gi|30138207|emb|CAD84215.1| putative basal-body rod modification protein FlgD [Nitrosomonas
           europaea ATCC 19718]
          Length = 223

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA---Q 81
           QD FLKLL+TQ+++QDP  PM  +E  +Q+A  S +    ++N+TL++L+  ++     +
Sbjct: 32  QDRFLKLLVTQMQNQDPLSPMDNAEVTSQMAQISTVSGIDKLNTTLEKLVADSDARRSFE 91

Query: 82  ASSYIGKNI 90
           A++ IG+ +
Sbjct: 92  AATMIGRGV 100


>gi|254463880|ref|ZP_05077291.1| flagellar hook capping protein [Rhodobacterales bacterium Y4I]
 gi|206684788|gb|EDZ45270.1| flagellar hook capping protein [Rhodobacterales bacterium Y4I]
          Length = 225

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (61%), Gaps = 3/65 (4%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQA 82
          + F+K+L  Q  +QDP EP+ ++E  AQLA FS +EQ  + N+ L+ L   L   N+A  
Sbjct: 33 ETFVKMLTAQATNQDPLEPLDSTEYAAQLAQFSMVEQQTKSNTLLEGLQSQLGLANMAAL 92

Query: 83 SSYIG 87
          S ++G
Sbjct: 93 SGWVG 97


>gi|76581470|gb|ABA50945.1| basal-body rod modification protein FlgD [Burkholderia pseudomallei
           1710b]
          Length = 459

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N+ L  L   L +    Q
Sbjct: 248 QTTFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTALTSLSSQLTAGQQTQ 307

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 308 AAMLIGSNV 316


>gi|91776308|ref|YP_546064.1| flagellar hook capping protein [Methylobacillus flagellatus KT]
 gi|91710295|gb|ABE50223.1| flagellar hook capping protein [Methylobacillus flagellatus KT]
          Length = 228

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS---NNLAQ 81
          QD F+KLLI Q+K+QDP  PM  +E  +Q+A  S +    +MN++L   + S       Q
Sbjct: 31 QDRFMKLLIAQMKNQDPLNPMDNAEVTSQMAQLSTVTGIEKMNASLSTFISSMQATQALQ 90

Query: 82 ASSYIGKNI 90
          ASS IG  +
Sbjct: 91 ASSLIGNTV 99


>gi|57505770|ref|ZP_00371696.1| hook assembly protein, flagella (flgD), putative [Campylobacter
           upsaliensis RM3195]
 gi|57016043|gb|EAL52831.1| hook assembly protein, flagella (flgD), putative [Campylobacter
           upsaliensis RM3195]
          Length = 274

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (57%), Gaps = 10/85 (11%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK-----SN 77
           L +DAFLKLL+ +++HQDPT+PM + + + Q +  + +E     N+T+Q+++      SN
Sbjct: 40  LDKDAFLKLLLIEMQHQDPTDPMDSDKMLTQTSQLAALEMQQNTNNTMQQMVAQMKKLSN 99

Query: 78  NLAQASSY-----IGKNITNADGSI 97
            +  + S      IGK  T AD  I
Sbjct: 100 AMGTSQSIGALGAIGKMATVADNKI 124


>gi|322832563|ref|YP_004212590.1| flagellar hook capping protein [Rahnella sp. Y9602]
 gi|321167764|gb|ADW73463.1| flagellar hook capping protein [Rahnella sp. Y9602]
          Length = 234

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 3/67 (4%)

Query: 27  AFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQAS 83
           +FL LL+ Q+K+QDPT PM  S+  +QLA  S +    ++N+TL  +   + S +  QAS
Sbjct: 38  SFLTLLVAQLKNQDPTNPMDNSQLTSQLAQISTVSGIEKLNTTLGSISGQITSGSSVQAS 97

Query: 84  SYIGKNI 90
           S IG  +
Sbjct: 98  SLIGHGV 104


>gi|291613037|ref|YP_003523194.1| flagellar hook capping protein [Sideroxydans lithotrophicus ES-1]
 gi|291583149|gb|ADE10807.1| flagellar hook capping protein [Sideroxydans lithotrophicus ES-1]
          Length = 220

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 42/67 (62%), Gaps = 3/67 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
          QD FL LL+TQ+K+QDP  PM  ++  +Q+A  S +    Q+NST+Q L   + ++   Q
Sbjct: 28 QDRFLTLLVTQLKNQDPLNPMDNAQVTSQMAQLSTVSGINQLNSTVQALSASMATSQSLQ 87

Query: 82 ASSYIGK 88
          A+S IG 
Sbjct: 88 ATSMIGH 94


>gi|229592131|ref|YP_002874250.1| flagellar basal body rod modification protein [Pseudomonas
          fluorescens SBW25]
 gi|229363997|emb|CAY51547.1| flagellar biosynthesis, initiation of hook assembly [Pseudomonas
          fluorescens SBW25]
          Length = 241

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 31/41 (75%)

Query: 21 KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME 61
          ++LG+DAFL+LL+TQ+K+Q+P  P      VAQLA FS +E
Sbjct: 40 QSLGKDAFLQLLVTQLKNQNPLSPQDNGAFVAQLAQFSSLE 80


>gi|295678059|ref|YP_003606583.1| flagellar hook capping protein [Burkholderia sp. CCGE1002]
 gi|295437902|gb|ADG17072.1| flagellar hook capping protein [Burkholderia sp. CCGE1002]
          Length = 235

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FL+LL+ Q+K+QDPT PM +S+  +QLA  S ++    +N++L  L   L ++  AQ
Sbjct: 42  QNTFLQLLVAQLKNQDPTNPMDSSQMTSQLAQISTVQGISNLNTSLTSLSTQLSASQQAQ 101

Query: 82  ASSYIGKNI 90
           ++  IG  +
Sbjct: 102 SALLIGSTV 110


>gi|229160716|ref|ZP_04288708.1| Flagellar hook assembly protein [Bacillus cereus R309803]
 gi|228622731|gb|EEK79565.1| Flagellar hook assembly protein [Bacillus cereus R309803]
          Length = 192

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 6/123 (4%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL- 73
           S+ K+   + +D FLKL +   +HQDP   M  ++ + Q A  S MEQ   M   +  L 
Sbjct: 43  SEQKAPGVMEKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDSLR 102

Query: 74  --LKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
             + S  L     ++GK +   DG    ++G V  ++++      + +DN  + +    R
Sbjct: 103 TTMYSTALDGGMKFLGKYVRGVDGEGNKVTGQVETVRLAENNEVQLVIDNKVVSLRFVER 162

Query: 129 ISN 131
           +S+
Sbjct: 163 VSD 165


>gi|260574415|ref|ZP_05842419.1| flagellar hook capping protein [Rhodobacter sp. SW2]
 gi|259023311|gb|EEW26603.1| flagellar hook capping protein [Rhodobacter sp. SW2]
          Length = 217

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 39/64 (60%), Gaps = 3/64 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQASS 84
          FL+++ TQ+K+QDP  P+ +++   QLA FS +EQ  + NS L+ +        +AQ + 
Sbjct: 31 FLRMMTTQLKNQDPMNPIDSADYAVQLATFSSVEQQAKTNSLLEAMGAQFGLMGMAQMAG 90

Query: 85 YIGK 88
          ++G 
Sbjct: 91 WVGH 94


>gi|88799020|ref|ZP_01114601.1| Flagellar hook capping protein [Reinekea sp. MED297]
 gi|88778247|gb|EAR09441.1| Flagellar hook capping protein [Reinekea sp. MED297]
          Length = 248

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 50/83 (60%), Gaps = 4/83 (4%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LK 75
           S   LG+  FL+L+I ++ +QDP +P   ++ +A+LA FS +E    M++  +EL    K
Sbjct: 25  SNDELGKTEFLELMIAKLNNQDPLKPQDDAQFIAELAQFSTVEGIQNMSAGFEELATSYK 84

Query: 76  SNNLAQASSYIGKNITNADGSIS 98
           S+   QASS +G  +T  DG+ S
Sbjct: 85  SSQALQASSLVGGAVT-IDGNTS 106


>gi|315637838|ref|ZP_07893028.1| flagellar hook assembly protein [Campylobacter upsaliensis JV21]
 gi|315482079|gb|EFU72693.1| flagellar hook assembly protein [Campylobacter upsaliensis JV21]
          Length = 285

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 37/52 (71%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
          L +DAFLKLL+ +++HQDPT+PM + + + Q +  + +E     N+T+Q+++
Sbjct: 41 LDKDAFLKLLLIEMQHQDPTDPMDSDKMLTQTSQLAALEMQQNTNNTMQQMV 92


>gi|254508413|ref|ZP_05120533.1| basal-body rod modification protein FlgD [Vibrio parahaemolyticus
           16]
 gi|219548623|gb|EED25628.1| basal-body rod modification protein FlgD [Vibrio parahaemolyticus
           16]
          Length = 236

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 52/94 (55%), Gaps = 11/94 (11%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LK 75
            K+ L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN+  + L   + 
Sbjct: 33  GKQDLKQEDFLSLLTKQLSQQDPFKPVSNDQMIAQMASFATVDGIGKMNNQFESLNASMT 92

Query: 76  SNNLAQASSYIGKN--------ITNADGSISGVV 101
           SN   QASS +G++        +   DGS++ +V
Sbjct: 93  SNQALQASSLVGRDVLIPGAAGVKKDDGSMAAMV 126


>gi|149188065|ref|ZP_01866360.1| flagellar basal body rod modification protein D [Vibrio shilonii
           AK1]
 gi|148838053|gb|EDL54995.1| flagellar basal body rod modification protein D [Vibrio shilonii
           AK1]
          Length = 235

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LK 75
            K+ L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN+  + L   + 
Sbjct: 32  GKQDLKQEDFLSLLTKQLAQQDPFKPVSNDQMIAQMASFATVDGIGKMNTQFESLNSSMT 91

Query: 76  SNNLAQASSYIGKNI 90
           SN   QASS +G+++
Sbjct: 92  SNQALQASSLVGRDV 106


>gi|312962589|ref|ZP_07777079.1| basal-body rod modification protein FlgD [Pseudomonas fluorescens
          WH6]
 gi|311283169|gb|EFQ61760.1| basal-body rod modification protein FlgD [Pseudomonas fluorescens
          WH6]
          Length = 241

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 31/41 (75%)

Query: 21 KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME 61
          ++LG+DAFL+LL+TQ+K+Q+P  P      VAQLA FS +E
Sbjct: 40 QSLGKDAFLQLLVTQLKNQNPLSPQDNGAFVAQLAQFSSLE 80


>gi|126460783|ref|YP_001041897.1| flagellar basal body rod modification protein [Rhodobacter
          sphaeroides ATCC 17029]
 gi|126102447|gb|ABN75125.1| flagellar hook capping protein [Rhodobacter sphaeroides ATCC
          17029]
          Length = 222

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 40/64 (62%), Gaps = 3/64 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS---NNLAQASS 84
          FL++L TQ+++QDP  PM++ +   QLA FS +EQ V+ N  L  +  S     L++ + 
Sbjct: 34 FLRMLTTQLQNQDPMNPMESDDFAMQLATFSGVEQQVKTNEILTGMGASIGVMGLSELAG 93

Query: 85 YIGK 88
          +IG+
Sbjct: 94 WIGR 97


>gi|229096238|ref|ZP_04227211.1| Flagellar hook assembly protein [Bacillus cereus Rock3-29]
 gi|229102352|ref|ZP_04233060.1| Flagellar hook assembly protein [Bacillus cereus Rock3-28]
 gi|229115193|ref|ZP_04244603.1| Flagellar hook assembly protein [Bacillus cereus Rock1-3]
 gi|228668333|gb|EEL23765.1| Flagellar hook assembly protein [Bacillus cereus Rock1-3]
 gi|228680999|gb|EEL35168.1| Flagellar hook assembly protein [Bacillus cereus Rock3-28]
 gi|228687198|gb|EEL41103.1| Flagellar hook assembly protein [Bacillus cereus Rock3-29]
          Length = 192

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 61/120 (50%), Gaps = 6/120 (5%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELL 74
           K+   +G+D FLKL ++  +HQDP   M  ++   Q AQL++  Q++   +   +L+  +
Sbjct: 46  KTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDSLRTTM 105

Query: 75  KSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            S  L     ++GK +   DG    ++G V  ++++      + ++N  + +    R+S+
Sbjct: 106 YSTALDGGMKFLGKYVRGVDGDGNKVTGQVETVRLAENNDVQLIINNKVVSLRFVERVSD 165


>gi|332994163|gb|AEF04218.1| flagellar basal body rod modification protein [Alteromonas sp. SN2]
          Length = 229

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 54/102 (52%), Gaps = 8/102 (7%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LK 75
           +++ L Q+ F  +L  Q+ +QDPT+P+   + VAQ+  F+  +   Q+N   +     + 
Sbjct: 27  TEQQLSQEDFFAMLTEQLANQDPTKPVDNDQMVAQMTSFTMADGISQLNDKFESFAASMT 86

Query: 76  SNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVD 117
           SN   QASS IG+N+      + G V  +   + G++ + V+
Sbjct: 87  SNQALQASSLIGQNVL-----VQGNVGHMSSDAAGVSGVVVN 123


>gi|316936124|ref|YP_004111106.1| flagellar hook capping protein [Rhodopseudomonas palustris DX-1]
 gi|315603838|gb|ADU46373.1| flagellar hook capping protein [Rhodopseudomonas palustris DX-1]
          Length = 222

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS-NNL--AQASS 84
          FL LL+TQ+++Q+P EP   ++ V+QL  ++  EQ   +NS L  L  S N+L    +S+
Sbjct: 33 FLTLLVTQLQNQNPLEPTDTNDFVSQLTSYANFEQQQALNSNLSSLTASLNSLLTLNSSN 92

Query: 85 YIGKNIT 91
          YIG+ +T
Sbjct: 93 YIGQTVT 99


>gi|167626154|ref|YP_001676448.1| flagellar hook capping protein [Shewanella halifaxensis HAW-EB4]
 gi|167356176|gb|ABZ78789.1| flagellar hook capping protein [Shewanella halifaxensis HAW-EB4]
          Length = 220

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 43/65 (66%), Gaps = 3/65 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQELLKSNNLAQASS 84
          F+ L+I QI++QDPT P+  +E V+QLA FSQ+E   QM    ST   ++++  + Q++ 
Sbjct: 32 FMTLMIAQIQNQDPTNPIDGTEYVSQLAQFSQVESLEQMRANQSTQMVIMENLGIVQSAQ 91

Query: 85 YIGKN 89
           +GK+
Sbjct: 92 LVGKD 96


>gi|89069831|ref|ZP_01157166.1| Possible FlgD protein [Oceanicola granulosus HTCC2516]
 gi|89044632|gb|EAR50748.1| Possible FlgD protein [Oceanicola granulosus HTCC2516]
          Length = 183

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 31  LLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQELLKSNNLAQASSYIG 87
           +L  Q+K+QDP  P+++++   QLA FSQ+EQ V  N   ++L E L +  L Q + ++G
Sbjct: 1   MLTVQLKNQDPLNPVESADYAVQLATFSQVEQQVLTNDLLTSLSEQLGAAGLGQVADWVG 60

Query: 88  KNITNADGSISGVVNAIQV 106
           +    A  ++S V  AI V
Sbjct: 61  REARVA-AAVSYVGTAIDV 78


>gi|172057881|ref|YP_001814341.1| flagellar hook capping protein [Exiguobacterium sibiricum 255-15]
 gi|171990402|gb|ACB61324.1| flagellar hook capping protein [Exiguobacterium sibiricum 255-15]
          Length = 156

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 55/98 (56%), Gaps = 3/98 (3%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           +K  S  ++ +D F+K+LI Q+ +QDPT PM+  E ++Q+A FS +EQ   +   ++ ++
Sbjct: 18  TKVPSSNSMDKDMFMKILIAQLSNQDPTAPMEDKEFISQMAQFSSLEQMQSIGKGIETMM 77

Query: 75  KSNNLAQASSY---IGKNITNADGSISGVVNAIQVSST 109
            + + A   +Y   IG  ++    +++       V+ST
Sbjct: 78  LNQHAAALMNYSNLIGNKVSYESETVTKDATGADVTST 115


>gi|224418357|ref|ZP_03656363.1| flagellar basal body rod modification protein [Helicobacter
           canadensis MIT 98-5491]
 gi|253827677|ref|ZP_04870562.1| flagellar biosynthesis protein [Helicobacter canadensis MIT
           98-5491]
 gi|313141888|ref|ZP_07804081.1| flagellar basal body rod modification protein [Helicobacter
           canadensis MIT 98-5491]
 gi|253511083|gb|EES89742.1| flagellar biosynthesis protein [Helicobacter canadensis MIT
           98-5491]
 gi|313130919|gb|EFR48536.1| flagellar basal body rod modification protein [Helicobacter
           canadensis MIT 98-5491]
          Length = 356

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 35/51 (68%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
           LG +AF+KL + Q+K+QDPT PM+  E + Q A  +Q+E   QM + ++++
Sbjct: 105 LGTEAFMKLFLEQLKNQDPTAPMETQEILTQTAQLTQVEAQTQMKNAMEQM 155


>gi|167835110|ref|ZP_02461993.1| flagellar basal body rod modification protein [Burkholderia
           thailandensis MSMB43]
          Length = 268

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+N+ L  L   + ++   Q
Sbjct: 57  QTTFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNTALTSLSSQITASQQTQ 116

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 117 AAMLIGSNV 125


>gi|77464914|ref|YP_354418.1| flagellar basal body rod modification protein [Rhodobacter
          sphaeroides 2.4.1]
 gi|77389332|gb|ABA80517.1| Possible FlgD protein [Rhodobacter sphaeroides 2.4.1]
          Length = 222

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 40/64 (62%), Gaps = 3/64 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS---NNLAQASS 84
          FL++L TQ+++QDP  PM++ +   QLA FS +EQ V+ N  L  +  S     L++ + 
Sbjct: 34 FLRMLTTQLQNQDPMNPMESDDFAMQLATFSGVEQQVKTNEILTGMGASIGVMGLSELAG 93

Query: 85 YIGK 88
          +IG+
Sbjct: 94 WIGR 97


>gi|288958685|ref|YP_003449026.1| flagellar basal-body rod modification protein [Azospirillum sp.
           B510]
 gi|288910993|dbj|BAI72482.1| flagellar basal-body rod modification protein [Azospirillum sp.
           B510]
          Length = 251

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 46/75 (61%), Gaps = 5/75 (6%)

Query: 21  KTLGQD--AFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           K LG +   FL +L TQ+K+QDP +P+  ++   QL  F+ +EQ++  NS L +L++  +
Sbjct: 50  KGLGDNFQTFLTMLTTQMKNQDPLKPLDTNDMTKQLVDFANVEQNIGTNSRLDKLVQLQS 109

Query: 79  LAQAS---SYIGKNI 90
              AS   +Y+G+ +
Sbjct: 110 AGTASTNLAYLGRTV 124


>gi|221640835|ref|YP_002527097.1| flagellar basal body rod modification protein [Rhodobacter
          sphaeroides KD131]
 gi|332559813|ref|ZP_08414135.1| FlgD2 [Rhodobacter sphaeroides WS8N]
 gi|221161616|gb|ACM02596.1| Flagellar hook capping protein [Rhodobacter sphaeroides KD131]
 gi|332277525|gb|EGJ22840.1| FlgD2 [Rhodobacter sphaeroides WS8N]
          Length = 222

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 40/64 (62%), Gaps = 3/64 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS---NNLAQASS 84
          FL++L TQ+++QDP  PM++ +   QLA FS +EQ V+ N  L  +  S     L++ + 
Sbjct: 34 FLRMLTTQLQNQDPMNPMESDDFAMQLATFSGVEQQVKTNEILTGMGASIGVMGLSELAG 93

Query: 85 YIGK 88
          +IG+
Sbjct: 94 WIGR 97


>gi|118475635|ref|YP_891219.1| flagellar basal body rod modification protein [Campylobacter fetus
           subsp. fetus 82-40]
 gi|118414861|gb|ABK83281.1| flagellar hook assembly protein [Campylobacter fetus subsp. fetus
           82-40]
          Length = 263

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 5/76 (6%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKAS---EQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           L +DAFLKLL+ ++++QDPTEPM ++   EQ +QLA     E + ++   L   ++S+  
Sbjct: 45  LDKDAFLKLLLVELQYQDPTEPMDSAKMLEQTSQLATLEMQENTNKVMKQLTTQMQSSLS 104

Query: 80  AQASSYIGK--NITNA 93
             A S +GK  N++NA
Sbjct: 105 MTAMSALGKMANLSNA 120


>gi|296282280|ref|ZP_06860278.1| flagellar hook capping protein [Citromicrobium bathyomarinum
          JL354]
          Length = 102

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 9/80 (11%)

Query: 5  TEVNPTQQEFSKSKSKKT---------LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLA 55
          T VNP     S S    T         LGQ  FL+LL  Q++ QDP EP+   E +AQ+A
Sbjct: 2  TSVNPFASATSASSKPNTNTQGRTMDQLGQADFLRLLTVQMQQQDPFEPVDNKEMLAQMA 61

Query: 56 VFSQMEQSVQMNSTLQELLK 75
           FS +  + + N+TL+++++
Sbjct: 62 QFSSLAGTAETNTTLEKIVE 81


>gi|332669197|ref|YP_004452205.1| flagellar hook capping protein [Cellulomonas fimi ATCC 484]
 gi|332338235|gb|AEE44818.1| flagellar hook capping protein [Cellulomonas fimi ATCC 484]
          Length = 151

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 55/106 (51%), Gaps = 9/106 (8%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA 80
           K L + AFL LL+ Q+++QDP+ PM +S+ + Q    S ME  V +  T +E        
Sbjct: 25  KELDKQAFLDLLVAQLRNQDPSAPMDSSQLMTQTTQLSTMESLVALADTQRESFALQMRM 84

Query: 81  QASSYIGKNITNADGSIS---GVVNAIQVSST------GLTAITVD 117
            A+  +G+ +T  D + +   GVV A+  + +      G T +T+D
Sbjct: 85  AAAQLVGQQVTWTDAAGATQKGVVTAVSYAGSVPTVKIGDTDVTLD 130


>gi|134095098|ref|YP_001100173.1| flagellar basal body rod modification protein [Herminiimonas
           arsenicoxydans]
 gi|133739001|emb|CAL62049.1| Basal-body rod modification protein FlgD [Herminiimonas
           arsenicoxydans]
          Length = 225

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 48/84 (57%), Gaps = 3/84 (3%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL--- 74
           KS     QD FL LL+TQ+K+QDP  P+  ++  +QLA  S +    ++N TL+ ++   
Sbjct: 27  KSTAEEAQDRFLTLLVTQMKNQDPLNPLDNAQVTSQLAQLSTVTGIDKLNGTLESMMGSY 86

Query: 75  KSNNLAQASSYIGKNITNADGSIS 98
           +SN   QA++ IG  +     +IS
Sbjct: 87  QSNQALQAANMIGHGVLAPGSNIS 110


>gi|39995525|ref|NP_951476.1| flagellar hook assembly protein FlgD [Geobacter sulfurreducens
          PCA]
 gi|39982288|gb|AAR33749.1| flagellar hook assembly protein FlgD [Geobacter sulfurreducens
          PCA]
 gi|298504525|gb|ADI83248.1| flagellar hook capping protein FlgD [Geobacter sulfurreducens
          KN400]
          Length = 218

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 5/77 (6%)

Query: 20 KKTLG--QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
          KK+ G  +D FLKL +TQ+++QDP  P  ++E + QLA  +Q+EQ+   NS L  LL   
Sbjct: 17 KKSTGMNKDDFLKLFVTQLQNQDPLNPQDSTEFIGQLAQLTQVEQAYNTNSNLSNLLNLV 76

Query: 78 NLA---QASSYIGKNIT 91
          N A    A S+IGK IT
Sbjct: 77 NGATSLSAVSFIGKEIT 93


>gi|326386929|ref|ZP_08208543.1| flagellar hook capping protein [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326208609|gb|EGD59412.1| flagellar hook capping protein [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 90

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (66%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
          LG   FLKLL  Q+ HQDPT+P+  ++ VAQLA FS +  + Q N+ L
Sbjct: 28 LGATDFLKLLTAQLNHQDPTQPVDNTQMVAQLAQFSSLAAANQTNTQL 75


>gi|126668557|ref|ZP_01739511.1| Flagellar hook capping protein [Marinobacter sp. ELB17]
 gi|126626962|gb|EAZ97605.1| Flagellar hook capping protein [Marinobacter sp. ELB17]
          Length = 224

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 63/114 (55%), Gaps = 15/114 (13%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ----SVQMNSTLQE 72
           +  K  LG++ F++L++ Q+K+Q+P +P    E ++QLA FS +E+    S  ++S + E
Sbjct: 23  ASGKGELGKNEFMELMLAQLKNQNPLDPQDNGEFISQLAQFSSLEEMQKLSGNVDSVIGE 82

Query: 73  LLKSNNLAQASSYIGKNI--------TNADGSISGVVNAIQVSSTGLTAITVDN 118
             +S    QAS+ +GK +          A G ++G V+    +STG   +++ N
Sbjct: 83  -FRSTKALQASAMVGKTVLVASDLAMLGASGEVNGTVDV--PASTGGVQVSILN 133


>gi|37525840|ref|NP_929184.1| flagellar basal body rod modification protein [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|36785269|emb|CAE14210.1| Basal-body rod modification protein FlgD (flagellar protein for the
           initiation of hook assembly) [Photorhabdus luminescens
           subsp. laumondii TTO1]
          Length = 231

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQASS 84
           F+KLL+ Q+K+QDPT PMK +E  + LA  + +    ++N+TL  +   + +N   QAS+
Sbjct: 35  FMKLLVAQMKNQDPTNPMKNNELTSHLAQINTLAGIEKLNTTLGSIVGQINNNQPVQASA 94

Query: 85  YIGKNI 90
            IG+ +
Sbjct: 95  LIGRGV 100


>gi|209695763|ref|YP_002263693.1| flagellar basal body rod modification protein [Aliivibrio
           salmonicida LFI1238]
 gi|208009716|emb|CAQ80020.1| flagellar basal-body rod protein FlgD [Aliivibrio salmonicida
           LFI1238]
          Length = 236

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 44/75 (58%), Gaps = 3/75 (4%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LK 75
            K  L Q+ FL LL  Q+  QDP++P++  + +AQ+A F+ ++   +MN     L   + 
Sbjct: 33  GKNELKQEDFLALLTKQLSQQDPSKPVENDQMIAQMASFATVDGIGKMNKQFDSLNTSMT 92

Query: 76  SNNLAQASSYIGKNI 90
           SN   QASS +G+++
Sbjct: 93  SNQALQASSLVGRDV 107


>gi|255523698|ref|ZP_05390664.1| flagellar hook capping protein [Clostridium carboxidivorans P7]
 gi|296186701|ref|ZP_06855103.1| flagellar hook capping protein [Clostridium carboxidivorans P7]
 gi|255512567|gb|EET88841.1| flagellar hook capping protein [Clostridium carboxidivorans P7]
 gi|296048738|gb|EFG88170.1| flagellar hook capping protein [Clostridium carboxidivorans P7]
          Length = 235

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 15/94 (15%)

Query: 5  TEVNPTQQEFSKSKSKKTL----GQD----AFLKLLITQIKHQDPTEPMKASEQVAQLAV 56
          ++VN T    +   S+ T     GQD    AF K+L  ++ +QDP+     +E V+Q+A 
Sbjct: 11 SDVNKTNDSNATKTSRGTRIVKKGQDMDKNAFFKILAAELSNQDPSNAKDGTEYVSQMAQ 70

Query: 57 FSQMEQSVQMNSTLQELLKSNNLAQASSYIGKNI 90
          FS +EQ V +N+T++       L  A++ IGK +
Sbjct: 71 FSSLEQMVNLNTTMK-------LTGANNLIGKTV 97


>gi|218532350|ref|YP_002423166.1| flagellar hook capping protein [Methylobacterium chloromethanicum
           CM4]
 gi|218524653|gb|ACK85238.1| flagellar hook capping protein [Methylobacterium chloromethanicum
           CM4]
          Length = 226

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 50/79 (63%), Gaps = 4/79 (5%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KSNNLAQASS 84
           FL LL TQ+K+Q+P +P+  ++   QL  F+ +EQ ++ NS+L  +L   K+ + + AS 
Sbjct: 35  FLTLLTTQLKNQNPLDPLDTNQFTQQLVQFAGVEQQLKTNSSLDTILTNSKAASASSASG 94

Query: 85  YIGKNITNADGSISGVVNA 103
            IG+ IT ADG+ + + N 
Sbjct: 95  LIGRTIT-ADGATTDLTNG 112


>gi|269138581|ref|YP_003295281.1| flagellar basal body rod modification protein [Edwardsiella tarda
           EIB202]
 gi|267984241|gb|ACY84070.1| flagellar basal body rod modification protein [Edwardsiella tarda
           EIB202]
 gi|304558591|gb|ADM41255.1| Flagellar basal-body rod modification protein FlgD [Edwardsiella
           tarda FL6-60]
          Length = 232

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q++FL LL+ Q+++QDPT P++ +E   QLA  S +    ++N+TL  +   + SN   Q
Sbjct: 34  QNSFLTLLVAQLRNQDPTNPLQNNELTTQLAQISTVSGIEKLNTTLGSISGQINSNQSIQ 93

Query: 82  ASSYIGKNI 90
           ASS IG  +
Sbjct: 94  ASSLIGHGV 102


>gi|124516304|gb|EAY57812.1| probable flagellar hook capping protein FlgD [Leptospirillum
           rubarum]
          Length = 276

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 58/113 (51%), Gaps = 10/113 (8%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN-- 77
           ++ LG   FL L+I+Q+++QDP  P+  +   AQLA FSQ++Q   +N  +  +      
Sbjct: 30  RQKLGMGDFLHLMISQLQYQDPLHPLNNTRFAAQLAQFSQLDQLTHLNRGVGTIAHDGAD 89

Query: 78  -NLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
            N      ++G+ +T     + G  NA +++ +G  ++T   T    +  +RI
Sbjct: 90  ANKMMMVGFLGQRVT-----MKG--NAFRLAPSGNVSLTYRQTGASQSGHLRI 135


>gi|270262402|ref|ZP_06190673.1| flagellar basal body rod modification protein [Serratia odorifera
          4Rx13]
 gi|270043086|gb|EFA16179.1| flagellar basal body rod modification protein [Serratia odorifera
          4Rx13]
          Length = 225

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 49/79 (62%), Gaps = 4/79 (5%)

Query: 15 SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL- 73
          +KS + + L Q+ FL LL+ Q+K+QDPT PM+ +E   QLA  + ++   ++N+TL  + 
Sbjct: 20 AKSNTGQDL-QNNFLTLLVAQLKNQDPTNPMQNNELTTQLAQINTVQGIEKLNTTLGSIS 78

Query: 74 --LKSNNLAQASSYIGKNI 90
            + SN   QA++ IG  +
Sbjct: 79 GQINSNQSLQATALIGHGV 97


>gi|59712482|ref|YP_205258.1| flagellar basal body rod modification protein [Vibrio fischeri
           ES114]
 gi|197335727|ref|YP_002156701.1| flagellar basal body rod modification protein [Vibrio fischeri
           MJ11]
 gi|24459276|gb|AAL86629.1| FlgD [Vibrio fischeri ES114]
 gi|59480583|gb|AAW86370.1| flagellar hook capping protein FlgD [Vibrio fischeri ES114]
 gi|197317217|gb|ACH66664.1| flagellar basal body rod modification protein [Vibrio fischeri
           MJ11]
          Length = 236

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 50/88 (56%), Gaps = 6/88 (6%)

Query: 6   EVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQ 65
           E N T++    +  K  L Q+ FL LL  Q+  QDP +P++  + +AQ+A F+ ++   +
Sbjct: 23  EANKTEK---TTGGKNELKQEDFLSLLTKQLSQQDPFKPVENDQMIAQMASFATVDGIGK 79

Query: 66  MNSTLQEL---LKSNNLAQASSYIGKNI 90
           MN+    L   + SN   QASS +G+++
Sbjct: 80  MNTQFDSLNSSMTSNQALQASSLVGRDV 107


>gi|163853492|ref|YP_001641535.1| flagellar hook capping protein [Methylobacterium extorquens PA1]
 gi|163665097|gb|ABY32464.1| flagellar hook capping protein [Methylobacterium extorquens PA1]
          Length = 226

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 50/79 (63%), Gaps = 4/79 (5%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KSNNLAQASS 84
           FL LL TQ+K+Q+P +P+  ++   QL  F+ +EQ ++ NS+L  +L   K+ + + AS 
Sbjct: 35  FLTLLTTQLKNQNPLDPLDTNQFTQQLVQFAGVEQQLKTNSSLDTILTNSKAASASSASG 94

Query: 85  YIGKNITNADGSISGVVNA 103
            IG+ IT ADG+ + + N 
Sbjct: 95  LIGRTIT-ADGATTDLTNG 112


>gi|315497624|ref|YP_004086428.1| flagellar hook capping protein [Asticcacaulis excentricus CB 48]
 gi|315415636|gb|ADU12277.1| flagellar hook capping protein [Asticcacaulis excentricus CB 48]
          Length = 224

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL--LKSNNLAQASSY 85
          FL LL  QIK+QDP  PM +++   QL  ++ +EQ ++ N  L+ L  L + N+A + + 
Sbjct: 32 FLGLLTAQIKNQDPLSPMDSTQWTNQLVQYTSVEQQLKANEYLKSLVGLGAGNMASSVNM 91

Query: 86 IGK 88
          IGK
Sbjct: 92 IGK 94


>gi|261253615|ref|ZP_05946188.1| flagellar basal-body rod modification protein FlgD [Vibrio
           orientalis CIP 102891]
 gi|260937006|gb|EEX92995.1| flagellar basal-body rod modification protein FlgD [Vibrio
           orientalis CIP 102891]
          Length = 237

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS---TLQELLK 75
            K+ L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN+   TL   + 
Sbjct: 34  GKQDLKQEDFLSLLTKQLAQQDPFKPVSNDQMIAQMASFATVDGIGKMNNQFETLNASMT 93

Query: 76  SNNLAQASSYIGKNI 90
           SN   QASS +G+++
Sbjct: 94  SNQALQASSLVGRDV 108


>gi|240140912|ref|YP_002965392.1| putative flagellar basal-body rod modification protein (Synonyms :
           FlgD flaV, fla FIV, fla FVI) [Methylobacterium
           extorquens AM1]
 gi|240010889|gb|ACS42115.1| putative flagellar basal-body rod modification protein (Synonyms :
           FlgD flaV, fla FIV, fla FVI) [Methylobacterium
           extorquens AM1]
          Length = 226

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 50/79 (63%), Gaps = 4/79 (5%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KSNNLAQASS 84
           FL LL TQ+K+Q+P +P+  ++   QL  F+ +EQ ++ NS+L  +L   K+ + + AS 
Sbjct: 35  FLTLLTTQLKNQNPLDPLDTNQFTQQLVQFAGVEQQLKTNSSLDTILTNSKAASASSASG 94

Query: 85  YIGKNITNADGSISGVVNA 103
            IG+ IT ADG+ + + N 
Sbjct: 95  LIGRTIT-ADGAATDLTNG 112


>gi|153950222|ref|YP_001401291.1| flagellar basal body rod modification protein [Yersinia
           pseudotuberculosis IP 31758]
 gi|152961717|gb|ABS49178.1| basal-body rod modification protein FlgD [Yersinia
           pseudotuberculosis IP 31758]
          Length = 228

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q++FL LL+ Q+K+QDPT PM+ +E   QLA  + +    ++N+TL  +   + SN    
Sbjct: 32  QNSFLTLLVAQLKNQDPTNPMENNELTTQLAQINTVSGIEKLNTTLGAITGQIDSNQSLY 91

Query: 82  ASSYIGKNI 90
           A+S IG+ +
Sbjct: 92  ATSLIGRGV 100


>gi|312968851|ref|ZP_07783058.1| basal-body rod modification protein flgD [Escherichia coli 2362-75]
 gi|312286253|gb|EFR14166.1| basal-body rod modification protein flgD [Escherichia coli 2362-75]
          Length = 231

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA+ S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLALISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|254563422|ref|YP_003070517.1| flagellar basal-body rod modification protein [Methylobacterium
           extorquens DM4]
 gi|254270700|emb|CAX26704.1| putative flagellar basal-body rod modification protein (Synonyms :
           FlgD flaV, fla FIV, fla FVI) [Methylobacterium
           extorquens DM4]
          Length = 226

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 50/79 (63%), Gaps = 4/79 (5%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KSNNLAQASS 84
           FL LL TQ+K+Q+P +P+  ++   QL  F+ +EQ ++ NS+L  +L   K+ + + AS 
Sbjct: 35  FLTLLTTQLKNQNPLDPLDTNQFTQQLVQFAGVEQQLKTNSSLDTILTNSKAASASSASG 94

Query: 85  YIGKNITNADGSISGVVNA 103
            IG+ IT ADG+ + + N 
Sbjct: 95  LIGRTIT-ADGAATDLTNG 112


>gi|15643438|ref|NP_228482.1| basal-body rod modification protein FlgD [Thermotoga maritima
          MSB8]
 gi|4981197|gb|AAD35757.1|AE001740_3 basal-body rod modification protein FlgD [Thermotoga maritima
          MSB8]
          Length = 224

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 47/72 (65%), Gaps = 3/72 (4%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK---SNNL 79
          L ++AFL+LL+ +++ QDP EPM+  + ++QL+  + +EQ   + S +++ ++   S + 
Sbjct: 27 LDKEAFLRLLLQELEMQDPLEPMETKDMISQLSQLTSLEQITNLTSAVKDFVEAQTSVSP 86

Query: 80 AQASSYIGKNIT 91
          AQ +S IGK + 
Sbjct: 87 AQLASLIGKYVV 98


>gi|315125983|ref|YP_004067986.1| LfgD [Pseudoalteromonas sp. SM9913]
 gi|315014497|gb|ADT67835.1| LfgD [Pseudoalteromonas sp. SM9913]
          Length = 217

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 54/87 (62%), Gaps = 13/87 (14%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME--QSVQMNSTLQELLKSNNLA--QAS 83
           FL+LL+ QI +Q+P +PM  ++ V+QLA FS +E  QS++ N T   L   ++LA  +A+
Sbjct: 33  FLELLVAQISNQNPLQPMDGTQYVSQLAEFSNVESLQSIRQN-TADGLDYVSSLAVLEAT 91

Query: 84  SYIGKNIT--------NADGSISGVVN 102
           + +G+ +           DGS+SG+VN
Sbjct: 92  NMVGQTVDVQASSIALEQDGSVSGMVN 118


>gi|260772273|ref|ZP_05881189.1| flagellar basal-body rod modification protein FlgD [Vibrio
           metschnikovii CIP 69.14]
 gi|260611412|gb|EEX36615.1| flagellar basal-body rod modification protein FlgD [Vibrio
           metschnikovii CIP 69.14]
          Length = 235

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 50/83 (60%), Gaps = 3/83 (3%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           Q++ +++  ++ L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN   
Sbjct: 24  QKKPTETTGQQELKQEDFLSLLTKQLAQQDPFKPVSNDQMIAQMASFATVDGIGKMNGQF 83

Query: 71  QEL---LKSNNLAQASSYIGKNI 90
           + L   + SN   QASS +G+++
Sbjct: 84  ESLNSAMTSNQALQASSLVGRDV 106


>gi|284989549|ref|YP_003408103.1| flagellar hook capping protein [Geodermatophilus obscurus DSM
           43160]
 gi|284062794|gb|ADB73732.1| flagellar hook capping protein [Geodermatophilus obscurus DSM
           43160]
          Length = 140

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 61/104 (58%), Gaps = 4/104 (3%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           +G+D FL+LL+ Q+++QDP  P   +E ++Q A F+Q+E+  ++ +    L+       A
Sbjct: 26  MGKDVFLQLLVAQMRYQDPNSPASTTEFMSQTATFTQVEKLEEIAAQNASLVALQRSLSA 85

Query: 83  SSYIGKNITNAD---GSISGVVNAIQVSSTGLTAITVDNTEIPI 123
            + +G  ++  D    +++G V ++++S    +A+ VD  ++PI
Sbjct: 86  GALVGHTVSYTDEGGVTVTGTVGSVRISGDEPSAV-VDGVDVPI 128


>gi|238751761|ref|ZP_04613249.1| Flagellar hook capping protein [Yersinia rohdei ATCC 43380]
 gi|238710032|gb|EEQ02262.1| Flagellar hook capping protein [Yersinia rohdei ATCC 43380]
          Length = 230

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q++FL LL+ Q+K+QDPT PM+ +E   QLA  + +    ++N+TL  +   L S+   Q
Sbjct: 34  QNSFLTLLVAQLKNQDPTNPMQNNELTTQLAQINTVSGIEKLNTTLGSISGQLDSSQSLQ 93

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 94  ASTLIGHGV 102


>gi|229017041|ref|ZP_04173961.1| Flagellar hook assembly protein [Bacillus cereus AH1273]
 gi|229023222|ref|ZP_04179733.1| Flagellar hook assembly protein [Bacillus cereus AH1272]
 gi|228738147|gb|EEL88632.1| Flagellar hook assembly protein [Bacillus cereus AH1272]
 gi|228744312|gb|EEL94394.1| Flagellar hook assembly protein [Bacillus cereus AH1273]
          Length = 192

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 68/139 (48%), Gaps = 10/139 (7%)

Query: 3   INTEVNPTQQEFSKSKS-KKTLG---QDAFLKLLITQIKHQDPTEPMKASE---QVAQLA 55
           +N   +P QQ    S S +KT G   +D FLKL +   +HQDP   M  ++   Q AQL+
Sbjct: 27  VNGVHSPVQQTNGVSASTQKTPGVMEKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLS 86

Query: 56  VFSQMEQSVQMNSTLQELLKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLT 112
           +  Q++   +   +L+  + S  L     ++GK +   DG    ++G V  ++++     
Sbjct: 87  LMEQVQNMTKAVDSLRTTMYSTALDGGMKFLGKYVRGIDGEGNKVTGQVETVRLAENNDV 146

Query: 113 AITVDNTEIPITTGIRISN 131
            + +DN  + +    RIS+
Sbjct: 147 QLVIDNKVVSLRFVERISD 165


>gi|242310748|ref|ZP_04809903.1| flagellar basal body rod modification protein [Helicobacter
           pullorum MIT 98-5489]
 gi|239523146|gb|EEQ63012.1| flagellar basal body rod modification protein [Helicobacter
           pullorum MIT 98-5489]
          Length = 379

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 35/51 (68%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
           LG +AF++L + Q+K+QDPT PM+  E + Q A  +Q+E   QM + ++++
Sbjct: 117 LGTEAFMRLFLEQLKNQDPTAPMETQEILTQTAQLTQVEAQTQMKNAMEQM 167


>gi|114765240|ref|ZP_01444372.1| Flagellar hook capping protein [Pelagibaca bermudensis HTCC2601]
 gi|114542375|gb|EAU45403.1| Flagellar hook capping protein [Roseovarius sp. HTCC2601]
          Length = 223

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 49/76 (64%), Gaps = 2/76 (2%)

Query: 15 SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
          S S S+ +   ++F+ LL  QI++Q+P EPM ++  ++QLA  SQ+EQSV +N  L+ + 
Sbjct: 19 SSSMSQLSEDYESFITLLTAQIQNQNPLEPMDSTTFISQLAQLSQVEQSVAVNDNLEGI- 77

Query: 75 KSNNLAQASSYIGKNI 90
           S+ L+  S+  G N+
Sbjct: 78 -SSQLSSMSAIAGLNL 92


>gi|254440284|ref|ZP_05053778.1| flagellar hook capping protein, putative [Octadecabacter
           antarcticus 307]
 gi|198255730|gb|EDY80044.1| flagellar hook capping protein, putative [Octadecabacter
           antarcticus 307]
          Length = 233

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (51%), Gaps = 11/97 (11%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ----- 71
           ++ K  LGQ  FLKL+  Q+++QDP  PM   + VAQ+A FS +    +MN T+      
Sbjct: 28  AEPKDELGQSDFLKLMTAQLQNQDPFAPMDNGDFVAQMAQFSSVAGISEMNQTMSSIAGQ 87

Query: 72  ----ELLKSNNLAQASSYIGKNITNAD--GSISGVVN 102
               ++  S N+   S  +  NI  AD  G I G ++
Sbjct: 88  MSQFQVASSVNMLGHSVMMPGNIARADNNGEIQGTLD 124


>gi|89092135|ref|ZP_01165090.1| basal-body rod modification protein FlgD [Oceanospirillum sp.
           MED92]
 gi|89083870|gb|EAR63087.1| basal-body rod modification protein FlgD [Oceanospirillum sp.
           MED92]
          Length = 235

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 45/71 (63%), Gaps = 8/71 (11%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME------QSVQMNSTLQELLKSNNL 79
           D F++L+I Q+++QDPT P   ++ + Q+A  SQ+E      Q+VQ  ST Q +L S   
Sbjct: 37  DMFMRLMIAQLQNQDPTSPADTNDFMQQIATMSQVESINNLTQTVQ--STSQSMLASQAA 94

Query: 80  AQASSYIGKNI 90
            QASS +G+++
Sbjct: 95  LQASSMVGQSV 105


>gi|224373465|ref|YP_002607837.1| flagellar hook capping protein [Nautilia profundicola AmH]
 gi|223589079|gb|ACM92815.1| flagellar hook capping protein [Nautilia profundicola AmH]
          Length = 223

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 16/90 (17%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           L +DAF+KL + +++ QDPT+PM   + + Q A  S ME +  M  +L  L  SN L+  
Sbjct: 25  LDKDAFMKLFLAELQMQDPTDPMDTDKMLEQTAYLSTMEMNDNMQKSLDNL--SNVLSTT 82

Query: 83  SSY-----IGK---------NITNADGSIS 98
           S +     IGK         N+T+ D S++
Sbjct: 83  SQFSTLSAIGKMADTGYRYVNVTDDDNSVN 112


>gi|157371208|ref|YP_001479197.1| flagellar basal body rod modification protein [Serratia
          proteamaculans 568]
 gi|157322972|gb|ABV42069.1| flagellar hook capping protein [Serratia proteamaculans 568]
          Length = 225

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQA 82
          ++FL LL+ Q+K+QDPT PM+ +E  +QLA  + ++   ++N+TL  +   + SN   QA
Sbjct: 30 NSFLTLLVAQLKNQDPTNPMQNNELTSQLAQINTVQGIEKLNTTLGSISGQINSNQSLQA 89

Query: 83 SSYIGKNI 90
          S+ IG  +
Sbjct: 90 SALIGHGV 97


>gi|223039165|ref|ZP_03609455.1| flagellar hook assembly protein [Campylobacter rectus RM3267]
 gi|222879526|gb|EEF14617.1| flagellar hook assembly protein [Campylobacter rectus RM3267]
          Length = 234

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           L +DAF+KLL+T++++QDPT PM   +   Q +QLA     E + +M   L + LK++  
Sbjct: 36  LDKDAFMKLLLTELQYQDPTSPMDTEKMLTQTSQLAALEMQENTNKMMQKLADQLKNSTN 95

Query: 80  AQASSYIGK 88
             A S +GK
Sbjct: 96  MYAVSVLGK 104


>gi|332161321|ref|YP_004297898.1| flagellar basal body rod modification protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318605241|emb|CBY26739.1| flagellar basal-body rod modification protein FlgD [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325665551|gb|ADZ42195.1| flagellar basal body rod modification protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330860607|emb|CBX70904.1| basal-body rod modification protein flgD [Yersinia enterocolitica
           W22703]
          Length = 228

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q++FL LL+ Q+K+QDPT PM+ +E   QLA  + +    ++N+TL  +   + ++   Q
Sbjct: 32  QNSFLTLLVAQLKNQDPTNPMQNNELTTQLAQINTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           ASS IG+ +
Sbjct: 92  ASSLIGRGV 100


>gi|218549197|ref|YP_002382988.1| flagellar basal body rod modification protein [Escherichia
           fergusonii ATCC 35469]
 gi|218356738|emb|CAQ89366.1| flagellar hook assembly protein [Escherichia fergusonii ATCC 35469]
          Length = 231

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGAISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           ASS IG  +
Sbjct: 92  ASSLIGHGV 100


>gi|119899028|ref|YP_934241.1| basal-body rod modification protein FlgD [Azoarcus sp. BH72]
 gi|119671441|emb|CAL95354.1| probable basal-body rod modification protein FlgD [Azoarcus sp.
           BH72]
          Length = 224

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 50/83 (60%), Gaps = 11/83 (13%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA---QASS 84
           FL LL TQ+++QDP  PM+ +E  +QLA  S +E   ++NS + +LL+S   A   QA++
Sbjct: 36  FLTLLTTQLQNQDPMNPMENAELTSQLAQLSTVEGIEKLNSMMTQLLQSQASAEGLQAAA 95

Query: 85  YI-------GKNITNAD-GSISG 99
            +       GKN+T  D G+I G
Sbjct: 96  LVGRGVLVEGKNLTLTDAGAIGG 118


>gi|114330360|ref|YP_746582.1| flagellar basal body rod modification protein [Nitrosomonas
           eutropha C91]
 gi|114307374|gb|ABI58617.1| flagellar hook capping protein [Nitrosomonas eutropha C91]
          Length = 223

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 47/69 (68%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA---Q 81
           Q+ FLKLL+TQ+++QDP  PM  +E  +Q+A  S +    ++NSTL++L+  ++     +
Sbjct: 32  QERFLKLLVTQMQNQDPLSPMDNAEVTSQMAQISTVSGIDKLNSTLEKLVSDSDARRSFE 91

Query: 82  ASSYIGKNI 90
           A++ IG+++
Sbjct: 92  AANMIGRSV 100


>gi|324113870|gb|EGC07844.1| flagellar hook capping protein [Escherichia fergusonii B253]
 gi|325497617|gb|EGC95476.1| flagellar basal body rod modification protein [Escherichia
           fergusonii ECD227]
          Length = 231

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGAISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           ASS IG  +
Sbjct: 92  ASSLIGHGV 100


>gi|90579908|ref|ZP_01235716.1| flagellar basal body rod modification protein [Vibrio angustum S14]
 gi|90438793|gb|EAS63976.1| flagellar basal body rod modification protein [Vibrio angustum S14]
          Length = 241

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 52/98 (53%), Gaps = 11/98 (11%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQELLK 75
            K  L QD FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN    +L   + 
Sbjct: 34  GKNQLKQDDFLSLLTKQLAQQDPFKPVSNDQMIAQMASFATVDGINKMNEQFGSLNSAMT 93

Query: 76  SNNLAQASSYIGKNI--------TNADGSISGVVNAIQ 105
           SN   QASS +G+++         +++G +SG+    Q
Sbjct: 94  SNQALQASSLVGQDVLIPNSTAMRSSEGEMSGMTRLTQ 131


>gi|92114099|ref|YP_574027.1| flagellar basal body rod modification protein [Chromohalobacter
           salexigens DSM 3043]
 gi|91797189|gb|ABE59328.1| flagellar hook capping protein [Chromohalobacter salexigens DSM
           3043]
          Length = 235

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQASS 84
           F+ LLITQ+++QDPT+PM  S+  AQLA  + +    ++N +L ++   + +    QASS
Sbjct: 41  FMTLLITQLQNQDPTKPMDNSDMTAQLAQINTVSGIQELNDSLGDINEQIDAGKTLQASS 100

Query: 85  YIGKNI 90
            IG+ +
Sbjct: 101 LIGQGV 106


>gi|89075494|ref|ZP_01161905.1| flagellar basal body rod modification protein [Photobacterium sp.
           SKA34]
 gi|89048766|gb|EAR54337.1| flagellar basal body rod modification protein [Photobacterium sp.
           SKA34]
          Length = 241

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 52/98 (53%), Gaps = 11/98 (11%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQELLK 75
            K  L QD FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN    +L   + 
Sbjct: 34  GKNQLKQDDFLSLLTKQLAQQDPFKPVSNDQMIAQMASFATVDGINKMNEQFGSLNSAMT 93

Query: 76  SNNLAQASSYIGKNI--------TNADGSISGVVNAIQ 105
           SN   QASS +G+++         +++G +SG+    Q
Sbjct: 94  SNQALQASSLVGQDVLIPNSTAMRSSEGEMSGMTRLTQ 131


>gi|313200564|ref|YP_004039222.1| flagellar hook capping protein [Methylovorus sp. MP688]
 gi|312439880|gb|ADQ83986.1| flagellar hook capping protein [Methylovorus sp. MP688]
          Length = 218

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KSNNLAQ 81
          QD F+ LLITQ+K QDP  PM  ++  +QLA  S +    ++N+T++ ++   +S+   Q
Sbjct: 27 QDRFMTLLITQMKSQDPLNPMDNAQVTSQLAQLSTVTGIDKLNTTMESMISNVQSSQTYQ 86

Query: 82 ASSYIGKNI 90
          AS+ IG+ +
Sbjct: 87 ASNMIGRYV 95


>gi|225159024|ref|ZP_03725334.1| flagellar hook capping protein [Opitutaceae bacterium TAV2]
 gi|224802403|gb|EEG20665.1| flagellar hook capping protein [Opitutaceae bacterium TAV2]
          Length = 144

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 49/88 (55%), Gaps = 2/88 (2%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           LGQ  F KLL  Q++ QDP  P+  ++ +AQLA FS + QS  + + +  L     +  A
Sbjct: 28  LGQADFFKLLSVQLQKQDPLNPVDDTQFLAQLAQFSALAQSEALVTQMGYLRADIQMQAA 87

Query: 83  SSYIGKNIT-NADGS-ISGVVNAIQVSS 108
           +  +GK +T  +DG  ++G V +I   S
Sbjct: 88  AGLVGKEVTVVSDGELVTGTVTSIAADS 115


>gi|293395582|ref|ZP_06639865.1| basal-body rod modification protein FlgD [Serratia odorifera DSM
           4582]
 gi|291421901|gb|EFE95147.1| basal-body rod modification protein FlgD [Serratia odorifera DSM
           4582]
          Length = 229

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
            ++FL LL+ Q+K+QDPT PM+ +E  +QLA  + +    ++N+TL  +   + SN   Q
Sbjct: 33  HNSFLTLLVAQLKNQDPTNPMQNNELTSQLAQINTVSGIEKLNTTLGAISGQINSNQSLQ 92

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 93  ASALIGHGV 101


>gi|254456986|ref|ZP_05070414.1| flagellar hook capping protein [Campylobacterales bacterium GD 1]
 gi|207085778|gb|EDZ63062.1| flagellar hook capping protein [Campylobacterales bacterium GD 1]
          Length = 221

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 43/72 (59%), Gaps = 3/72 (4%)

Query: 20 KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
          K  LG+D F+ LL+ +++HQDPTEPM + + + Q +  + +E +   N  L+ L  S + 
Sbjct: 25 KTVLGKDDFMTLLLVELQHQDPTEPMDSEKILTQTSQLAGLESAENTNKALESLAASLSA 84

Query: 80 AQ---ASSYIGK 88
          +Q   + S IGK
Sbjct: 85 SQNFSSISAIGK 96


>gi|330445347|ref|ZP_08308999.1| flagellar hook capping family protein [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489538|dbj|GAA03496.1| flagellar hook capping family protein [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 241

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 3/75 (4%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQELLK 75
            K  L QD FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN    +L   + 
Sbjct: 34  GKNQLKQDDFLSLLTKQLAQQDPFKPVGNDQMIAQMASFATVDGINKMNEQFGSLNSAMT 93

Query: 76  SNNLAQASSYIGKNI 90
           SN   QASS +G+++
Sbjct: 94  SNQALQASSLVGQDV 108


>gi|163856434|ref|YP_001630732.1| flagellar basal body rod modification protein [Bordetella petrii
          DSM 12804]
 gi|163260162|emb|CAP42464.1| basal-body rod modification protein FlgD [Bordetella petrii]
          Length = 231

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ--- 81
          QD FL LL+TQ+K+QDP  PM+ +E  +QLA  S +E    + +TL  +    +++Q   
Sbjct: 29 QDRFLTLLVTQLKNQDPLNPMENAELTSQLAQISTVEGITNLKNTLLAISGQIDVSQSMN 88

Query: 82 ASSYIGKNI 90
          A S IGK +
Sbjct: 89 AVSMIGKGV 97


>gi|260438801|ref|ZP_05792617.1| flagellar hook capping protein [Butyrivibrio crossotus DSM 2876]
 gi|292808790|gb|EFF67995.1| flagellar hook capping protein [Butyrivibrio crossotus DSM 2876]
          Length = 149

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 52/92 (56%), Gaps = 7/92 (7%)

Query: 8  NPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN 67
          N T  + +K     +L +DAFL++L  ++++QDP EP   +E V+Q++ FSQ+E      
Sbjct: 15 NYTDGKANKKTGSDSLNKDAFLQILAAEMQYQDPLEPSSNTEWVSQMSSFSQIE------ 68

Query: 68 STLQELLKSNNLAQASSYIGKNITNADGSISG 99
           +LQ +  S +   AS+ +GK +   D   +G
Sbjct: 69 -SLQTVSDSISEQGASNLVGKRVILEDTDSAG 99


>gi|317406202|gb|EFV86451.1| basal-body rod modification protein FlgD [Achromobacter
          xylosoxidans C54]
          Length = 231

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ--- 81
          QD FLKLL+TQ+K+QDP  PM+ +E  +QLA  S +E    + +T+  +    +++Q   
Sbjct: 30 QDQFLKLLVTQLKNQDPLNPMQNAELTSQLAQISTVEGITNLKNTMLAISGQIDVSQSMN 89

Query: 82 ASSYIGKNI 90
          A + IGK +
Sbjct: 90 AVAMIGKGV 98


>gi|294635609|ref|ZP_06714086.1| flagellar basal-body rod modification protein FlgD [Edwardsiella
           tarda ATCC 23685]
 gi|291091061|gb|EFE23622.1| flagellar basal-body rod modification protein FlgD [Edwardsiella
           tarda ATCC 23685]
          Length = 232

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FL LL+ Q+++QDPT P++ +E   QLA  S +    ++N+TL  +   + SN   Q
Sbjct: 34  QNNFLTLLVAQLRNQDPTNPLQNNELTTQLAQISTVSGIEKLNTTLGSISGQINSNQSLQ 93

Query: 82  ASSYIGKNI 90
           ASS IG  +
Sbjct: 94  ASSLIGHGV 102


>gi|170751442|ref|YP_001757702.1| flagellar hook capping protein [Methylobacterium radiotolerans JCM
           2831]
 gi|170657964|gb|ACB27019.1| flagellar hook capping protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 228

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 48/74 (64%), Gaps = 4/74 (5%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KSNNLAQASS 84
           FL LL TQ+K+Q+P +PM  ++   QL  F+ +EQ ++ N  L  +L   +S + A A+S
Sbjct: 35  FLTLLTTQLKNQNPLDPMDTNQFTQQLVQFAGVEQQLKTNDRLDSILSASQSASSASATS 94

Query: 85  YIGKNITNADGSIS 98
           YIGK ++ ADGS S
Sbjct: 95  YIGKTVS-ADGSAS 107


>gi|4378859|gb|AAD19727.1| basal-body rod modification protein [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 230

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 49/84 (58%), Gaps = 10/84 (11%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST---LQELLKSNNLAQASS 84
           FL LL TQ+K+QDP  P+  ++  A +A FS +    Q+N+T   +Q  + ++ L   S+
Sbjct: 42  FLTLLTTQLKYQDPDSPVDNTQMAAPMAQFSSVAGINQLNTTVSSIQSDVSNSRLGNVSN 101

Query: 85  YIGK------NI-TNADGSISGVV 101
           +IGK      NI T+ DG+ +G V
Sbjct: 102 WIGKAGLVSSNIATSIDGTFAGQV 125


>gi|145298490|ref|YP_001141331.1| flagellar hook capping protein FlgD [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851262|gb|ABO89583.1| flagellar hook capping protein FlgD [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 242

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 13/94 (13%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ----SVQMNSTLQELLK 75
           KK L Q +FLKLL  Q+ +QDP +P+  ++ ++Q+   S  E     S QM + L  L+ 
Sbjct: 25  KKELDQASFLKLLTMQLSYQDPFKPVDNAQMLSQMTSMSTSEGINSLSTQMGN-LNTLMT 83

Query: 76  SNNLAQASSYIGKNI---TNA-----DGSISGVV 101
           S+   QAS+ +G+N+   +N      +GSI GVV
Sbjct: 84  SSQALQASALVGQNVLLQSNVGFLENEGSIGGVV 117


>gi|226314864|ref|YP_002774760.1| hypothetical protein BBR47_52790 [Brevibacillus brevis NBRC
          100599]
 gi|226097814|dbj|BAH46256.1| hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 310

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 7/75 (9%)

Query: 8  NPTQQEFSKSKSKKT----LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
          NP  Q     K KK     L Q+AF+KL++ Q+KHQDP  PM  S+ + Q ++ + +E+ 
Sbjct: 11 NPYIQPHMSYKGKKEFSTELDQNAFMKLMLEQLKHQDPMSPMDNSQFIQQTSMLTMVEKI 70

Query: 64 VQMNSTLQELLKSNN 78
           +M +TL E  +SNN
Sbjct: 71 TKM-TTLME--QSNN 82


>gi|300311351|ref|YP_003775443.1| flagellar basal-body rod modification protein [Herbaspirillum
           seropedicae SmR1]
 gi|300074136|gb|ADJ63535.1| flagellar basal-body rod modification protein [Herbaspirillum
           seropedicae SmR1]
          Length = 240

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA-- 82
           Q+ FL LL+ Q+K+QDP  PM  S+  +Q+A  S +    Q+NSTL  L+ + N +QA  
Sbjct: 36  QNRFLTLLMAQMKNQDPNNPMDNSQLTSQMAQLSTVSGISQLNSTLATLMGNLNSSQALS 95

Query: 83  -SSYIGKNI 90
            ++ IG ++
Sbjct: 96  SANMIGHSV 104


>gi|183598616|ref|ZP_02960109.1| hypothetical protein PROSTU_02016 [Providencia stuartii ATCC 25827]
 gi|188020795|gb|EDU58835.1| hypothetical protein PROSTU_02016 [Providencia stuartii ATCC 25827]
          Length = 279

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 47/78 (60%), Gaps = 3/78 (3%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQE 72
           K+KS+    +D FLK+++TQ+++QDPT+PM+ +E   Q+AQ+A    M +     S +  
Sbjct: 28  KNKSQTDDMRDTFLKMIVTQMQNQDPTKPMENAELTSQLAQIATLESMNKLSDKVSGISS 87

Query: 73  LLKSNNLAQASSYIGKNI 90
            + S    QA+  +GK +
Sbjct: 88  QIGSGQSLQATQLVGKGV 105


>gi|226327747|ref|ZP_03803265.1| hypothetical protein PROPEN_01620 [Proteus penneri ATCC 35198]
 gi|225203451|gb|EEG85805.1| hypothetical protein PROPEN_01620 [Proteus penneri ATCC 35198]
          Length = 270

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 5/85 (5%)

Query: 9  PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
          P+     KS S+   G   FL LLITQ+K+QDPT PM+ +E  +QLA  S +E    +N 
Sbjct: 14 PSSYHTKKSGSEDIKGN--FLTLLITQMKNQDPTNPMQNNELTSQLAQISTVEGIETLNK 71

Query: 69 TLQELLKSNNLAQ---ASSYIGKNI 90
          T+  ++   + +Q   ASS +G  +
Sbjct: 72 TVNNIVGQIDQSQALRASSLVGHGV 96


>gi|51246515|ref|YP_066399.1| basal-body rod modification protein FlgD [Desulfotalea psychrophila
           LSv54]
 gi|50877552|emb|CAG37392.1| related to basal-body rod modification protein (FlgD) [Desulfotalea
           psychrophila LSv54]
          Length = 248

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 5/78 (6%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL-- 74
           S    T+G+  FL LL+ Q+++QDP  P + +E  AQLA FS +EQ + +N  +  ++  
Sbjct: 26  SGKNSTMGKQEFLTLLVAQLQNQDPLNPDEGTEFTAQLAQFSSLEQLMSINKGMGNMITS 85

Query: 75  --KSNNLAQASSYIGKNI 90
              S+N+A  ++ IGK +
Sbjct: 86  TSNSDNIALLNT-IGKEV 102


>gi|117619792|ref|YP_857344.1| flagellar hook capping protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117561199|gb|ABK38147.1| flagellar hook capping protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 242

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 52/93 (55%), Gaps = 11/93 (11%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQELLKS 76
           KK L Q++FLKLL  Q+ +QDP +P+  ++ ++Q+   S  +    ++    +L  L+ S
Sbjct: 26  KKELDQESFLKLLTMQLSYQDPFKPVDNAQMLSQMTSMSTSQGISSLSNQIGSLNSLMTS 85

Query: 77  NNLAQASSYIGKNI--------TNADGSISGVV 101
           +   QAS+ +G+N+           DGS+ GVV
Sbjct: 86  SQALQASALVGQNVLLQSNVGYLEKDGSLPGVV 118


>gi|293605002|ref|ZP_06687398.1| flagellar hook assembly protein FlgD [Achromobacter piechaudii
          ATCC 43553]
 gi|292816607|gb|EFF75692.1| flagellar hook assembly protein FlgD [Achromobacter piechaudii
          ATCC 43553]
          Length = 232

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ--- 81
          QD FLKLL TQ+++QDP  PM+ +E  +QLA  + +E    + ST+Q +    +++Q   
Sbjct: 30 QDQFLKLLTTQLQNQDPLNPMQNAELTSQLAQIATVEGISNLKSTIQAISGQIDVSQSMN 89

Query: 82 ASSYIGKNI 90
          A S IGK +
Sbjct: 90 AVSMIGKGV 98


>gi|317492429|ref|ZP_07950858.1| flagellar hook capping protein [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919768|gb|EFV41098.1| flagellar hook capping protein [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 233

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQA 82
           ++FL LL+ Q+K+QDPT P++ +E  +QLA  + +    ++N+TL  +   + SN   QA
Sbjct: 36  NSFLTLLVAQLKNQDPTNPLQNNELTSQLAQINTVSGIEKLNTTLGSISGQINSNQSLQA 95

Query: 83  SSYIGKNI 90
           SS IG  +
Sbjct: 96  SSLIGHGV 103


>gi|91224200|ref|ZP_01259463.1| flagellar basal-body rod modification protein D [Vibrio
           alginolyticus 12G01]
 gi|91191111|gb|EAS77377.1| flagellar basal-body rod modification protein D [Vibrio
           alginolyticus 12G01]
          Length = 227

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 46/74 (62%), Gaps = 4/74 (5%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE---LLKSNNLAQ 81
           ++ F+ L++ QI++QDP  P+  +E V QLA FSQ++ +  M+ T+Q+   LL +  +  
Sbjct: 39  ENEFISLMVAQIQNQDPLNPLDGTEYVGQLAQFSQVQSTENMSKTMQQSMVLLDNMQVLS 98

Query: 82  ASSYIGKNI-TNAD 94
            +  +G+ +  NAD
Sbjct: 99  TAGLVGQTVYVNAD 112


>gi|269965643|ref|ZP_06179756.1| Flagellar basal-body rod modification protein flgD [Vibrio
           alginolyticus 40B]
 gi|269829711|gb|EEZ83947.1| Flagellar basal-body rod modification protein flgD [Vibrio
           alginolyticus 40B]
          Length = 227

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 46/74 (62%), Gaps = 4/74 (5%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE---LLKSNNLAQ 81
           ++ F+ L++ QI++QDP  P+  +E V QLA FSQ++ +  M+ T+Q+   LL +  +  
Sbjct: 39  ENEFISLMVAQIQNQDPLNPLDGTEYVGQLAQFSQVQSTENMSKTMQQSMVLLDNMQVLS 98

Query: 82  ASSYIGKNI-TNAD 94
            +  +G+ +  NAD
Sbjct: 99  TAGLVGQTVYVNAD 112


>gi|253990128|ref|YP_003041484.1| flagellar basal body rod modification protein [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|211639035|emb|CAR67649.1| basal-body rod modification protein flgd (flagellar protein for th
           initiation of hook assembly) [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253781578|emb|CAQ84741.1| basal-body rod modification protein flgd (flagellar protein for th
           initiation of hook assembly) [Photorhabdus asymbiotica]
          Length = 232

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (57%), Gaps = 14/85 (16%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQASS 84
           F++LLI Q+K+QDPT PM+ +E  A LA  + +E   ++N+T+  +   + +N   Q S+
Sbjct: 37  FMQLLIAQVKNQDPTNPMQNNELTAHLAQINMLEGIEKLNTTVGSIVGQINNNQSLQVSA 96

Query: 85  YIGKNI----------TN-ADGSIS 98
            IG+ +          TN  DGSIS
Sbjct: 97  LIGRGVMIPGDTILVGTNEKDGSIS 121


>gi|300114800|ref|YP_003761375.1| flagellar hook capping protein [Nitrosococcus watsonii C-113]
 gi|299540737|gb|ADJ29054.1| flagellar hook capping protein [Nitrosococcus watsonii C-113]
          Length = 226

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 50/90 (55%), Gaps = 11/90 (12%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNL 79
           LG + FLKL+  Q+ +QDP +PM  S  ++Q+A F  ++    + ++ +E+   L+SN  
Sbjct: 30  LGLEQFLKLMTAQLNNQDPFKPMDNSTFLSQVAQFGTVKGIQDLQTSFKEVSGSLQSNQA 89

Query: 80  AQASSYIGKNI--------TNADGSISGVV 101
            QAS  +G+++          A GSI G V
Sbjct: 90  LQASGLVGRSVLVPSAEGSLEAGGSIRGAV 119


>gi|311992299|gb|ADQ26723.1| hook capping protein [Aeromonas hydrophila]
          Length = 241

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 52/93 (55%), Gaps = 11/93 (11%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQELLKS 76
           KK L Q++FLKLL  Q+ +QDP +P+  ++ ++Q+   S  +    ++    +L  L+ S
Sbjct: 25  KKELDQESFLKLLTMQLSYQDPFKPVDNAQMLSQMTSMSTSQGISSLSNQIGSLNSLMTS 84

Query: 77  NNLAQASSYIGKNI--------TNADGSISGVV 101
           +   QAS+ +G+N+           DGS+ GVV
Sbjct: 85  SQALQASALVGQNVLLQSNVGYLEKDGSLQGVV 117


>gi|307719962|ref|YP_003891102.1| flagellar hook capping protein [Sulfurimonas autotrophica DSM
          16294]
 gi|306978055|gb|ADN08090.1| flagellar hook capping protein [Sulfurimonas autotrophica DSM
          16294]
          Length = 220

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (59%)

Query: 20 KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
          K  LG+D F+KLL+ Q+++QDPTEPM   + + Q +  + +E +    + L++L  S   
Sbjct: 24 KGVLGKDDFMKLLLVQLQYQDPTEPMDTEKILTQTSQLASLESADNTKTALEKLAASLGN 83

Query: 80 AQASSYI 86
          AQ  S I
Sbjct: 84 AQQFSTI 90


>gi|206603147|gb|EDZ39627.1| Probable flagellar hook capping protein FlgD [Leptospirillum sp.
           Group II '5-way CG']
          Length = 276

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 52/99 (52%), Gaps = 10/99 (10%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN-- 77
           ++ LG   FL L+I+Q+++QDP  P+  +   AQLA FSQ++Q   +N  +  +      
Sbjct: 30  RQKLGMGDFLHLMISQLQYQDPLHPLNNTRFAAQLAQFSQLDQLTHLNRGVGTIAHDGAD 89

Query: 78  -NLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAIT 115
            N      ++G+ +T     + G  NA ++  +G  ++T
Sbjct: 90  ANKMMMVGFLGQRVT-----MKG--NAFRLDPSGNVSLT 121


>gi|149908760|ref|ZP_01897421.1| LfgD [Moritella sp. PE36]
 gi|149808302|gb|EDM68241.1| LfgD [Moritella sp. PE36]
          Length = 218

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 52/87 (59%), Gaps = 6/87 (6%)

Query: 8  NPTQQEFSKSKSKKTLG-QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQM 66
          NP Q   S+  +   LG ++ FL++++ QIK+QDP +P+  +E V+QLA FS +E    +
Sbjct: 11 NPAQT--SEVTANSALGLKNEFLQMMVAQIKNQDPLDPLDGTEYVSQLAQFSMVEGVEGL 68

Query: 67 N---STLQELLKSNNLAQASSYIGKNI 90
              S+  E+L +  + Q+++ IG  +
Sbjct: 69 RAGQSSQAEMLYTQQVLQSTALIGTTV 95


>gi|239995126|ref|ZP_04715650.1| flagellar basal body rod modification protein [Alteromonas
           macleodii ATCC 27126]
 gi|332140545|ref|YP_004426283.1| flagellar basal body rod modification protein [Alteromonas
           macleodii str. 'Deep ecotype']
 gi|327550567|gb|AEA97285.1| flagellar basal body rod modification protein [Alteromonas
           macleodii str. 'Deep ecotype']
          Length = 228

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 12/95 (12%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LK 75
           +++ L Q+ F  +L  Q+ +QDPT P+   + VAQ+  F+  +   Q+N   +     + 
Sbjct: 26  TEQQLTQEDFFSMLTEQLANQDPTAPVDNDQMVAQMTSFTMADGISQLNEKFESFAASMT 85

Query: 76  SNNLAQASSYIGKNI---------TNADGSISGVV 101
           SN   QASS IG+N+          N    ISGV+
Sbjct: 86  SNQALQASSLIGQNVLVQGNVGYMANEGDGISGVI 120


>gi|261821152|ref|YP_003259258.1| flagellar basal body rod modification protein [Pectobacterium
           wasabiae WPP163]
 gi|261605165|gb|ACX87651.1| flagellar hook capping protein [Pectobacterium wasabiae WPP163]
          Length = 224

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FL LL+ Q+K+QDPT PM   + V+QLA  + +    ++N+TL  +   + +N   Q
Sbjct: 32  QNQFLTLLVAQLKNQDPTNPMSNDQLVSQLAQLNTVSGIEKLNTTLGSISGQINNNQSMQ 91

Query: 82  ASSYIGKNI 90
           A++ IG+++
Sbjct: 92  ATTLIGRSV 100


>gi|152979993|ref|YP_001353110.1| flagellar basal body rod modification protein [Janthinobacterium
           sp. Marseille]
 gi|151280070|gb|ABR88480.1| FlgD flagellar hook capping protein [Janthinobacterium sp.
           Marseille]
          Length = 225

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 3/76 (3%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL--- 74
           KS     QD FLKLL+TQ+++QDP  P+  ++  +QLA  S +    ++N TL+ L+   
Sbjct: 27  KSTAEEAQDRFLKLLVTQMQNQDPLNPLDNAQVTSQLAQLSTVTGIDKLNGTLESLMGNY 86

Query: 75  KSNNLAQASSYIGKNI 90
           +S  L QAS+ I   +
Sbjct: 87  QSAQLLQASNMIDHGV 102


>gi|188534171|ref|YP_001907968.1| flagellar basal body rod modification protein [Erwinia
          tasmaniensis Et1/99]
 gi|188029213|emb|CAO97085.1| Flagellar biosynthesis, initiation of hook assembly [Erwinia
          tasmaniensis Et1/99]
          Length = 223

 Score = 48.1 bits (113), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
          Q  FL LL+TQ+K+QDPT PM  S+   QLA  + +    ++N+TL  +   + S    Q
Sbjct: 31 QGNFLTLLVTQLKNQDPTNPMDNSQLTTQLAQINTLSGVEKLNTTLGSISGQITSGQSLQ 90

Query: 82 ASSYIGKNI 90
          AS+ IG  +
Sbjct: 91 ASTLIGHGV 99


>gi|28211325|ref|NP_782269.1| putative basal-body rod modification protein flgD [Clostridium
           tetani E88]
 gi|28203765|gb|AAO36206.1| putative basal-body rod modification protein flgD [Clostridium
           tetani E88]
          Length = 174

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 47/87 (54%), Gaps = 16/87 (18%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           L ++AFL++L  ++ HQDP      +E V Q+A F+ +EQ   +N+T++        A A
Sbjct: 32  LDKNAFLRILAAELSHQDPLSAKDGTEFVTQMAQFTSIEQMSNLNNTMR-------FAGA 84

Query: 83  SSYIGKN--ITNAD-------GSISGV 100
           +S IGK   + N D       G I+GV
Sbjct: 85  TSLIGKYAMVNNTDTYGNLYHGVITGV 111


>gi|73539449|ref|YP_299816.1| flagellar basal body rod modification protein [Ralstonia eutropha
           JMP134]
 gi|72122786|gb|AAZ64972.1| Flagellar hook capping protein [Ralstonia eutropha JMP134]
          Length = 226

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 46/79 (58%), Gaps = 4/79 (5%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           S S S   L Q  FLK+L+TQ+ +QDP  PM  ++  +QLA  S +     MNSTL +LL
Sbjct: 25  SGSASAADL-QSNFLKMLVTQMNNQDPLNPMDNAQLTSQLAQISTVSSMQTMNSTLTQLL 83

Query: 75  KSNNLAQA---SSYIGKNI 90
              + ++A   ++ IG+ +
Sbjct: 84  NQTSASRAMDSAALIGRTV 102


>gi|288940408|ref|YP_003442648.1| flagellar hook capping protein [Allochromatium vinosum DSM 180]
 gi|288895780|gb|ADC61616.1| flagellar hook capping protein [Allochromatium vinosum DSM 180]
          Length = 236

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 46/79 (58%), Gaps = 3/79 (3%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           S       LGQ  FLKL+ITQ+ +QDPT P++  +  +Q+A FS +    ++ S+ + L 
Sbjct: 32  STGSGNNALGQSDFLKLMITQLTNQDPTNPVENEDFASQMAQFSTLTGIEELTSSFETLS 91

Query: 75  KS---NNLAQASSYIGKNI 90
           K+       +A++ +G+++
Sbjct: 92  KTLLQGQTVEAATLVGQSV 110


>gi|196033351|ref|ZP_03100763.1| flagellar hook capping protein [Bacillus cereus W]
 gi|195993785|gb|EDX57741.1| flagellar hook capping protein [Bacillus cereus W]
          Length = 190

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 57/123 (46%), Gaps = 6/123 (4%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST---LQ 71
           S  K+   + +D FLKL +   KHQDP   M  ++ + Q A  S MEQ   M      LQ
Sbjct: 43  STQKTPGIMDKDDFLKLFLASFKHQDPFNAMDMNQMMNQTAQLSLMEQVNNMTKAVDKLQ 102

Query: 72  ELLKSNNLAQASSYIGK---NITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
             + S  L     ++GK    ++N    ++G V  ++++      + VDN  + +    R
Sbjct: 103 STMYSTALDGGMKFLGKYVRGVSNNGKQVTGQVETVRLAENNDVQLIVDNQVVSLRFIER 162

Query: 129 ISN 131
           +S+
Sbjct: 163 VSD 165


>gi|84514834|ref|ZP_01002197.1| Flagellar scaffolding protein FlgD [Loktanella vestfoldensis SKA53]
 gi|84510993|gb|EAQ07447.1| Flagellar scaffolding protein FlgD [Loktanella vestfoldensis SKA53]
          Length = 233

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 11/93 (11%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKS 76
           K+ LGQ  FLKL+  Q+++QDP  PM   + +AQ+A FS +    +M+ T+  +   +  
Sbjct: 31  KEELGQTDFLKLMTAQLQNQDPFAPMDNGDFIAQMAQFSSVAGISKMSETMSGIADQMGQ 90

Query: 77  NNLAQASSYIGK------NITNAD--GSISGVV 101
             +A + +Y+G       N+  AD  G I G +
Sbjct: 91  FRVASSVNYLGHSVMIPGNLARADDNGEIHGAI 123


>gi|290474971|ref|YP_003467855.1| flagellar initiation of hook assembly [Xenorhabdus bovienii
           SS-2004]
 gi|289174288|emb|CBJ81078.1| flagellar biosynthesis; initiation of hook assembly [Xenorhabdus
           bovienii SS-2004]
          Length = 231

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 53/106 (50%), Gaps = 7/106 (6%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           +D FL LL+ Q+K+QDPT PM+ +E   QLA  S ++   ++N TL  +   ++ N   Q
Sbjct: 34  KDNFLNLLVAQLKNQDPTNPMQNNELTTQLAQISTVQGVEKLNKTLGAVVGQMEGNQAMQ 93

Query: 82  ASSYIGKNITNADGSI---SGVVNAIQVSSTGLTAIT-VDNTEIPI 123
            +  IG+ +      I   SG  N I  S  G       DN +I I
Sbjct: 94  TTMLIGRTVMIPGDKILVGSGEENGISTSPFGFELTRPADNIKITI 139


>gi|50120638|ref|YP_049805.1| flagellar basal body rod modification protein [Pectobacterium
           atrosepticum SCRI1043]
 gi|49611164|emb|CAG74610.1| basal-body rod modification protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 224

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FL LL+ Q+K+QDPT PM   + V+QLA  + +    ++N+TL  +   + +N   Q
Sbjct: 32  QNQFLTLLVAQLKNQDPTNPMSNDQLVSQLAQLNTVSGIEKLNTTLGSISGQINNNQSMQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG ++
Sbjct: 92  ASTLIGHSV 100


>gi|109947807|ref|YP_665035.1| flagellar basal body rod modification protein [Helicobacter
          acinonychis str. Sheeba]
 gi|109715028|emb|CAK00036.1| flagellar hook assembly protein [Helicobacter acinonychis str.
          Sheeba]
          Length = 292

 Score = 48.1 bits (113), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L +DAF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKDAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|218704483|ref|YP_002412002.1| flagellar basal body rod modification protein [Escherichia coli
           UMN026]
 gi|293404359|ref|ZP_06648353.1| basal-body rod modification protein flgD [Escherichia coli
           FVEC1412]
 gi|298380139|ref|ZP_06989744.1| basal-body rod modification protein flgD [Escherichia coli
           FVEC1302]
 gi|300899594|ref|ZP_07117833.1| flagellar hook capping protein [Escherichia coli MS 198-1]
 gi|331672595|ref|ZP_08373384.1| basal-body rod modification protein FlgD [Escherichia coli TA280]
 gi|331682577|ref|ZP_08383196.1| basal-body rod modification protein FlgD [Escherichia coli H299]
 gi|218431580|emb|CAR12459.1| flagellar hook assembly protein [Escherichia coli UMN026]
 gi|291428945|gb|EFF01970.1| basal-body rod modification protein flgD [Escherichia coli
           FVEC1412]
 gi|298279837|gb|EFI21345.1| basal-body rod modification protein flgD [Escherichia coli
           FVEC1302]
 gi|300356865|gb|EFJ72735.1| flagellar hook capping protein [Escherichia coli MS 198-1]
 gi|331070238|gb|EGI41604.1| basal-body rod modification protein FlgD [Escherichia coli TA280]
 gi|331080208|gb|EGI51387.1| basal-body rod modification protein FlgD [Escherichia coli H299]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|331646333|ref|ZP_08347436.1| basal-body rod modification protein FlgD [Escherichia coli M605]
 gi|330910889|gb|EGH39399.1| flagellar basal-body rod modification protein FlgD [Escherichia
           coli AA86]
 gi|331045085|gb|EGI17212.1| basal-body rod modification protein FlgD [Escherichia coli M605]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|285018210|ref|YP_003375921.1| flagellar hook capping protein flgd [Xanthomonas albilineans GPE
           PC73]
 gi|283473428|emb|CBA15933.1| probable flagellar hook capping protein flgd [Xanthomonas
           albilineans]
          Length = 226

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 58/107 (54%), Gaps = 14/107 (13%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNL 79
           L Q  FLKL+  Q++HQDP +PM  S+ V+Q+A  S ++    +N T+  L   + ++ +
Sbjct: 32  LKQADFLKLMTEQLQHQDPLKPMDNSQMVSQMAQLSTVQGIGDLNKTVTALSASMSTDQV 91

Query: 80  AQASSYIGKNI--------TNADGSISGVVNAIQVSSTGLTAITVDN 118
            + ++ IG  +          +DG+  G+V A   +S G+  +TV +
Sbjct: 92  LRGANLIGHKVLVPSASLPLGSDGAAGGMVAA---TSAGVVNLTVSD 135


>gi|168790010|ref|ZP_02815017.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC869]
 gi|261227020|ref|ZP_05941301.1| flagellar basal body rod modification protein [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261256254|ref|ZP_05948787.1| flagellar basal body rod modification protein [Escherichia coli
           O157:H7 str. FRIK966]
 gi|189370461|gb|EDU88877.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC869]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|170682037|ref|YP_001744105.1| flagellar basal body rod modification protein [Escherichia coli
           SMS-3-5]
 gi|170519755|gb|ACB17933.1| flagellar hook capping protein FlgD [Escherichia coli SMS-3-5]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|218700422|ref|YP_002408051.1| flagellar basal body rod modification protein [Escherichia coli
           IAI39]
 gi|300938640|ref|ZP_07153369.1| flagellar hook capping protein [Escherichia coli MS 21-1]
 gi|218370408|emb|CAR18215.1| flagellar hook assembly protein [Escherichia coli IAI39]
 gi|300456425|gb|EFK19918.1| flagellar hook capping protein [Escherichia coli MS 21-1]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|82777310|ref|YP_403659.1| flagellar basal body rod modification protein [Shigella dysenteriae
           Sd197]
 gi|309788142|ref|ZP_07682748.1| basal-body rod modification protein flgD [Shigella dysenteriae
           1617]
 gi|81241458|gb|ABB62168.1| initiation of hook assembly [Shigella dysenteriae Sd197]
 gi|308923994|gb|EFP69495.1| basal-body rod modification protein flgD [Shigella dysenteriae
           1617]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|26247215|ref|NP_753255.1| flagellar basal body rod modification protein [Escherichia coli
           CFT073]
 gi|227886567|ref|ZP_04004372.1| flagellar basal body rod modification protein [Escherichia coli
           83972]
 gi|300974379|ref|ZP_07172591.1| flagellar hook capping protein [Escherichia coli MS 45-1]
 gi|301051141|ref|ZP_07197971.1| flagellar hook capping protein [Escherichia coli MS 185-1]
 gi|26107616|gb|AAN79815.1|AE016759_89 Basal-body rod modification protein flgD [Escherichia coli CFT073]
 gi|227836771|gb|EEJ47237.1| flagellar basal body rod modification protein [Escherichia coli
           83972]
 gi|300297162|gb|EFJ53547.1| flagellar hook capping protein [Escherichia coli MS 185-1]
 gi|300410622|gb|EFJ94160.1| flagellar hook capping protein [Escherichia coli MS 45-1]
 gi|307553077|gb|ADN45852.1| flagellar hook capping protein FlgD [Escherichia coli ABU 83972]
 gi|315291069|gb|EFU50432.1| flagellar hook capping protein [Escherichia coli MS 153-1]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|222032828|emb|CAP75567.1| Basal-body rod modification protein flgD [Escherichia coli LF82]
 gi|312945637|gb|ADR26464.1| flagellar basal body rod modification protein [Escherichia coli
           O83:H1 str. NRG 857C]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|188492655|ref|ZP_02999925.1| flagellar hook capping protein FlgD [Escherichia coli 53638]
 gi|188487854|gb|EDU62957.1| flagellar hook capping protein FlgD [Escherichia coli 53638]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|187732739|ref|YP_001880753.1| flagellar basal body rod modification protein [Shigella boydii CDC
           3083-94]
 gi|187429731|gb|ACD09005.1| flagellar hook capping protein FlgD [Shigella boydii CDC 3083-94]
 gi|320173528|gb|EFW48724.1| Flagellar basal-body rod modification protein FlgD [Shigella
           dysenteriae CDC 74-1112]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|323947623|gb|EGB43627.1| flagellar hook capping protein [Escherichia coli H120]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|15830707|ref|NP_309480.1| flagellar basal body rod modification protein [Escherichia coli
           O157:H7 str. Sakai]
 gi|91210227|ref|YP_540213.1| flagellar basal body rod modification protein [Escherichia coli
           UTI89]
 gi|110641251|ref|YP_668981.1| flagellar basal body rod modification protein [Escherichia coli
           536]
 gi|117623261|ref|YP_852174.1| flagellar basal body rod modification protein [Escherichia coli
           APEC O1]
 gi|157160602|ref|YP_001457920.1| flagellar basal body rod modification protein [Escherichia coli HS]
 gi|168747149|ref|ZP_02772171.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4113]
 gi|168758632|ref|ZP_02783639.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4401]
 gi|168764487|ref|ZP_02789494.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4501]
 gi|168767734|ref|ZP_02792741.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4486]
 gi|168773920|ref|ZP_02798927.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783605|ref|ZP_02808612.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4076]
 gi|168802020|ref|ZP_02827027.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC508]
 gi|170020529|ref|YP_001725483.1| flagellar basal body rod modification protein [Escherichia coli
           ATCC 8739]
 gi|191172470|ref|ZP_03034011.1| flagellar hook capping protein FlgD [Escherichia coli F11]
 gi|195935465|ref|ZP_03080847.1| flagellar basal body rod modification protein [Escherichia coli
           O157:H7 str. EC4024]
 gi|208809154|ref|ZP_03251491.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4206]
 gi|208815597|ref|ZP_03256776.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4045]
 gi|208822404|ref|ZP_03262723.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4042]
 gi|209396598|ref|YP_002269921.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4115]
 gi|215486284|ref|YP_002328715.1| flagellar basal body rod modification protein [Escherichia coli
           O127:H6 str. E2348/69]
 gi|217328509|ref|ZP_03444591.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           TW14588]
 gi|218557957|ref|YP_002390870.1| flagellar basal body rod modification protein [Escherichia coli
           S88]
 gi|237706939|ref|ZP_04537420.1| flagellar hook protein FlgE [Escherichia sp. 3_2_53FAA]
 gi|254792457|ref|YP_003077294.1| flagellar basal body rod modification protein [Escherichia coli
           O157:H7 str. TW14359]
 gi|291282095|ref|YP_003498913.1| Flagellar hook protein FlgE [Escherichia coli O55:H7 str. CB9615]
 gi|300902466|ref|ZP_07120448.1| flagellar hook capping protein [Escherichia coli MS 84-1]
 gi|300982622|ref|ZP_07176206.1| flagellar hook capping protein [Escherichia coli MS 200-1]
 gi|301023262|ref|ZP_07187059.1| flagellar hook capping protein [Escherichia coli MS 69-1]
 gi|301304986|ref|ZP_07211088.1| flagellar hook capping protein [Escherichia coli MS 124-1]
 gi|307310147|ref|ZP_07589797.1| flagellar hook capping protein [Escherichia coli W]
 gi|312971212|ref|ZP_07785390.1| basal-body rod modification protein flgD [Escherichia coli 1827-70]
 gi|331657137|ref|ZP_08358099.1| basal-body rod modification protein FlgD [Escherichia coli TA206]
 gi|331662481|ref|ZP_08363404.1| basal-body rod modification protein FlgD [Escherichia coli TA143]
 gi|13360917|dbj|BAB34876.1| flagellar biosynthesis FlgD protein [Escherichia coli O157:H7 str.
           Sakai]
 gi|91071801|gb|ABE06682.1| flagellar hook formation protein FlgD [Escherichia coli UTI89]
 gi|110342843|gb|ABG69080.1| basal-body rod modification protein FlgD [Escherichia coli 536]
 gi|115512385|gb|ABJ00460.1| flagellar hook formation protein FlgD [Escherichia coli APEC O1]
 gi|157066282|gb|ABV05537.1| flagellar hook capping protein FlgD [Escherichia coli HS]
 gi|169755457|gb|ACA78156.1| flagellar hook capping protein [Escherichia coli ATCC 8739]
 gi|187770545|gb|EDU34389.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4196]
 gi|188018077|gb|EDU56199.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4113]
 gi|188999082|gb|EDU68068.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4076]
 gi|189354575|gb|EDU72994.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4401]
 gi|189363218|gb|EDU81637.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4486]
 gi|189365529|gb|EDU83945.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4501]
 gi|189375919|gb|EDU94335.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC508]
 gi|190907354|gb|EDV66952.1| flagellar hook capping protein FlgD [Escherichia coli F11]
 gi|208728955|gb|EDZ78556.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4206]
 gi|208732245|gb|EDZ80933.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4045]
 gi|208737889|gb|EDZ85572.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4042]
 gi|209157998|gb|ACI35431.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           EC4115]
 gi|209773388|gb|ACI85006.1| flagellar biosynthesis FlgD protein [Escherichia coli]
 gi|209773390|gb|ACI85007.1| flagellar biosynthesis FlgD protein [Escherichia coli]
 gi|209773392|gb|ACI85008.1| flagellar biosynthesis FlgD protein [Escherichia coli]
 gi|209773394|gb|ACI85009.1| flagellar biosynthesis FlgD protein [Escherichia coli]
 gi|209773396|gb|ACI85010.1| flagellar biosynthesis FlgD protein [Escherichia coli]
 gi|215264356|emb|CAS08713.1| flagellar hook assembly protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217318936|gb|EEC27362.1| flagellar hook capping protein FlgD [Escherichia coli O157:H7 str.
           TW14588]
 gi|218364726|emb|CAR02416.1| flagellar hook assembly protein [Escherichia coli S88]
 gi|226898149|gb|EEH84408.1| flagellar hook protein FlgE [Escherichia sp. 3_2_53FAA]
 gi|254591857|gb|ACT71218.1| flagellar hook assembly protein [Escherichia coli O157:H7 str.
           TW14359]
 gi|281178184|dbj|BAI54514.1| flagellar hook formation protein FlgD [Escherichia coli SE15]
 gi|284920898|emb|CBG33961.1| basal-body rod modification protein FlgD [Escherichia coli 042]
 gi|290761968|gb|ADD55929.1| Flagellar hook protein FlgE [Escherichia coli O55:H7 str. CB9615]
 gi|294491980|gb|ADE90736.1| Flagellar hook capping protein [Escherichia coli IHE3034]
 gi|300307087|gb|EFJ61607.1| flagellar hook capping protein [Escherichia coli MS 200-1]
 gi|300397107|gb|EFJ80645.1| flagellar hook capping protein [Escherichia coli MS 69-1]
 gi|300405498|gb|EFJ89036.1| flagellar hook capping protein [Escherichia coli MS 84-1]
 gi|300839704|gb|EFK67464.1| flagellar hook capping protein [Escherichia coli MS 124-1]
 gi|306909865|gb|EFN40359.1| flagellar hook capping protein [Escherichia coli W]
 gi|307627455|gb|ADN71759.1| flagellar basal body rod modification protein [Escherichia coli
           UM146]
 gi|310336414|gb|EFQ01600.1| basal-body rod modification protein flgD [Escherichia coli 1827-70]
 gi|315060353|gb|ADT74680.1| flagellar hook assembly protein [Escherichia coli W]
 gi|315253876|gb|EFU33844.1| flagellar hook capping protein [Escherichia coli MS 85-1]
 gi|315287370|gb|EFU46781.1| flagellar hook capping protein [Escherichia coli MS 110-3]
 gi|315296706|gb|EFU56001.1| flagellar hook capping protein [Escherichia coli MS 16-3]
 gi|320179225|gb|EFW54183.1| Flagellar basal-body rod modification protein FlgD [Shigella boydii
           ATCC 9905]
 gi|320189758|gb|EFW64414.1| Flagellar basal-body rod modification protein FlgD [Escherichia
           coli O157:H7 str. EC1212]
 gi|320196443|gb|EFW71066.1| Flagellar basal-body rod modification protein FlgD [Escherichia
           coli WV_060327]
 gi|320200971|gb|EFW75555.1| Flagellar basal-body rod modification protein FlgD [Escherichia
           coli EC4100B]
 gi|320637526|gb|EFX07326.1| flagellar basal body rod modification protein [Escherichia coli
           O157:H7 str. G5101]
 gi|320643087|gb|EFX12288.1| flagellar basal body rod modification protein [Escherichia coli
           O157:H- str. 493-89]
 gi|320648545|gb|EFX17200.1| flagellar basal body rod modification protein [Escherichia coli
           O157:H- str. H 2687]
 gi|320653859|gb|EFX21933.1| flagellar basal body rod modification protein [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320659339|gb|EFX26908.1| flagellar basal body rod modification protein [Escherichia coli
           O55:H7 str. USDA 5905]
 gi|320664474|gb|EFX31625.1| flagellar basal body rod modification protein [Escherichia coli
           O157:H7 str. LSU-61]
 gi|323174796|gb|EFZ60411.1| basal-body rod modification protein flgD [Escherichia coli LT-68]
 gi|323379086|gb|ADX51354.1| flagellar hook capping protein [Escherichia coli KO11]
 gi|323953239|gb|EGB49105.1| flagellar hook capping protein [Escherichia coli H252]
 gi|323957899|gb|EGB53611.1| flagellar hook capping protein [Escherichia coli H263]
 gi|324007915|gb|EGB77134.1| flagellar hook capping protein [Escherichia coli MS 57-2]
 gi|324013349|gb|EGB82568.1| flagellar hook capping protein [Escherichia coli MS 60-1]
 gi|326339297|gb|EGD63111.1| Flagellar basal-body rod modification protein FlgD [Escherichia
           coli O157:H7 str. 1125]
 gi|326344742|gb|EGD68490.1| Flagellar basal-body rod modification protein FlgD [Escherichia
           coli O157:H7 str. 1044]
 gi|331055385|gb|EGI27394.1| basal-body rod modification protein FlgD [Escherichia coli TA206]
 gi|331060903|gb|EGI32867.1| basal-body rod modification protein FlgD [Escherichia coli TA143]
 gi|332088751|gb|EGI93863.1| basal-body rod modification protein flgD [Shigella boydii 5216-82]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|218689028|ref|YP_002397240.1| flagellar basal body rod modification protein [Escherichia coli
           ED1a]
 gi|306814076|ref|ZP_07448249.1| flagellar basal body rod modification protein [Escherichia coli
           NC101]
 gi|218426592|emb|CAR07420.1| flagellar hook assembly protein [Escherichia coli ED1a]
 gi|305852713|gb|EFM53161.1| flagellar basal body rod modification protein [Escherichia coli
           NC101]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|193064562|ref|ZP_03045642.1| flagellar hook capping protein FlgD [Escherichia coli E22]
 gi|194428429|ref|ZP_03060969.1| flagellar hook capping protein FlgD [Escherichia coli B171]
 gi|260843315|ref|YP_003221093.1| flagellar hook assembly protein FlgD [Escherichia coli O103:H2 str.
           12009]
 gi|192927814|gb|EDV82428.1| flagellar hook capping protein FlgD [Escherichia coli E22]
 gi|194413481|gb|EDX29763.1| flagellar hook capping protein FlgD [Escherichia coli B171]
 gi|257758462|dbj|BAI29959.1| flagellar hook assembly protein FlgD [Escherichia coli O103:H2 str.
           12009]
 gi|323163757|gb|EFZ49576.1| basal-body rod modification protein flgD [Escherichia coli E128010]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|293409441|ref|ZP_06653017.1| basal-body rod modification protein flgD [Escherichia coli B354]
 gi|291469909|gb|EFF12393.1| basal-body rod modification protein flgD [Escherichia coli B354]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|194438126|ref|ZP_03070219.1| flagellar hook capping protein FlgD [Escherichia coli 101-1]
 gi|253773901|ref|YP_003036732.1| flagellar basal body rod modification protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254161181|ref|YP_003044289.1| flagellar basal body rod modification protein [Escherichia coli B
           str. REL606]
 gi|300928373|ref|ZP_07143907.1| flagellar hook capping protein [Escherichia coli MS 187-1]
 gi|194423062|gb|EDX39056.1| flagellar hook capping protein FlgD [Escherichia coli 101-1]
 gi|242376879|emb|CAQ31596.1| flagellar biosynthesis, initiation of hook assembly [Escherichia
           coli BL21(DE3)]
 gi|253324945|gb|ACT29547.1| flagellar hook capping protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973082|gb|ACT38753.1| flagellar basal body rod modification protein D [Escherichia coli B
           str. REL606]
 gi|253977296|gb|ACT42966.1| flagellar basal body rod modification protein D [Escherichia coli
           BL21(DE3)]
 gi|300463631|gb|EFK27124.1| flagellar hook capping protein [Escherichia coli MS 187-1]
 gi|323962674|gb|EGB58252.1| flagellar hook capping protein [Escherichia coli H489]
 gi|323973336|gb|EGB68525.1| flagellar hook capping protein [Escherichia coli TA007]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|323967016|gb|EGB62442.1| flagellar hook capping protein [Escherichia coli M863]
 gi|323976552|gb|EGB71640.1| flagellar hook capping protein [Escherichia coli TW10509]
 gi|327253474|gb|EGE65112.1| basal-body rod modification protein flgD [Escherichia coli STEC_7v]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|157157345|ref|YP_001462309.1| flagellar basal body rod modification protein [Escherichia coli
           E24377A]
 gi|157079375|gb|ABV19083.1| flagellar hook capping protein FlgD [Escherichia coli E24377A]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|16129038|ref|NP_415593.1| flagellar hook assembly protein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89107921|ref|AP_001701.1| flagellar hook assembly protein [Escherichia coli str. K-12 substr.
           W3110]
 gi|110805092|ref|YP_688612.1| flagellar basal body rod modification protein [Shigella flexneri 5
           str. 8401]
 gi|170080726|ref|YP_001730046.1| flagellar hook assembly protein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|191168471|ref|ZP_03030259.1| flagellar hook capping protein FlgD [Escherichia coli B7A]
 gi|209918329|ref|YP_002292413.1| flagellar basal body rod modification protein [Escherichia coli
           SE11]
 gi|218553654|ref|YP_002386567.1| flagellar basal body rod modification protein [Escherichia coli
           IAI1]
 gi|218694609|ref|YP_002402276.1| flagellar basal body rod modification protein [Escherichia coli
           55989]
 gi|238900329|ref|YP_002926125.1| flagellar hook assembly protein [Escherichia coli BW2952]
 gi|256018668|ref|ZP_05432533.1| flagellar basal body rod modification protein [Shigella sp. D9]
 gi|256023227|ref|ZP_05437092.1| flagellar basal body rod modification protein [Escherichia sp.
           4_1_40B]
 gi|260854558|ref|YP_003228449.1| flagellar hook assembly protein FlgD [Escherichia coli O26:H11 str.
           11368]
 gi|293433365|ref|ZP_06661793.1| basal-body rod modification protein flgD [Escherichia coli B088]
 gi|300816777|ref|ZP_07096997.1| flagellar hook capping protein [Escherichia coli MS 107-1]
 gi|300821144|ref|ZP_07101293.1| flagellar hook capping protein [Escherichia coli MS 119-7]
 gi|300922601|ref|ZP_07138701.1| flagellar hook capping protein [Escherichia coli MS 182-1]
 gi|300950170|ref|ZP_07164115.1| flagellar hook capping protein [Escherichia coli MS 116-1]
 gi|300954385|ref|ZP_07166839.1| flagellar hook capping protein [Escherichia coli MS 175-1]
 gi|301029710|ref|ZP_07192764.1| flagellar hook capping protein [Escherichia coli MS 196-1]
 gi|301328555|ref|ZP_07221616.1| flagellar hook capping protein [Escherichia coli MS 78-1]
 gi|301644987|ref|ZP_07244953.1| flagellar hook capping protein [Escherichia coli MS 146-1]
 gi|309798069|ref|ZP_07692444.1| flagellar hook capping protein [Escherichia coli MS 145-7]
 gi|331652128|ref|ZP_08353147.1| basal-body rod modification protein FlgD [Escherichia coli M718]
 gi|331667475|ref|ZP_08368339.1| basal-body rod modification protein FlgD [Escherichia coli TA271]
 gi|331676866|ref|ZP_08377562.1| basal-body rod modification protein FlgD [Escherichia coli H591]
 gi|332279737|ref|ZP_08392150.1| flagellar hook protein FlgE [Shigella sp. D9]
 gi|2494526|sp|P75936|FLGD_ECOLI RecName: Full=Basal-body rod modification protein flgD
 gi|1787315|gb|AAC74159.1| flagellar hook assembly protein [Escherichia coli str. K-12 substr.
           MG1655]
 gi|4062652|dbj|BAA35883.1| flagellar hook assembly protein [Escherichia coli str. K12 substr.
           W3110]
 gi|110614640|gb|ABF03307.1| basal-body rod modification protein FlgD [Shigella flexneri 5 str.
           8401]
 gi|169888561|gb|ACB02268.1| flagellar hook assembly protein [Escherichia coli str. K-12 substr.
           DH10B]
 gi|190901490|gb|EDV61251.1| flagellar hook capping protein FlgD [Escherichia coli B7A]
 gi|209911588|dbj|BAG76662.1| flagellar hook formation protein FlgD [Escherichia coli SE11]
 gi|218351341|emb|CAU97047.1| flagellar hook assembly protein [Escherichia coli 55989]
 gi|218360422|emb|CAQ97974.1| flagellar hook assembly protein [Escherichia coli IAI1]
 gi|238861107|gb|ACR63105.1| flagellar hook assembly protein [Escherichia coli BW2952]
 gi|257753207|dbj|BAI24709.1| flagellar hook assembly protein FlgD [Escherichia coli O26:H11 str.
           11368]
 gi|260449785|gb|ACX40207.1| flagellar hook capping protein [Escherichia coli DH1]
 gi|291324184|gb|EFE63606.1| basal-body rod modification protein flgD [Escherichia coli B088]
 gi|299877398|gb|EFI85609.1| flagellar hook capping protein [Escherichia coli MS 196-1]
 gi|300318621|gb|EFJ68405.1| flagellar hook capping protein [Escherichia coli MS 175-1]
 gi|300421078|gb|EFK04389.1| flagellar hook capping protein [Escherichia coli MS 182-1]
 gi|300450517|gb|EFK14137.1| flagellar hook capping protein [Escherichia coli MS 116-1]
 gi|300526443|gb|EFK47512.1| flagellar hook capping protein [Escherichia coli MS 119-7]
 gi|300530551|gb|EFK51613.1| flagellar hook capping protein [Escherichia coli MS 107-1]
 gi|300844947|gb|EFK72707.1| flagellar hook capping protein [Escherichia coli MS 78-1]
 gi|301076716|gb|EFK91522.1| flagellar hook capping protein [Escherichia coli MS 146-1]
 gi|308118352|gb|EFO55614.1| flagellar hook capping protein [Escherichia coli MS 145-7]
 gi|309701347|emb|CBJ00648.1| basal-body rod modification protein FlgD [Escherichia coli ETEC
           H10407]
 gi|315135707|dbj|BAJ42866.1| flagellar basal body rod modification protein [Escherichia coli
           DH1]
 gi|315618245|gb|EFU98835.1| basal-body rod modification protein flgD [Escherichia coli 3431]
 gi|323156882|gb|EFZ43016.1| basal-body rod modification protein flgD [Escherichia coli EPECa14]
 gi|323165583|gb|EFZ51370.1| basal-body rod modification protein flgD [Shigella sonnei 53G]
 gi|323185802|gb|EFZ71163.1| basal-body rod modification protein flgD [Escherichia coli 1357]
 gi|323937815|gb|EGB34079.1| flagellar hook capping protein [Escherichia coli E1520]
 gi|323942544|gb|EGB38711.1| flagellar hook capping protein [Escherichia coli E482]
 gi|324017421|gb|EGB86640.1| flagellar hook capping protein [Escherichia coli MS 117-3]
 gi|324117354|gb|EGC11261.1| flagellar hook capping protein [Escherichia coli E1167]
 gi|331050406|gb|EGI22464.1| basal-body rod modification protein FlgD [Escherichia coli M718]
 gi|331065060|gb|EGI36955.1| basal-body rod modification protein FlgD [Escherichia coli TA271]
 gi|331075555|gb|EGI46853.1| basal-body rod modification protein FlgD [Escherichia coli H591]
 gi|332102089|gb|EGJ05435.1| flagellar hook protein FlgE [Shigella sp. D9]
 gi|332342621|gb|AEE55955.1| flagellar basal-body rod modification protein FlgD [Escherichia
           coli UMNK88]
 gi|333008277|gb|EGK27751.1| basal-body rod modification protein flgD [Shigella flexneri K-272]
 gi|333019767|gb|EGK39039.1| basal-body rod modification protein flgD [Shigella flexneri K-227]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|292487938|ref|YP_003530813.1| basal-body rod modification protein FlgD [Erwinia amylovora
          CFBP1430]
 gi|292899157|ref|YP_003538526.1| flagellar hook formation protein FlgD [Erwinia amylovora ATCC
          49946]
 gi|291199005|emb|CBJ46116.1| flagellar hook formation protein FlgD [Erwinia amylovora ATCC
          49946]
 gi|291553360|emb|CBA20405.1| Basal-body rod modification protein flgD [Erwinia amylovora
          CFBP1430]
          Length = 223

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 41/69 (59%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
          Q+ FL LL+TQ+K+QDPT PM  ++   QLA  + +    ++N+TL  +   + S    Q
Sbjct: 31 QNNFLTLLVTQLKNQDPTNPMDNAQLTTQLAQINTLSGVEKLNTTLGSISGQITSGQSLQ 90

Query: 82 ASSYIGKNI 90
          AS+ IG  +
Sbjct: 91 ASTLIGHGV 99


>gi|323190587|gb|EFZ75859.1| basal-body rod modification protein flgD [Escherichia coli RN587/1]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|15801192|ref|NP_287209.1| flagellar basal body rod modification protein [Escherichia coli
           O157:H7 EDL933]
 gi|12514613|gb|AAG55821.1|AE005317_10 flagellar biosynthesis, initiation of hook assembly [Escherichia
           coli O157:H7 str. EDL933]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|194432371|ref|ZP_03064658.1| flagellar hook capping protein FlgD [Shigella dysenteriae 1012]
 gi|194419258|gb|EDX35340.1| flagellar hook capping protein FlgD [Shigella dysenteriae 1012]
 gi|332092821|gb|EGI97889.1| basal-body rod modification protein flgD [Shigella dysenteriae
           155-74]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|30062612|ref|NP_836783.1| flagellar basal body rod modification protein [Shigella flexneri 2a
           str. 2457T]
 gi|30040858|gb|AAP16589.1| flagellar hook formation protein FlgD [Shigella flexneri 2a str.
           2457T]
 gi|313650474|gb|EFS14881.1| basal-body rod modification protein flgD [Shigella flexneri 2a str.
           2457T]
 gi|332758234|gb|EGJ88557.1| basal-body rod modification protein flgD [Shigella flexneri
           4343-70]
 gi|332761420|gb|EGJ91704.1| basal-body rod modification protein flgD [Shigella flexneri K-671]
 gi|332767682|gb|EGJ97875.1| flagellar hook capping family protein [Shigella flexneri 2930-71]
 gi|333005536|gb|EGK25054.1| basal-body rod modification protein flgD [Shigella flexneri K-218]
 gi|333019309|gb|EGK38592.1| basal-body rod modification protein flgD [Shigella flexneri K-304]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|260867438|ref|YP_003233840.1| flagellar hook assembly protein FlgD [Escherichia coli O111:H- str.
           11128]
 gi|257763794|dbj|BAI35289.1| flagellar hook assembly protein FlgD [Escherichia coli O111:H- str.
           11128]
 gi|323175694|gb|EFZ61288.1| basal-body rod modification protein flgD [Escherichia coli 1180]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|74311637|ref|YP_310056.1| flagellar basal body rod modification protein [Shigella sonnei
           Ss046]
 gi|73855114|gb|AAZ87821.1| flagellar protein for initiation of hook assembly [Shigella sonnei
           Ss046]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|307137710|ref|ZP_07497066.1| flagellar basal body rod modification protein [Escherichia coli
           H736]
 gi|331641619|ref|ZP_08342754.1| basal-body rod modification protein FlgD [Escherichia coli H736]
 gi|331038417|gb|EGI10637.1| basal-body rod modification protein FlgD [Escherichia coli H736]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|146311245|ref|YP_001176319.1| flagellar basal body rod modification protein [Enterobacter sp.
           638]
 gi|145318121|gb|ABP60268.1| flagellar hook capping protein [Enterobacter sp. 638]
          Length = 236

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E   QLA  S +    ++N+TL  +   L  +   Q
Sbjct: 36  QGSFLTLLVAQLKNQDPTNPMQNNELTTQLAQISTVSGIEKLNTTLGSVSGQLNDSQSLQ 95

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 96  ASNLIGHGV 104


>gi|109899403|ref|YP_662658.1| flagellar basal body rod modification protein [Pseudoalteromonas
           atlantica T6c]
 gi|109701684|gb|ABG41604.1| flagellar hook capping protein [Pseudoalteromonas atlantica T6c]
          Length = 228

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 60/113 (53%), Gaps = 14/113 (12%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---L 74
           +S + L Q+ F  LL  Q+ +QDP++P+   + VAQ+  F+  +   Q+N   +     +
Sbjct: 25  ESNQNLSQEDFFSLLTEQLANQDPSKPVDNDQMVAQMTSFTMADGISQLNEKFETFATSM 84

Query: 75  KSNNLAQASSYIGKNI--------TNADG-SISGVVNAIQVSSTGLTAITVDN 118
            SN   QASS IG+ +          ++G  +SGVV  I  S+T  T IT++N
Sbjct: 85  TSNQALQASSLIGQQVLLQGDVAHMASEGQGVSGVV--INDSTTLNTKITIEN 135


>gi|332759649|gb|EGJ89954.1| basal-body rod modification protein flgD [Shigella flexneri
           2747-71]
          Length = 231

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|312172059|emb|CBX80316.1| Basal-body rod modification protein flgD [Erwinia amylovora ATCC
          BAA-2158]
          Length = 223

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 41/69 (59%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
          Q+ FL LL+TQ+K+QDPT PM  ++   QLA  + +    ++N+TL  +   + S    Q
Sbjct: 31 QNNFLTLLVTQLKNQDPTNPMDNAQLTTQLAQINTLSGVEKLNTTLGSISGQITSGQSLQ 90

Query: 82 ASSYIGKNI 90
          AS+ IG  +
Sbjct: 91 ASTLIGHGV 99


>gi|281600494|gb|ADA73478.1| Flagellar hook protein FlgE [Shigella flexneri 2002017]
          Length = 229

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|259908813|ref|YP_002649169.1| flagellar basal body rod modification protein [Erwinia pyrifoliae
           Ep1/96]
 gi|224964435|emb|CAX55944.1| Flagellar biosynthesis, initiation of hook assembly [Erwinia
           pyrifoliae Ep1/96]
          Length = 224

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 41/69 (59%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FL LL+TQ+K+QDPT PM  ++   QLA  + +    ++N+TL  +   + S    Q
Sbjct: 32  QNNFLTLLVTQLKNQDPTNPMDNAQLTTQLAQINTLSGVERLNTTLGSISGQITSGQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASTLIGHGV 100


>gi|126730148|ref|ZP_01745960.1| Possible FlgD protein [Sagittula stellata E-37]
 gi|126709528|gb|EBA08582.1| Possible FlgD protein [Sagittula stellata E-37]
          Length = 188

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 4/74 (5%)

Query: 31  LLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQASSYIG 87
           +L  Q+++QDP  P+ ++E   QLA FS +EQ VQ N  L+ +   L  N+L +   +IG
Sbjct: 1   MLTVQVQNQDPLNPVDSTEYATQLATFSSVEQQVQTNELLRNISATLGGNSLNEFGRWIG 60

Query: 88  -KNITNADGSISGV 100
            + +  A     GV
Sbjct: 61  MEGLVRAPAMFDGV 74


>gi|34498341|ref|NP_902556.1| basal-body rod modification protein FlgD [Chromobacterium
          violaceum ATCC 12472]
 gi|34104195|gb|AAQ60554.1| basal-body rod modification protein FlgD [Chromobacterium
          violaceum ATCC 12472]
          Length = 224

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ--- 81
          Q+ FL LL  Q+  QDP  PM  S+  +Q+A  SQ+     +N T+Q+L+ S N +Q   
Sbjct: 29 QNNFLTLLTAQLNAQDPLNPMDNSQLTSQMAQISQVSGLQSLNLTMQQLVASQNASQSMM 88

Query: 82 ASSYIGKNI 90
          A+  IG N+
Sbjct: 89 ATGMIGNNV 97


>gi|82702452|ref|YP_412018.1| flagellar basal body rod modification protein [Nitrosospira
          multiformis ATCC 25196]
 gi|82410517|gb|ABB74626.1| Flagellar hook capping protein [Nitrosospira multiformis ATCC
          25196]
          Length = 222

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 9/91 (9%)

Query: 9  PTQQEFSKSKSKKTLG------QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
          PT   F+   ++ T        QD FLKLL+TQ+K+QDP  P+  ++   QLA  S +  
Sbjct: 9  PTSNPFAAYGTRSTAKPAEEDLQDRFLKLLVTQMKNQDPLNPLDNAQVTTQLAQISTVNG 68

Query: 63 SVQMNSTLQELLKSNNLA---QASSYIGKNI 90
            ++N+T++ +  S       QA+  IG+ +
Sbjct: 69 VERLNATIRTIADSFTAGQSLQAAGMIGREV 99


>gi|254516988|ref|ZP_05129046.1| flagellar hook capping protein [gamma proteobacterium NOR5-3]
 gi|219674493|gb|EED30861.1| flagellar hook capping protein [gamma proteobacterium NOR5-3]
          Length = 233

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 45/78 (57%), Gaps = 3/78 (3%)

Query: 16 KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQE 72
          K+ S + +G D FL L++ Q+++QDP++PM   + + QLA F  +    ++N   S L  
Sbjct: 21 KAGSVEDMGSDDFLTLMVAQLENQDPSKPMDNMQFMGQLAQFGTVSGIQELNAGFSGLSN 80

Query: 73 LLKSNNLAQASSYIGKNI 90
           L      QA++ +G+++
Sbjct: 81 ALSGGQALQAAALVGRSV 98


>gi|24051371|gb|AAN42702.1| flagellar hook protein FlgE [Shigella flexneri 2a str. 301]
          Length = 642

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|116626494|ref|YP_828650.1| flagellar hook capping protein [Candidatus Solibacter usitatus
          Ellin6076]
 gi|116229656|gb|ABJ88365.1| flagellar hook capping protein [Candidatus Solibacter usitatus
          Ellin6076]
          Length = 99

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 29/43 (67%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN 67
          +D FL+LL+ QIK+QDP  P    + + QLA F Q+EQS+ M 
Sbjct: 30 KDMFLQLLVAQIKNQDPLSPTDGVQFLTQLAQFQQLEQSINMG 72


>gi|283478795|emb|CAY74711.1| Basal-body rod modification protein flgD [Erwinia pyrifoliae DSM
           12163]
          Length = 226

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 41/69 (59%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FL LL+TQ+K+QDPT PM  ++   QLA  + +    ++N+TL  +   + S    Q
Sbjct: 34  QNNFLTLLVTQLKNQDPTNPMDNAQLTTQLAQINTLSGVERLNTTLGSISGQITSGQSLQ 93

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 94  ASTLIGHGV 102


>gi|300918677|ref|ZP_07135258.1| flagellar hook capping protein [Escherichia coli MS 115-1]
 gi|300414171|gb|EFJ97481.1| flagellar hook capping protein [Escherichia coli MS 115-1]
          Length = 231

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGYGV 100


>gi|332305614|ref|YP_004433465.1| flagellar hook capping protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172943|gb|AEE22197.1| flagellar hook capping protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 228

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 58/117 (49%), Gaps = 9/117 (7%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---L 74
            S + L Q+ F  LL  Q+ +QDP++P+   + VAQ+  F+  +   Q+N   +     +
Sbjct: 25  DSNQNLSQEDFFSLLTEQLANQDPSKPVDNDQMVAQMTSFTMADGISQLNEKFETFATSM 84

Query: 75  KSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            SN   QASS IG+ +      + G V  +     G++ + +++T   + T I I N
Sbjct: 85  TSNQALQASSLIGQQVL-----LQGDVAHMASEGQGVSGVVINDTTT-LNTKITIEN 135


>gi|51596010|ref|YP_070201.1| flagellar basal body rod modification protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|170024648|ref|YP_001721153.1| flagellar basal body rod modification protein [Yersinia
           pseudotuberculosis YPIII]
 gi|186895113|ref|YP_001872225.1| flagellar basal body rod modification protein [Yersinia
           pseudotuberculosis PB1/+]
 gi|51589292|emb|CAH20913.1| basal-body rod modification protein FlgD [Yersinia
           pseudotuberculosis IP 32953]
 gi|169751182|gb|ACA68700.1| flagellar hook capping protein [Yersinia pseudotuberculosis YPIII]
 gi|186698139|gb|ACC88768.1| flagellar hook capping protein [Yersinia pseudotuberculosis PB1/+]
          Length = 228

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q++FL LL+ Q+K+QDPT PM+ +E   QLA  + +    ++N+TL  +   + S+    
Sbjct: 32  QNSFLTLLVAQLKNQDPTNPMENNELTTQLAQINTVSGIEKLNTTLGAITGQIDSSQSLY 91

Query: 82  ASSYIGKNI 90
           A+S IG+ +
Sbjct: 92  ATSLIGRGV 100


>gi|257095360|ref|YP_003169001.1| flagellar hook capping protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047884|gb|ACV37072.1| flagellar hook capping protein [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 225

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 53/91 (58%), Gaps = 16/91 (17%)

Query: 25  QDAFLKLLITQIKHQDPTEPMK---ASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA- 80
           Q+ FLKLL+TQ+K+QDP  P+     + Q++Q++  + +E   ++N+TL+ LL + N   
Sbjct: 34  QNRFLKLLVTQLKNQDPLNPLDNAAVTSQISQISTVTGIE---KLNTTLETLLNTFNDGQ 90

Query: 81  --QASSYIGKNITNA-------DGSISGVVN 102
             QA+  +GK++  A        G  SG VN
Sbjct: 91  SMQAAGLLGKSVLVAGSQLALTGGRASGGVN 121


>gi|310767289|gb|ADP12239.1| flagellar basal body rod modification protein [Erwinia sp. Ejp617]
          Length = 224

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 41/69 (59%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FL LL+TQ+K+QDPT PM  ++   QLA  + +    ++N+TL  +   + S    Q
Sbjct: 32  QNNFLTLLVTQLKNQDPTNPMDNAQLTTQLAQINTLSGVEKLNTTLGSISGQITSGQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASTLIGHGV 100


>gi|258404709|ref|YP_003197451.1| flagellar hook capping protein [Desulfohalobium retbaense DSM
          5692]
 gi|257796936|gb|ACV67873.1| flagellar hook capping protein [Desulfohalobium retbaense DSM
          5692]
          Length = 227

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 46/72 (63%), Gaps = 3/72 (4%)

Query: 22 TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL--LKSNNL 79
          +LG+  FL LL+TQ+++QDP  P   +E  AQLA FS +EQ   ++ +++ L  +K+   
Sbjct: 28 SLGKMDFLNLLVTQLENQDPMNPSDPTEMTAQLAQFSSLEQLTNISESMEGLDAMKTAYE 87

Query: 80 AQAS-SYIGKNI 90
            A+ S +G+N+
Sbjct: 88 QNAALSMLGRNV 99


>gi|251778352|ref|ZP_04821272.1| flagellar hook assembly protein FlgD [Clostridium botulinum E1 str.
           'BoNT E Beluga']
 gi|243082667|gb|EES48557.1| flagellar hook assembly protein FlgD [Clostridium botulinum E1 str.
           'BoNT E Beluga']
          Length = 321

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%), Gaps = 4/95 (4%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           SKS +   +++FLKLL  Q+ + DPT    ++  V Q+A F+ MEQ   +N T+      
Sbjct: 41  SKSGQEFDKNSFLKLLSAQLSNLDPTSDQDSTAYVTQMAQFAAMEQMYNLNDTMSTFAHQ 100

Query: 77  NNLAQASSYIGKNITNADGS-ISGVVNAIQVSSTG 110
             + + ++    ++ NADG   +G++  +   + G
Sbjct: 101 QLVGKGATM---DLINADGEYYTGIIRGVSKDNYG 132


>gi|197104254|ref|YP_002129631.1| flagellar hook assembly protein [Phenylobacterium zucineum HLK1]
 gi|196477674|gb|ACG77202.1| flagellar hook assembly protein [Phenylobacterium zucineum HLK1]
          Length = 230

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 2/70 (2%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK--SNNLAQAS 83
          D FL LL TQ+K+QDP  P+ +++   Q+   + +EQ +  N  L+ L+   SN ++ A 
Sbjct: 25 DTFLALLTTQLKNQDPLSPLDSNQFTQQIVQMTGVEQQLLTNDLLKSLVSNTSNGVSTAV 84

Query: 84 SYIGKNITNA 93
          S IGK +  A
Sbjct: 85 SLIGKEVRAA 94


>gi|157738167|ref|YP_001490851.1| flagellar hook assembly protein FlgD [Arcobacter butzleri RM4018]
 gi|315636310|ref|ZP_07891560.1| flagellar hook assembly protein FlgD [Arcobacter butzleri JV22]
 gi|157700021|gb|ABV68181.1| flagellar hook assembly protein FlgD [Arcobacter butzleri RM4018]
 gi|315479399|gb|EFU70082.1| flagellar hook assembly protein FlgD [Arcobacter butzleri JV22]
          Length = 226

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 55/98 (56%), Gaps = 3/98 (3%)

Query: 14  FSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
           ++ S S  +L  + FLKL+I Q+K QDPT+P  +++ +      S +  ++QM STL+ +
Sbjct: 18  YTTSVSNDSLTTNDFLKLMIEQLKLQDPTKPYDSAKMLETQMQMSTLNANMQMISTLESI 77

Query: 74  ---LKSNNLAQASSYIGKNITNADGSISGVVNAIQVSS 108
               +  +++ A+  IG +I N   + SG + +  V S
Sbjct: 78  STAFQQTSISNAAGLIGSSIENGSKNSSGSLKSYYVES 115


>gi|188588066|ref|YP_001920208.1| flagellar hook assembly protein FlgD [Clostridium botulinum E3 str.
           Alaska E43]
 gi|188498347|gb|ACD51483.1| flagellar hook assembly protein FlgD [Clostridium botulinum E3 str.
           Alaska E43]
          Length = 321

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%), Gaps = 4/95 (4%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           SKS +   +++FLKLL  Q+ + DPT    ++  V Q+A F+ MEQ   +N T+      
Sbjct: 41  SKSGQEFDKNSFLKLLSAQLSNLDPTSDQDSTAYVTQMAQFAAMEQMYNLNDTMSTFAHQ 100

Query: 77  NNLAQASSYIGKNITNADGS-ISGVVNAIQVSSTG 110
             + + ++    ++ NADG   +G++  +   + G
Sbjct: 101 QLVGKGATM---DLINADGEYYTGIIRGVSKDNYG 132


>gi|311105934|ref|YP_003978787.1| basal-body rod modification protein FlgD [Achromobacter
          xylosoxidans A8]
 gi|310760623|gb|ADP16072.1| basal-body rod modification protein FlgD [Achromobacter
          xylosoxidans A8]
          Length = 232

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ--- 81
          QD FLKLL+TQ+++QDP  PM+ +E  +QLA  S +E    + +T+  +    +++Q   
Sbjct: 30 QDQFLKLLVTQLQNQDPLNPMQNAELTSQLAQISTVEGITNLKNTMLAISGQIDVSQSMN 89

Query: 82 ASSYIGKNI 90
          A + IGK +
Sbjct: 90 AVAMIGKGV 98


>gi|187934832|ref|YP_001885047.1| flagellar hook assembly protein FlgD [Clostridium botulinum B str.
           Eklund 17B]
 gi|187722985|gb|ACD24206.1| flagellar hook assembly protein FlgD [Clostridium botulinum B str.
           Eklund 17B]
          Length = 321

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%), Gaps = 4/95 (4%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           SKS +   +++FLKLL  Q+ + DPT    ++  V Q+A F+ MEQ   +N T+      
Sbjct: 41  SKSGQEFDKNSFLKLLSAQLSNLDPTSDQDSTAYVTQMAQFAAMEQMYNLNDTMSTFAHQ 100

Query: 77  NNLAQASSYIGKNITNADGS-ISGVVNAIQVSSTG 110
             + + ++    ++ NADG   +G++  +   + G
Sbjct: 101 QLVGKGATM---DLINADGEYYTGIIRGVSKDNYG 132


>gi|304397203|ref|ZP_07379082.1| flagellar hook capping protein [Pantoea sp. aB]
 gi|304355352|gb|EFM19720.1| flagellar hook capping protein [Pantoea sp. aB]
          Length = 224

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 51/94 (54%), Gaps = 6/94 (6%)

Query: 3   INTEVNPTQQEFSKSKSKKTLGQDA---FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           +N +++PT    S +       QD    FL +L+TQ+K+QDPT PM  S+   QLA  + 
Sbjct: 7   VNDKLDPTVLSSSNTSGTGNNAQDLQNQFLTMLVTQLKNQDPTNPMDNSQLTTQLAQINT 66

Query: 60  MEQSVQMNSTLQEL---LKSNNLAQASSYIGKNI 90
           +    ++N+TL  +   + ++   Q+S+ IG  +
Sbjct: 67  LSGIEKLNTTLGSISGQINTSQSLQSSTLIGHGV 100


>gi|255323567|ref|ZP_05364697.1| flagellar hook assembly protein [Campylobacter showae RM3277]
 gi|255299281|gb|EET78568.1| flagellar hook assembly protein [Campylobacter showae RM3277]
          Length = 234

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           L +DAF+KLL+T++++QDPT PM   +   Q +QLA     E + +M   L + LK++  
Sbjct: 36  LDKDAFMKLLLTELQYQDPTSPMDTEKMLTQTSQLASLEMQENTNKMMQKLADQLKNSTN 95

Query: 80  AQASSYIGKNITNADGSISGVV 101
             A   +GK     D   SG+V
Sbjct: 96  MYAVGVLGKMAKIGD---SGIV 114


>gi|261339375|ref|ZP_05967233.1| basal-body rod modification protein FlgD [Enterobacter cancerogenus
           ATCC 35316]
 gi|288318176|gb|EFC57114.1| basal-body rod modification protein FlgD [Enterobacter cancerogenus
           ATCC 35316]
          Length = 236

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E   QLA  S +    ++N+TL  +   + S+   Q
Sbjct: 36  QSSFLTLLVAQLKNQDPTNPMQNNELTTQLAQISTVSGIEKLNTTLGSVSGQIDSSQSLQ 95

Query: 82  ASSYIGKNI 90
           A++ IG  +
Sbjct: 96  AANLIGHGV 104


>gi|85712253|ref|ZP_01043304.1| flagellar basal body rod modification protein [Idiomarina baltica
           OS145]
 gi|85693880|gb|EAQ31827.1| flagellar basal body rod modification protein [Idiomarina baltica
           OS145]
          Length = 227

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 45/81 (55%), Gaps = 3/81 (3%)

Query: 13  EFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE 72
           E +    ++ L Q+ F KLL  Q+  QDPT+P+   + ++Q+  FS  E   Q++S   +
Sbjct: 22  EAADPSEQQKLEQEDFFKLLTEQLNMQDPTKPVDNDQMISQMTSFSMAEGISQLSSQFTQ 81

Query: 73  L---LKSNNLAQASSYIGKNI 90
               + SN   QAS+ +G+++
Sbjct: 82  FTQNMSSNQALQASTMVGRDV 102


>gi|148258442|ref|YP_001243027.1| putative flagellar basal-body rod modification protein FlgD
           [Bradyrhizobium sp. BTAi1]
 gi|146410615|gb|ABQ39121.1| putative flagellar basal-body rod modification protein FlgD
           [Bradyrhizobium sp. BTAi1]
          Length = 235

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (54%), Gaps = 7/93 (7%)

Query: 10  TQQEFSKSKSKKTLGQD---AFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQM 66
           T++    S S +T   D   +FL LL TQ+ HQ+P +P+  ++   QL  F+Q+EQ ++ 
Sbjct: 21  TEEPVKPSASARTGIADNFQSFLTLLTTQLNHQNPLDPLNVNQFTQQLVQFAQVEQQLKG 80

Query: 67  NSTLQELL---KSNNLAQASSYIGKNITNADGS 96
           N+ L+ L+   KS    QA   +G+     DGS
Sbjct: 81  NTLLERLVEAQKSTQSTQALMLVGRTAV-VDGS 112


>gi|167994040|ref|ZP_02575132.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205328048|gb|EDZ14812.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|332988067|gb|AEF07050.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 232

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           NT V  T    S + S     Q +FL LL+ Q+K+QDPT P++ +E   QLA  S +   
Sbjct: 12  NTGVKTTTDSGSMTGSNAADLQSSFLTLLVAQLKNQDPTNPLQNNELTTQLAQISTVSGI 71

Query: 64  VQMNSTLQEL---LKSNNLAQASSYIGKNI 90
            ++N+TL  +   + ++   QA++ IG  +
Sbjct: 72  EKLNTTLGAISGQIDNSQSLQATTLIGHGV 101


>gi|311280018|ref|YP_003942249.1| flagellar hook capping protein [Enterobacter cloacae SCF1]
 gi|308749213|gb|ADO48965.1| flagellar hook capping protein [Enterobacter cloacae SCF1]
          Length = 230

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E  +QLA  S +    ++N+TL  +   + +    Q
Sbjct: 33  QSSFLTLLVAQLKNQDPTNPMQNNELTSQLAQISTVSGIEKLNTTLGSISGQIDNGQSLQ 92

Query: 82  ASSYIGKNI 90
           A++ IG  +
Sbjct: 93  ATALIGHGV 101


>gi|296102909|ref|YP_003613055.1| flagellar basal-body rod modification protein FlgD [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
 gi|295057368|gb|ADF62106.1| flagellar basal-body rod modification protein FlgD [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
          Length = 236

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E   QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 36  QSSFLTLLVAQLKNQDPTNPMQNNELTTQLAQISTVSGIEKLNTTLGSVSGQIDNSQSLQ 95

Query: 82  ASSYIGKNI 90
           A+S IG  +
Sbjct: 96  AASLIGHGV 104


>gi|227328337|ref|ZP_03832361.1| flagellar basal body rod modification protein [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 224

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FL LL+ Q+K+QDPT PM   + V+QLA  + +    ++N+TL  +   + +N   Q
Sbjct: 32  QNQFLTLLVAQLKNQDPTNPMSNDQLVSQLAQLNTVSGIEKLNTTLGSISGQINNNQSMQ 91

Query: 82  ASSYIGKNI 90
           A++ IG ++
Sbjct: 92  ATTLIGHSV 100


>gi|77359721|ref|YP_339296.1| flagellar basal body rod modification protein [Pseudoalteromonas
          haloplanktis TAC125]
 gi|76874632|emb|CAI85853.1| flagellar biosynthesis; initiation of hook assembly
          [Pseudoalteromonas haloplanktis TAC125]
          Length = 225

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 44/81 (54%), Gaps = 4/81 (4%)

Query: 11 QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
          +Q  SK KS   L Q+ F  LL  Q+  QDP++P    + +AQ+  F+  E    +NS  
Sbjct: 20 KQAASKDKSD-ALTQEDFFSLLTQQLSFQDPSKPADNDQMIAQMTSFTMAEGISNLNSNF 78

Query: 71 QEL---LKSNNLAQASSYIGK 88
          + L   + SN+  QAS+ +GK
Sbjct: 79 EALAASMTSNSALQASTLVGK 99


>gi|254227982|ref|ZP_04921412.1| Flagellar hook capping protein [Vibrio sp. Ex25]
 gi|262396036|ref|YP_003287889.1| flagellar basal-body rod modification protein FlgD [Vibrio sp.
          Ex25]
 gi|151939478|gb|EDN58306.1| Flagellar hook capping protein [Vibrio sp. Ex25]
 gi|262339630|gb|ACY53424.1| flagellar basal-body rod modification protein FlgD [Vibrio sp.
          Ex25]
          Length = 227

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 34/48 (70%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE 72
          ++ F+ L++ QI++QDP  P+  +E V QLA FSQ++ +  M+ T+Q+
Sbjct: 39 ENEFISLMVAQIQNQDPLNPLDGTEYVGQLAQFSQVQSTENMSRTMQQ 86


>gi|317011117|gb|ADU84864.1| flagellar basal body rod modification protein [Helicobacter
          pylori SouthAfrica7]
          Length = 382

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L +DAF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKDAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|188583763|ref|YP_001927208.1| flagellar hook capping protein [Methylobacterium populi BJ001]
 gi|179347261|gb|ACB82673.1| flagellar hook capping protein [Methylobacterium populi BJ001]
          Length = 223

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 47/72 (65%), Gaps = 4/72 (5%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KSNNLAQASS 84
           FL LL TQ+K+Q+P +P+  ++   QL  F+ +EQ ++ N++L  +L   K+ + + AS 
Sbjct: 32  FLTLLTTQLKNQNPLDPLDTNQFTQQLVQFAGVEQQLKTNASLDTILTNSKAASASSASG 91

Query: 85  YIGKNITNADGS 96
            IG+ IT ADG+
Sbjct: 92  LIGRTIT-ADGA 102


>gi|315127354|ref|YP_004069357.1| flagellar basal body rod modification protein [Pseudoalteromonas
          sp. SM9913]
 gi|315015868|gb|ADT69206.1| flagellar basal body rod modification protein [Pseudoalteromonas
          sp. SM9913]
          Length = 225

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 3/76 (3%)

Query: 16 KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL-- 73
          K +    L Q+ F  LL  Q+ +QDP++P    + +AQ+  F+  E    +NS  + L  
Sbjct: 24 KKEESDALTQEDFFSLLTQQLSYQDPSKPADNDQMIAQMTNFTMAEGISNLNSNFESLAA 83

Query: 74 -LKSNNLAQASSYIGK 88
           + SN+  QAS+ +GK
Sbjct: 84 SMTSNSALQASTLVGK 99


>gi|253688973|ref|YP_003018163.1| flagellar hook capping protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251755551|gb|ACT13627.1| flagellar hook capping protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 224

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FL LL+ Q+K+QDPT PM   + V+QLA  + +    ++N+TL  +   + +N   Q
Sbjct: 32  QNQFLTLLVAQLKNQDPTNPMSNDQLVSQLAQLNTVSGIEKLNTTLGSISGQINNNQSMQ 91

Query: 82  ASSYIGKNI 90
           A++ IG ++
Sbjct: 92  ATTLIGHSV 100


>gi|228914331|ref|ZP_04077946.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228845325|gb|EEM90361.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 190

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 59/123 (47%), Gaps = 6/123 (4%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQ 71
           S  K+   + +D FLKL +   +HQDP   M  ++   Q AQL++  Q++   +    LQ
Sbjct: 43  STQKTPGIMDKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQ 102

Query: 72  ELLKSNNLAQASSYIGK---NITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
             + S  L     ++GK    ++N    ++G V  ++++      + VDN  + +    R
Sbjct: 103 STMYSTALDGGMKFLGKYVRGVSNNGKQVTGQVETVRLAENNDVQLIVDNQVVSLRFIER 162

Query: 129 ISN 131
           +S+
Sbjct: 163 VSD 165


>gi|228958032|ref|ZP_04119768.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|229189849|ref|ZP_04316860.1| Flagellar hook assembly protein [Bacillus cereus ATCC 10876]
 gi|228593657|gb|EEK51465.1| Flagellar hook assembly protein [Bacillus cereus ATCC 10876]
 gi|228801657|gb|EEM48538.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           pakistani str. T13001]
          Length = 190

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 56/123 (45%), Gaps = 6/123 (4%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST---LQ 71
           S  K+   + +D FLKL +   +HQDP   M  ++ + Q A  S MEQ   M      LQ
Sbjct: 43  SNQKTPGIMDKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQ 102

Query: 72  ELLKSNNLAQASSYIGK---NITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
             + +  L     ++GK    I N    ++G V  ++++      + VDN  + +    R
Sbjct: 103 STMYTTALDGGMKFLGKYVRGINNKGEQVTGQVETVRLAENNDVQLIVDNQVVSLRFVER 162

Query: 129 ISN 131
           +S+
Sbjct: 163 VSD 165


>gi|332284018|ref|YP_004415929.1| flagellar basal body rod modification protein [Pusillimonas sp.
          T7-7]
 gi|330427971|gb|AEC19305.1| flagellar basal body rod modification protein [Pusillimonas sp.
          T7-7]
          Length = 228

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA---Q 81
          QD FL LL+TQ+++QDP  PM  ++  +Q+A  S +    Q+N+TL  L    +++   Q
Sbjct: 31 QDRFLTLLVTQLQNQDPLNPMDNAQVTSQIAQLSTVNGINQLNTTLLALSGQMDVSQSMQ 90

Query: 82 ASSYIGKNI 90
          A+  IGK +
Sbjct: 91 AAGLIGKEV 99


>gi|260767922|ref|ZP_05876856.1| flagellar basal-body rod modification protein FlgD [Vibrio
          furnissii CIP 102972]
 gi|260615952|gb|EEX41137.1| flagellar basal-body rod modification protein FlgD [Vibrio
          furnissii CIP 102972]
 gi|315179625|gb|ADT86539.1| flagellar basal body rod modification protein D [Vibrio furnissii
          NCTC 11218]
          Length = 226

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 32/47 (68%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          Q+ F+ L++ QI++QDP  P+  +E V QLA FSQ++    M+S +Q
Sbjct: 38 QNEFISLMVAQIQNQDPLNPLDGTEYVGQLAQFSQVQSMENMSSLMQ 84


>gi|227112520|ref|ZP_03826176.1| flagellar basal body rod modification protein [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 227

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q+ FL LL+ Q+K+QDPT PM   + V+QLA  + +    ++N+TL  +   + +N   Q
Sbjct: 35  QNQFLTLLVAQLKNQDPTNPMSNDQLVSQLAQLNTVSGIEKLNTTLGSISGQINNNQSMQ 94

Query: 82  ASSYIGKNI 90
           A++ IG ++
Sbjct: 95  ATTLIGHSV 103


>gi|228952132|ref|ZP_04114227.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228807664|gb|EEM54188.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
          Length = 190

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 58/123 (47%), Gaps = 6/123 (4%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQ 71
           S  K+   + +D FLKL +   +HQDP   M  ++   Q AQL++  Q++   +    LQ
Sbjct: 43  SNQKTPGIMDKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQ 102

Query: 72  ELLKSNNLAQASSYIGK---NITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
             + +  L     ++GK    I N    ++G V  ++++      + VDN  + +    R
Sbjct: 103 STMYTTALDGGMKFLGKYVRGINNKGEQVTGQVETVRLAENNDVQLIVDNQVVSLRFVER 162

Query: 129 ISN 131
           +S+
Sbjct: 163 VSD 165


>gi|62179693|ref|YP_216110.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|62127326|gb|AAX65029.1| flagellar biosynthesis, initiation of hook assembly [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|322714163|gb|EFZ05734.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
          Length = 232

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           NT V  T    S + S     Q +FL LL+ Q+K+QDPT P++ +E   QLA  S +   
Sbjct: 12  NTGVKTTTGSGSMTGSNAADLQSSFLTLLVAQLKNQDPTNPLQNNELTTQLAQISTVSGI 71

Query: 64  VQMNSTLQEL---LKSNNLAQASSYIGKNI 90
            ++N+TL  +   + ++   QA++ IG  +
Sbjct: 72  EKLNTTLGAISGQIDNSQSLQATTLIGHGV 101


>gi|118477188|ref|YP_894339.1| flagellar basal body rod modification protein [Bacillus
           thuringiensis str. Al Hakam]
 gi|225863611|ref|YP_002748989.1| flagellar hook assembly protein family protein [Bacillus cereus
           03BB102]
 gi|229183944|ref|ZP_04311160.1| Flagellar hook assembly protein [Bacillus cereus BGSC 6E1]
 gi|118416413|gb|ABK84832.1| basal-body rod modification protein [Bacillus thuringiensis str. Al
           Hakam]
 gi|225788388|gb|ACO28605.1| flagellar hook assembly protein family protein [Bacillus cereus
           03BB102]
 gi|228599596|gb|EEK57200.1| Flagellar hook assembly protein [Bacillus cereus BGSC 6E1]
          Length = 190

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 59/123 (47%), Gaps = 6/123 (4%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQ 71
           S  K+   + +D FLKL +   +HQDP   M  ++   Q AQL++  Q++   +    LQ
Sbjct: 43  STQKTPGIMDKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQ 102

Query: 72  ELLKSNNLAQASSYIGK---NITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
             + S  L     ++GK    ++N    ++G V  ++++      + VDN  + +    R
Sbjct: 103 STMYSTALDGGMKFLGKYVRGVSNNGKQVTGQVETVRLAENNDVQLIVDNQVVSLRFIER 162

Query: 129 ISN 131
           +S+
Sbjct: 163 VSD 165


>gi|30261750|ref|NP_844127.1| flagellar basal body rod modification protein [Bacillus anthracis
           str. Ames]
 gi|47526974|ref|YP_018323.1| flagellar basal body rod modification protein [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|49184582|ref|YP_027834.1| flagellar basal body rod modification protein [Bacillus anthracis
           str. Sterne]
 gi|49477316|ref|YP_035872.1| flagellar basal body rod modification protein [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|167633353|ref|ZP_02391678.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. A0442]
 gi|167639172|ref|ZP_02397445.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. A0193]
 gi|170686321|ref|ZP_02877543.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. A0465]
 gi|170706446|ref|ZP_02896906.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. A0389]
 gi|177650541|ref|ZP_02933508.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. A0174]
 gi|190566416|ref|ZP_03019334.1| flagellar hook assembly protein family protein [Bacillus anthracis
           Tsiankovskii-I]
 gi|196045133|ref|ZP_03112366.1| flagellar hook assembly protein family protein [Bacillus cereus
           03BB108]
 gi|218902867|ref|YP_002450701.1| flagellar hook assembly protein family protein [Bacillus cereus
           AH820]
 gi|228933036|ref|ZP_04095899.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228984837|ref|ZP_04145008.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229090714|ref|ZP_04221947.1| Flagellar hook assembly protein [Bacillus cereus Rock3-42]
 gi|229155323|ref|ZP_04283434.1| Flagellar hook assembly protein [Bacillus cereus ATCC 4342]
 gi|229600498|ref|YP_002866148.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. A0248]
 gi|254683243|ref|ZP_05147104.1| flagellar basal body rod modification protein [Bacillus anthracis
           str. CNEVA-9066]
 gi|254723829|ref|ZP_05185615.1| flagellar basal body rod modification protein [Bacillus anthracis
           str. A1055]
 gi|254734596|ref|ZP_05192308.1| flagellar basal body rod modification protein [Bacillus anthracis
           str. Western North America USA6153]
 gi|254741005|ref|ZP_05198693.1| flagellar basal body rod modification protein [Bacillus anthracis
           str. Kruger B]
 gi|254759784|ref|ZP_05211808.1| flagellar basal body rod modification protein [Bacillus anthracis
           str. Australia 94]
 gi|300117327|ref|ZP_07055117.1| flagellar basal body rod modification protein [Bacillus cereus SJ1]
 gi|301053290|ref|YP_003791501.1| flagellar hook assembly protein [Bacillus anthracis CI]
 gi|30255978|gb|AAP25613.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. Ames]
 gi|47502122|gb|AAT30798.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|49178509|gb|AAT53885.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. Sterne]
 gi|49328872|gb|AAT59518.1| basal-body rod modification protein [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|167512962|gb|EDR88335.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. A0193]
 gi|167531391|gb|EDR94069.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. A0442]
 gi|170128544|gb|EDS97411.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. A0389]
 gi|170670018|gb|EDT20759.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. A0465]
 gi|172083685|gb|EDT68745.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. A0174]
 gi|190562551|gb|EDV16518.1| flagellar hook assembly protein family protein [Bacillus anthracis
           Tsiankovskii-I]
 gi|196024135|gb|EDX62809.1| flagellar hook assembly protein family protein [Bacillus cereus
           03BB108]
 gi|218537170|gb|ACK89568.1| flagellar hook assembly protein family protein [Bacillus cereus
           AH820]
 gi|228628248|gb|EEK84964.1| Flagellar hook assembly protein [Bacillus cereus ATCC 4342]
 gi|228692656|gb|EEL46382.1| Flagellar hook assembly protein [Bacillus cereus Rock3-42]
 gi|228774889|gb|EEM23284.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228826637|gb|EEM72408.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|229264906|gb|ACQ46543.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. A0248]
 gi|298725162|gb|EFI65814.1| flagellar basal body rod modification protein [Bacillus cereus SJ1]
 gi|300375459|gb|ADK04363.1| flagellar hook assembly protein [Bacillus cereus biovar anthracis
           str. CI]
          Length = 190

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 59/123 (47%), Gaps = 6/123 (4%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQ 71
           S  K+   + +D FLKL +   +HQDP   M  ++   Q AQL++  Q++   +    LQ
Sbjct: 43  STQKTPGIMDKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQ 102

Query: 72  ELLKSNNLAQASSYIGK---NITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
             + S  L     ++GK    ++N    ++G V  ++++      + VDN  + +    R
Sbjct: 103 STMYSTALDGGMKFLGKYVRGVSNNGKQVTGQVETVRLAENNDVQLIVDNQVVSLRFIER 162

Query: 129 ISN 131
           +S+
Sbjct: 163 VSD 165


>gi|16760052|ref|NP_455669.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|16764532|ref|NP_460147.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|29142177|ref|NP_805519.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|56413837|ref|YP_150912.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|161614601|ref|YP_001588566.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167553036|ref|ZP_02346786.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|168234102|ref|ZP_02659160.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168237258|ref|ZP_02662316.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|168244775|ref|ZP_02669707.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168264031|ref|ZP_02686004.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168467128|ref|ZP_02700970.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|168822619|ref|ZP_02834619.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194446242|ref|YP_002040430.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194450049|ref|YP_002045175.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194471560|ref|ZP_03077544.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194734983|ref|YP_002114175.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197249054|ref|YP_002146867.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197264764|ref|ZP_03164838.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197362760|ref|YP_002142397.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|198243981|ref|YP_002215961.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|200391018|ref|ZP_03217629.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204930747|ref|ZP_03221620.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205353086|ref|YP_002226887.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|207857316|ref|YP_002243967.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|213026535|ref|ZP_03340982.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Typhi str. 404ty]
 gi|213161845|ref|ZP_03347555.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213419884|ref|ZP_03352950.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
 gi|213424679|ref|ZP_03357444.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213582036|ref|ZP_03363862.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213648925|ref|ZP_03378978.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|213865506|ref|ZP_03387625.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|289828581|ref|ZP_06546406.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|60392285|sp|P0A1I9|FLGD_SALTY RecName: Full=Basal-body rod modification protein flgD
 gi|60392286|sp|P0A1J0|FLGD_SALTI RecName: Full=Basal-body rod modification protein flgD
 gi|25355188|pir||AI0639 flagellar hook formation protein FlgD [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|534883|dbj|BAA04982.1| flagella [Salmonella enterica subsp. enterica serovar Typhimurium]
 gi|16419693|gb|AAL20106.1| flagellar biosynthesis protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16502346|emb|CAD08300.1| flagellar hook formation protein FlgD [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29137807|gb|AAO69368.1| flagellar hook formation protein FlgD [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56128094|gb|AAV77600.1| flagellar hook formation protein FlgD [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|161363965|gb|ABX67733.1| hypothetical protein SPAB_02351 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404905|gb|ACF65127.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194408353|gb|ACF68572.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194457924|gb|EDX46763.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194710485|gb|ACF89706.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|195630307|gb|EDX48933.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|197094237|emb|CAR59742.1| flagellar hook formation protein FlgD [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197212757|gb|ACH50154.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197243019|gb|EDY25639.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197289802|gb|EDY29163.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|197938497|gb|ACH75830.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|199603463|gb|EDZ02009.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204320206|gb|EDZ05410.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205272867|emb|CAR37796.1| flagellar hook formation protein FlgD [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205322429|gb|EDZ10268.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|205331933|gb|EDZ18697.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|205336417|gb|EDZ23181.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205341045|gb|EDZ27809.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|205347362|gb|EDZ33993.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|206709119|emb|CAR33452.1| flagellar hook formation protein FlgD [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|261246387|emb|CBG24196.1| flagellar hook formation protein FlgD [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267992950|gb|ACY87835.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301157717|emb|CBW17209.1| flagellar hook formation protein FlgD [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312912163|dbj|BAJ36137.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|320086384|emb|CBY96157.1| Basal-body rod modification protein flgD [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321223794|gb|EFX48857.1| Flagellar basal-body rod modification protein FlgD [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|322616546|gb|EFY13455.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322620513|gb|EFY17377.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322622507|gb|EFY19352.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322629658|gb|EFY26433.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322632622|gb|EFY29368.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322636883|gb|EFY33586.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322641579|gb|EFY38217.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322644069|gb|EFY40615.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322650031|gb|EFY46449.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322653956|gb|EFY50279.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322658488|gb|EFY54750.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322663346|gb|EFY59548.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322670080|gb|EFY66220.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674856|gb|EFY70947.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322676674|gb|EFY72741.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322682596|gb|EFY78615.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322686651|gb|EFY82630.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|323129446|gb|ADX16876.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|323195765|gb|EFZ80941.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323198343|gb|EFZ83447.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323203173|gb|EFZ88203.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323209176|gb|EFZ94113.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323209680|gb|EFZ94609.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323217864|gb|EGA02579.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323222152|gb|EGA06536.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323224924|gb|EGA09182.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323229666|gb|EGA13789.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323232891|gb|EGA16987.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323240626|gb|EGA24668.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323242940|gb|EGA26961.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323250257|gb|EGA34146.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323252632|gb|EGA36470.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323258840|gb|EGA42493.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323261029|gb|EGA44622.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323266938|gb|EGA50423.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323269979|gb|EGA53428.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
 gi|326623709|gb|EGE30054.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
 gi|326628166|gb|EGE34509.1| basal-body rod modification protein FlgD [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
          Length = 232

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           NT V  T    S + S     Q +FL LL+ Q+K+QDPT P++ +E   QLA  S +   
Sbjct: 12  NTGVKTTTGSGSMTGSNAADLQSSFLTLLVAQLKNQDPTNPLQNNELTTQLAQISTVSGI 71

Query: 64  VQMNSTLQEL---LKSNNLAQASSYIGKNI 90
            ++N+TL  +   + ++   QA++ IG  +
Sbjct: 72  EKLNTTLGAISGQIDNSQSLQATTLIGHGV 101


>gi|65319022|ref|ZP_00391981.1| COG1843: Flagellar hook capping protein [Bacillus anthracis str.
           A2012]
          Length = 190

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 59/123 (47%), Gaps = 6/123 (4%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQ 71
           S  K+   + +D FLKL +   +HQDP   M  ++   Q AQL++  Q++   +    LQ
Sbjct: 43  STQKTPGIMDKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQ 102

Query: 72  ELLKSNNLAQASSYIGK---NITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
             + S  L     ++GK    ++N    ++G V  ++++      + VDN  + +    R
Sbjct: 103 STMYSTALDGGMKFLGKYVRGVSNNGKQVTGQVETVRLAENNDVQLIVDNQVVSLRFIER 162

Query: 129 ISN 131
           +S+
Sbjct: 163 VSD 165


>gi|30019796|ref|NP_831427.1| flagellar basal body rod modification protein [Bacillus cereus ATCC
           14579]
 gi|229127078|ref|ZP_04256077.1| Flagellar hook assembly protein [Bacillus cereus BDRD-Cer4]
 gi|229144364|ref|ZP_04272770.1| Flagellar hook assembly protein [Bacillus cereus BDRD-ST24]
 gi|229149955|ref|ZP_04278183.1| Flagellar hook assembly protein [Bacillus cereus m1550]
 gi|296502352|ref|YP_003664052.1| flagellar basal body rod modification protein [Bacillus
           thuringiensis BMB171]
 gi|29895341|gb|AAP08628.1| Basal-body rod modification protein flgD [Bacillus cereus ATCC
           14579]
 gi|228633636|gb|EEK90237.1| Flagellar hook assembly protein [Bacillus cereus m1550]
 gi|228639151|gb|EEK95575.1| Flagellar hook assembly protein [Bacillus cereus BDRD-ST24]
 gi|228656431|gb|EEL12270.1| Flagellar hook assembly protein [Bacillus cereus BDRD-Cer4]
 gi|296323404|gb|ADH06332.1| flagellar basal body rod modification protein [Bacillus
           thuringiensis BMB171]
          Length = 190

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 58/123 (47%), Gaps = 6/123 (4%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQ 71
           S  K+   + +D FLKL +   +HQDP   M  ++   Q AQL++  Q++   +    LQ
Sbjct: 43  SNQKTPGIMDKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQ 102

Query: 72  ELLKSNNLAQASSYIGK---NITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
             + +  L     ++GK    I N    ++G V  ++++      + VDN  + +    R
Sbjct: 103 STMYTTALDGGMKFLGKYVRGINNKGEQVTGQVETVRLAENNDVQLIVDNQVVSLRFVER 162

Query: 129 ISN 131
           +S+
Sbjct: 163 VSD 165


>gi|162419120|ref|YP_001606472.1| flagellar basal body rod modification protein [Yersinia pestis
          Angola]
 gi|162351935|gb|ABX85883.1| basal-body rod modification protein FlgD [Yersinia pestis Angola]
          Length = 225

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
          Q+ FL LL+ Q+K+QDPT PM+ +E   QLA  + +    ++N+TL  +   + S+    
Sbjct: 29 QNRFLTLLVAQLKNQDPTNPMENNELTTQLAQINTVSGIEKLNTTLGAITGQIDSSQSLY 88

Query: 82 ASSYIGKNI 90
          A+S IG+ +
Sbjct: 89 ATSLIGRGV 97


>gi|22126391|ref|NP_669814.1| flagellar basal body rod modification protein [Yersinia pestis
          KIM 10]
 gi|45441410|ref|NP_992949.1| flagellar basal body rod modification protein [Yersinia pestis
          biovar Microtus str. 91001]
 gi|108807172|ref|YP_651088.1| flagellar basal body rod modification protein [Yersinia pestis
          Antiqua]
 gi|108812484|ref|YP_648251.1| flagellar basal body rod modification protein [Yersinia pestis
          Nepal516]
 gi|145598611|ref|YP_001162687.1| flagellar basal body rod modification protein [Yersinia pestis
          Pestoides F]
 gi|149366252|ref|ZP_01888287.1| basal-body rod modification protein FlgD [Yersinia pestis
          CA88-4125]
 gi|165925901|ref|ZP_02221733.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Orientalis str. F1991016]
 gi|165938661|ref|ZP_02227216.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Orientalis str. IP275]
 gi|166010833|ref|ZP_02231731.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Antiqua str. E1979001]
 gi|166210989|ref|ZP_02237024.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Antiqua str. B42003004]
 gi|167401100|ref|ZP_02306603.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Antiqua str. UG05-0454]
 gi|167420264|ref|ZP_02312017.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167425865|ref|ZP_02317618.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|167469719|ref|ZP_02334423.1| flagellar basal body rod modification protein [Yersinia pestis
          FV-1]
 gi|218928921|ref|YP_002346796.1| flagellar basal body rod modification protein [Yersinia pestis
          CO92]
 gi|229896241|ref|ZP_04511411.1| basal-body rod modification protein FlgD [Yersinia pestis
          Pestoides A]
 gi|229897176|ref|ZP_04512332.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229897902|ref|ZP_04513053.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229902866|ref|ZP_04517983.1| basal-body rod modification protein FlgD [Yersinia pestis
          Nepal516]
 gi|270486646|ref|ZP_06203720.1| flagellar hook capping protein [Yersinia pestis KIM D27]
 gi|294504031|ref|YP_003568093.1| basal-body rod modification protein FlgD [Yersinia pestis
          Z176003]
 gi|21959378|gb|AAM86065.1|AE013854_1 basal-body rod modification protein [Yersinia pestis KIM 10]
 gi|45436271|gb|AAS61826.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Microtus str. 91001]
 gi|108776132|gb|ABG18651.1| basal-body rod modification protein FlgD [Yersinia pestis
          Nepal516]
 gi|108779085|gb|ABG13143.1| basal-body rod modification protein FlgD [Yersinia pestis
          Antiqua]
 gi|115347532|emb|CAL20441.1| basal-body rod modification protein FlgD [Yersinia pestis CO92]
 gi|145210307|gb|ABP39714.1| basal-body rod modification protein FlgD [Yersinia pestis
          Pestoides F]
 gi|149292665|gb|EDM42739.1| basal-body rod modification protein FlgD [Yersinia pestis
          CA88-4125]
 gi|165913275|gb|EDR31897.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Orientalis str. IP275]
 gi|165922105|gb|EDR39282.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Orientalis str. F1991016]
 gi|165990177|gb|EDR42478.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Antiqua str. E1979001]
 gi|166208169|gb|EDR52649.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Antiqua str. B42003004]
 gi|166961959|gb|EDR57980.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167049489|gb|EDR60897.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Antiqua str. UG05-0454]
 gi|167055264|gb|EDR65061.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|229680313|gb|EEO76412.1| basal-body rod modification protein FlgD [Yersinia pestis
          Nepal516]
 gi|229688943|gb|EEO81008.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229693513|gb|EEO83562.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229701164|gb|EEO89193.1| basal-body rod modification protein FlgD [Yersinia pestis
          Pestoides A]
 gi|262361783|gb|ACY58504.1| basal-body rod modification protein FlgD [Yersinia pestis
          D106004]
 gi|262366081|gb|ACY62638.1| basal-body rod modification protein FlgD [Yersinia pestis
          D182038]
 gi|270335150|gb|EFA45927.1| flagellar hook capping protein [Yersinia pestis KIM D27]
 gi|294354490|gb|ADE64831.1| basal-body rod modification protein FlgD [Yersinia pestis
          Z176003]
 gi|320015468|gb|ADV99039.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Medievalis str. Harbin 35]
          Length = 225

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
          Q+ FL LL+ Q+K+QDPT PM+ +E   QLA  + +    ++N+TL  +   + S+    
Sbjct: 29 QNRFLTLLVAQLKNQDPTNPMENNELTTQLAQINTVSGIEKLNTTLGAITGQIDSSQSLY 88

Query: 82 ASSYIGKNI 90
          A+S IG+ +
Sbjct: 89 ATSLIGRGV 97


>gi|150019074|ref|YP_001311328.1| flagellar hook capping protein [Clostridium beijerinckii NCIMB
          8052]
 gi|149905539|gb|ABR36372.1| flagellar hook capping protein [Clostridium beijerinckii NCIMB
          8052]
          Length = 339

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 37/55 (67%)

Query: 18 KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE 72
          K+  T+ +++FLK+L  Q+ + DPT+   +S  V+Q+A F+ MEQ   +N+T+ +
Sbjct: 30 KTDNTMDKNSFLKILSAQLSNLDPTQNQDSSAYVSQMAQFASMEQMQNLNTTMSD 84


>gi|229043507|ref|ZP_04191217.1| Flagellar hook assembly protein [Bacillus cereus AH676]
 gi|228725885|gb|EEL77132.1| Flagellar hook assembly protein [Bacillus cereus AH676]
          Length = 190

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 56/123 (45%), Gaps = 6/123 (4%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST---LQ 71
           S  K+   + +D FLKL +   +HQDP   M  ++ + Q A  S MEQ   M      LQ
Sbjct: 43  SNQKTPGIMDKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQ 102

Query: 72  ELLKSNNLAQASSYIGK---NITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
             + +  L     ++GK    I N    ++G V  ++++      + VDN  + +    R
Sbjct: 103 STMYTTALDGGMKFLGKYVRGINNKGEQVTGQVETVRLAENNDVQLIVDNQVVSLRFVER 162

Query: 129 ISN 131
           +S+
Sbjct: 163 VSD 165


>gi|224584320|ref|YP_002638118.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|224468847|gb|ACN46677.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
          Length = 232

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           NT V  T    S + S     Q +FL LL+ Q+K+QDPT P++ +E   QLA  S +   
Sbjct: 12  NTGVKTTTGSGSMTGSNAADLQSSFLTLLVAQLKNQDPTNPLQNNELTTQLAQISTVSGI 71

Query: 64  VQMNSTLQEL---LKSNNLAQASSYIGKNI 90
            ++N+TL  +   + ++   QA++ IG  +
Sbjct: 72  EKLNTTLGAISGQIDNSQSLQATTLIGHGV 101


>gi|52143705|ref|YP_083123.1| flagellar basal body rod modification protein [Bacillus cereus
           E33L]
 gi|228945355|ref|ZP_04107710.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|51977174|gb|AAU18724.1| basal-body rod modification protein [Bacillus cereus E33L]
 gi|228814327|gb|EEM60593.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
          Length = 190

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 59/123 (47%), Gaps = 6/123 (4%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQ 71
           S  K+   + +D FLKL +   +HQDP   M  ++   Q AQL++  Q++   +    LQ
Sbjct: 43  STQKTPGIMDKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQ 102

Query: 72  ELLKSNNLAQASSYIGK---NITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
             + S  L     ++GK    ++N    ++G V  ++++      + VDN  + +    R
Sbjct: 103 STMYSTALDGGMKFLGKYVRGVSNNGKQVTGQVETVRLAENNDVQLIVDNQVVSLRFIER 162

Query: 129 ISN 131
           +S+
Sbjct: 163 VSD 165


>gi|165869506|ref|ZP_02214165.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. A0488]
 gi|227815487|ref|YP_002815496.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. CDC 684]
 gi|254755248|ref|ZP_05207282.1| flagellar basal body rod modification protein [Bacillus anthracis
           str. Vollum]
 gi|164714946|gb|EDR20464.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. A0488]
 gi|227007323|gb|ACP17066.1| flagellar hook assembly protein family protein [Bacillus anthracis
           str. CDC 684]
          Length = 198

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 59/123 (47%), Gaps = 6/123 (4%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQ 71
           S  K+   + +D FLKL +   +HQDP   M  ++   Q AQL++  Q++   +    LQ
Sbjct: 43  STQKTPGIMDKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQ 102

Query: 72  ELLKSNNLAQASSYIGK---NITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
             + S  L     ++GK    ++N    ++G V  ++++      + VDN  + +    R
Sbjct: 103 STMYSTALDGGMKFLGKYVRGVSNNGKQVTGQVETVRLAENNDVQLIVDNQVVSLRFIER 162

Query: 129 ISN 131
           +S+
Sbjct: 163 VSD 165


>gi|291532059|emb|CBK97644.1| Flagellar hook capping protein [Eubacterium siraeum 70/3]
          Length = 224

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 63/123 (51%), Gaps = 13/123 (10%)

Query: 14  FSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
           F  S    T+  D F  LL+ ++ +QDP EP   +E V+Q+A F+ ++         Q+ 
Sbjct: 21  FKNSGKNDTISTDTFFSLLMAEMSNQDPLEPTSNTEFVSQMAQFTALQAQ-------QDN 73

Query: 74  LKSNNLAQASSYIGKNIT-NA---DGS-ISGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
           LK +    A+  +GK +T NA   DG+ +SGV   + +S + +  + VD  +  ++    
Sbjct: 74  LKYSMSNYAAGLVGKTLTMNAQSDDGTLLSGVCTGVNISGSDV-KVVVDGKQYDLSAVKA 132

Query: 129 ISN 131
           IS+
Sbjct: 133 ISD 135


>gi|237731006|ref|ZP_04561487.1| flagellar hook protein FlgE [Citrobacter sp. 30_2]
 gi|226906545|gb|EEH92463.1| flagellar hook protein FlgE [Citrobacter sp. 30_2]
          Length = 232

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT P++ +E   QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 33  QSSFLTLLVAQLKNQDPTNPLQNNELTTQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 92

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 93  ASTLIGHGV 101


>gi|167750724|ref|ZP_02422851.1| hypothetical protein EUBSIR_01702 [Eubacterium siraeum DSM 15702]
 gi|167656403|gb|EDS00533.1| hypothetical protein EUBSIR_01702 [Eubacterium siraeum DSM 15702]
          Length = 224

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 63/123 (51%), Gaps = 13/123 (10%)

Query: 14  FSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
           F  S    T+  D F  LL+ ++ +QDP EP   +E V+Q+A F+ ++         Q+ 
Sbjct: 21  FKNSGKNDTISTDTFFSLLMAEMSNQDPLEPTSNTEFVSQMAQFTALQAQ-------QDN 73

Query: 74  LKSNNLAQASSYIGKNIT-NA---DGS-ISGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
           LK +    A+  +GK +T NA   DG+ +SGV   + +S + +  + VD  +  ++    
Sbjct: 74  LKYSMSNYAAGLVGKTLTMNAQSDDGTLLSGVCTGVNISGSDV-KVVVDGKQYDLSAVKA 132

Query: 129 ISN 131
           IS+
Sbjct: 133 ISD 135


>gi|182418374|ref|ZP_02949669.1| flagellar hook assembly protein FlgD [Clostridium butyricum 5521]
 gi|237666720|ref|ZP_04526705.1| flagellar hook capping protein [Clostridium butyricum E4 str.
          BoNT E BL5262]
 gi|182377756|gb|EDT75300.1| flagellar hook assembly protein FlgD [Clostridium butyricum 5521]
 gi|237657919|gb|EEP55474.1| flagellar hook capping protein [Clostridium butyricum E4 str.
          BoNT E BL5262]
          Length = 308

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 34/51 (66%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          LGQ+AFL +L+ ++ + DPT+   ++  V Q+A F+ +EQ   +N+T++  
Sbjct: 25 LGQNAFLNILVAELSNMDPTKDQDSTAYVTQMAEFASIEQLNNLNTTMKNF 75


>gi|332531617|ref|ZP_08407514.1| flagellar hook capping protein [Hylemonella gracilis ATCC 19624]
 gi|332038980|gb|EGI75409.1| flagellar hook capping protein [Hylemonella gracilis ATCC 19624]
          Length = 237

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           QD FLKLL+ QI +QDP  PM  ++  +Q+A  + +     +N T++ L     S  + Q
Sbjct: 32  QDRFLKLLVAQISNQDPLNPMDNAQMTSQMAQINTVTGIENLNQTVKNLGNQFTSMQVLQ 91

Query: 82  ASSYIGKNITNADGSIS 98
            ++ +G+ +  AD ++S
Sbjct: 92  GTALVGREVMVADTTLS 108


>gi|219682253|ref|YP_002468637.1| basal-body rod modification protein FlgD [Buchnera aphidicola str.
           Tuc7 (Acyrthosiphon pisum)]
 gi|219621986|gb|ACL30142.1| basal-body rod modification protein FlgD [Buchnera aphidicola str.
           Tuc7 (Acyrthosiphon pisum)]
 gi|311086077|gb|ADP66159.1| basal-body rod modification protein FlgD [Buchnera aphidicola str.
           LL01 (Acyrthosiphon pisum)]
 gi|311086648|gb|ADP66729.1| basal-body rod modification protein FlgD [Buchnera aphidicola str.
           TLW03 (Acyrthosiphon pisum)]
 gi|311087234|gb|ADP67314.1| basal-body rod modification protein FlgD [Buchnera aphidicola str.
           JF99 (Acyrthosiphon pisum)]
          Length = 236

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FL LLI QIK+QDPT+P+K S+  +QLA  +      ++N+T+ +    +  N   Q
Sbjct: 43  QKNFLSLLIAQIKNQDPTDPIKNSDLTSQLAQINTASGMQKLNNTVDQFSNQISKNQNIQ 102

Query: 82  ASSYIGKNI 90
            S+ IG+++
Sbjct: 103 LSTLIGRHV 111


>gi|291558203|emb|CBL35320.1| Flagellar hook capping protein [Eubacterium siraeum V10Sc8a]
          Length = 224

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 63/123 (51%), Gaps = 13/123 (10%)

Query: 14  FSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
           F  S    T+  D F  LL+ ++ +QDP EP   +E V+Q+A F+ ++         Q+ 
Sbjct: 21  FKNSGKNDTISTDTFFSLLMAEMSNQDPLEPTSNTEFVSQMAQFTALQAQ-------QDN 73

Query: 74  LKSNNLAQASSYIGKNIT-NA---DGS-ISGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
           LK +    A+  +GK +T NA   DG+ +SGV   + +S + +  + VD  +  ++    
Sbjct: 74  LKYSMSNYAAGLVGKTLTMNAQSDDGTLLSGVCTGVSISGSDV-KVVVDGKQYDLSAVKA 132

Query: 129 ISN 131
           IS+
Sbjct: 133 ISD 135


>gi|283833631|ref|ZP_06353372.1| basal-body rod modification protein FlgD [Citrobacter youngae ATCC
           29220]
 gi|291071314|gb|EFE09423.1| basal-body rod modification protein FlgD [Citrobacter youngae ATCC
           29220]
          Length = 232

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT P++ +E   QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 33  QSSFLTLLVAQLKNQDPTNPLQNNELTTQLAQISTVSGIEKLNTTLGSISGQIDNSQSLQ 92

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 93  ASTLIGHGV 101


>gi|311087753|gb|ADP67832.1| basal-body rod modification protein FlgD [Buchnera aphidicola str.
           JF98 (Acyrthosiphon pisum)]
          Length = 236

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FL LLI QIK+QDPT+P+K S+  +QLA  +      ++N+T+ +    +  N   Q
Sbjct: 43  QKNFLSLLIAQIKNQDPTDPIKNSDLTSQLAQINTASGMQKLNNTVDQFSNQISKNQNIQ 102

Query: 82  ASSYIGKNI 90
            S+ IG+++
Sbjct: 103 LSTLIGRHV 111


>gi|15616945|ref|NP_240158.1| basal-body rod modification protein FlgD [Buchnera aphidicola str.
           APS (Acyrthosiphon pisum)]
 gi|219681698|ref|YP_002468084.1| basal-body rod modification protein FlgD [Buchnera aphidicola str.
           5A (Acyrthosiphon pisum)]
 gi|257471394|ref|ZP_05635393.1| basal-body rod modification protein FlgD [Buchnera aphidicola str.
           LSR1 (Acyrthosiphon pisum)]
 gi|11386806|sp|P57421|FLGD_BUCAI RecName: Full=Basal-body rod modification protein flgD
 gi|25355178|pir||D84969 basal-body rod modification protein flgD [imported] - Buchnera sp.
           (strain APS)
 gi|10039010|dbj|BAB13044.1| basal-body rod modification protein flgD [Buchnera aphidicola str.
           APS (Acyrthosiphon pisum)]
 gi|219624541|gb|ACL30696.1| basal-body rod modification protein FlgD [Buchnera aphidicola str.
           5A (Acyrthosiphon pisum)]
          Length = 236

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FL LLI QIK+QDPT+P+K S+  +QLA  +      ++N+T+ +    +  N   Q
Sbjct: 43  QKNFLSLLIAQIKNQDPTDPIKNSDLTSQLAQINTASGMQKLNNTVDQFSNQISKNQNIQ 102

Query: 82  ASSYIGKNI 90
            S+ IG+++
Sbjct: 103 LSTLIGRHV 111


>gi|268589983|ref|ZP_06124204.1| basal-body rod modification protein FlgD [Providencia rettgeri DSM
           1131]
 gi|291314701|gb|EFE55154.1| basal-body rod modification protein FlgD [Providencia rettgeri DSM
           1131]
          Length = 285

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
           +D FLK+++TQ+++QDPT+PM+ ++   Q+AQ+A    M +     S + + + S    Q
Sbjct: 35  RDTFLKMIVTQMQNQDPTKPMENTDLTSQLAQIATLESMNKLSDSVSGISQQIGSGQSLQ 94

Query: 82  ASSYIGKNI 90
           A+  +GK +
Sbjct: 95  ATQLVGKGV 103


>gi|308063737|gb|ADO05624.1| flagellar basal body rod modification protein [Helicobacter
          pylori Sat464]
          Length = 309

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AFLKL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFLKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|88811800|ref|ZP_01127054.1| flagellar basal body rod modification protein [Nitrococcus
          mobilis Nb-231]
 gi|88791191|gb|EAR22304.1| flagellar basal body rod modification protein [Nitrococcus
          mobilis Nb-231]
          Length = 221

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
          QD FLK+++ Q+++Q+P +PM   E + Q+A F+      Q+ S+ Q     ++SN   Q
Sbjct: 28 QDDFLKMMVAQLQNQNPLKPMSNGEFLTQIAQFTSASGIEQLQSSFQAFQTNMQSNLALQ 87

Query: 82 ASSYIGKNI 90
          A+S +G+ +
Sbjct: 88 AASLVGRQV 96


>gi|157146227|ref|YP_001453546.1| flagellar basal body rod modification protein [Citrobacter koseri
           ATCC BAA-895]
 gi|157083432|gb|ABV13110.1| hypothetical protein CKO_01984 [Citrobacter koseri ATCC BAA-895]
          Length = 232

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT P++ +E   QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 33  QSSFLTLLVAQLKNQDPTNPLQNNELTTQLAQISTVSGIEKLNTTLGAISGQIDNSQSLQ 92

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 93  ASTLIGHGV 101


>gi|83950599|ref|ZP_00959332.1| Possible FlgD protein [Roseovarius nubinhibens ISM]
 gi|83838498|gb|EAP77794.1| Possible FlgD protein [Roseovarius nubinhibens ISM]
          Length = 227

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 10 TQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST 69
          TQ E   S    +   + FLK+L  Q+++QDP  P++ ++   QLA FS +EQ V+ N  
Sbjct: 21 TQAESDSSSRAISADFETFLKMLTVQMRNQDPLNPVEGTDFAVQLATFSTVEQQVRTNDL 80

Query: 70 LQEL 73
          L  L
Sbjct: 81 LGAL 84


>gi|196039031|ref|ZP_03106338.1| flagellar hook capping protein [Bacillus cereus NVH0597-99]
 gi|228926788|ref|ZP_04089856.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|229121304|ref|ZP_04250535.1| Flagellar hook assembly protein [Bacillus cereus 95/8201]
 gi|196030176|gb|EDX68776.1| flagellar hook capping protein [Bacillus cereus NVH0597-99]
 gi|228662149|gb|EEL17758.1| Flagellar hook assembly protein [Bacillus cereus 95/8201]
 gi|228832901|gb|EEM78470.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 190

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 58/120 (48%), Gaps = 6/120 (5%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELL 74
           K+   + +D FLKL +   +HQDP   M  ++   Q AQL++  Q++   +    LQ  +
Sbjct: 46  KTPGIMDKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDKLQSTM 105

Query: 75  KSNNLAQASSYIGK---NITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            S  L     ++GK    ++N    ++G V  ++++      + VDN  + +    R+S+
Sbjct: 106 YSTALDGGMKFLGKYVRGVSNNGKQVTGQVETVRLAENNDVQLIVDNQVVSLRFIERVSD 165


>gi|28900121|ref|NP_799776.1| flagellar basal body rod modification protein [Vibrio
          parahaemolyticus RIMD 2210633]
 gi|153837050|ref|ZP_01989717.1| flagellar basal body rod modification protein [Vibrio
          parahaemolyticus AQ3810]
 gi|260365771|ref|ZP_05778267.1| flagellar basal body rod modification protein [Vibrio
          parahaemolyticus K5030]
 gi|260880693|ref|ZP_05893048.1| flagellar basal body rod modification protein [Vibrio
          parahaemolyticus AN-5034]
 gi|260897701|ref|ZP_05906197.1| flagellar basal body rod modification protein [Vibrio
          parahaemolyticus Peru-466]
 gi|260899388|ref|ZP_05907783.1| flagellar basal body rod modification protein [Vibrio
          parahaemolyticus AQ4037]
 gi|1272367|gb|AAA97475.1| LfgD [Vibrio parahaemolyticus]
 gi|28808404|dbj|BAC61609.1| LfgD [Vibrio parahaemolyticus RIMD 2210633]
 gi|149749638|gb|EDM60383.1| flagellar basal body rod modification protein [Vibrio
          parahaemolyticus AQ3810]
 gi|308086232|gb|EFO35927.1| flagellar basal body rod modification protein [Vibrio
          parahaemolyticus Peru-466]
 gi|308091965|gb|EFO41660.1| flagellar basal body rod modification protein [Vibrio
          parahaemolyticus AN-5034]
 gi|308109288|gb|EFO46828.1| flagellar basal body rod modification protein [Vibrio
          parahaemolyticus AQ4037]
 gi|308114994|gb|EFO52534.1| flagellar basal body rod modification protein [Vibrio
          parahaemolyticus K5030]
 gi|328470100|gb|EGF41011.1| flagellar basal body rod modification protein [Vibrio
          parahaemolyticus 10329]
          Length = 227

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          Q+ F+ L++ QI++QDP  P+  +E V QLA FSQ++ +  M+  +Q
Sbjct: 39 QNEFISLMVAQIQNQDPLNPLDGTEYVGQLAQFSQVQSTENMSKVMQ 85


>gi|308062225|gb|ADO04113.1| flagellar basal body rod modification protein [Helicobacter
          pylori Cuz20]
          Length = 319

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AFLKL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFLKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|332296629|ref|YP_004438552.1| flagellar hook capping protein [Thermodesulfobium narugense DSM
           14796]
 gi|332179732|gb|AEE15421.1| flagellar hook capping protein [Thermodesulfobium narugense DSM
           14796]
          Length = 139

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 45/73 (61%), Gaps = 2/73 (2%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSY 85
           +AFL LLI Q+K+QDP + M  +E + +L+  +  +Q   M++++Q  + + N   A++ 
Sbjct: 32  NAFLTLLIAQLKNQDPLDAMSTNEFMNELSALTTTQQMTNMSNSVQNSMTNINNLYATNL 91

Query: 86  IGKNI--TNADGS 96
           IGK I  T AD S
Sbjct: 92  IGKKIQYTAADNS 104


>gi|315453408|ref|YP_004073678.1| flagellar hook assembly protein [Helicobacter felis ATCC 49179]
 gi|315132460|emb|CBY83088.1| flagellar hook assembly protein [Helicobacter felis ATCC 49179]
          Length = 375

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 52/94 (55%), Gaps = 11/94 (11%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           L +DAF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T++E+    N  Q+
Sbjct: 28  LDKDAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEESKKTMKEVA---NAMQS 84

Query: 83  SSYIGKNITNADGSI--------SGVVNAIQVSS 108
           S    +++ +  G +         G+ N+++ S+
Sbjct: 85  SKETNQSLKDFQGKLKDTLEHLDKGMDNSLKASA 118


>gi|254499107|ref|ZP_05111797.1| Putative flagellar hook capping protein [Legionella drancourtii
           LLAP12]
 gi|254351646|gb|EET10491.1| Putative flagellar hook capping protein [Legionella drancourtii
           LLAP12]
          Length = 123

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 55/96 (57%), Gaps = 4/96 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           +GQ  ++K+ + ++ +QDP +P+   E +AQ+A FS ++Q+   N  L +L++ +   + 
Sbjct: 10  VGQADYMKVFMQELTYQDPLKPIDNREFMAQMAQFSTLQQASASNENLMKLIQLHYGNRG 69

Query: 83  SSYIGKN--ITNADGSISGVVNAIQVSSTGLTAITV 116
            S +G +  IT  +G   G+V AI+ +   +  + +
Sbjct: 70  LSLLGHSVKITGEEG--YGLVEAIRFTEEQMPEVRI 103


>gi|156934441|ref|YP_001438357.1| flagellar basal body rod modification protein [Cronobacter
           sakazakii ATCC BAA-894]
 gi|156532695|gb|ABU77521.1| hypothetical protein ESA_02272 [Cronobacter sakazakii ATCC BAA-894]
          Length = 226

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 5/70 (7%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL----QELLKSNNLA 80
           Q +FL LL+ Q+K+QDPT PM+ +E   QLA  S +    ++N+TL     ++  S +LA
Sbjct: 34  QSSFLTLLVAQLKNQDPTNPMQNNELTTQLAQISTVSGIEKLNTTLGSISGQIDNSQSLA 93

Query: 81  QASSYIGKNI 90
            AS+ IG  +
Sbjct: 94  -ASALIGHGV 102


>gi|188527732|ref|YP_001910419.1| flagellar basal body rod modification protein [Helicobacter
          pylori Shi470]
 gi|188143972|gb|ACD48389.1| flagellar basal body rod modification protein [Helicobacter
          pylori Shi470]
          Length = 324

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AFLKL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFLKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|82544459|ref|YP_408406.1| flagellar basal body rod modification protein [Shigella boydii
           Sb227]
 gi|81245870|gb|ABB66578.1| initiation of hook assembly [Shigella boydii Sb227]
 gi|320186978|gb|EFW61691.1| Flagellar basal-body rod modification protein FlgD [Shigella
           flexneri CDC 796-83]
 gi|332094132|gb|EGI99184.1| basal-body rod modification protein flgD [Shigella boydii 3594-74]
          Length = 231

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E   Q+AQ++  S +E+   M  ++   + ++   Q
Sbjct: 32  QSSFLTLLVAQLKNQDPTNPMENNELTSQLAQISTVSGIEKLNTMLGSISGQIDNSQSLQ 91

Query: 82  ASSYIGKNI 90
           AS+ IG  +
Sbjct: 92  ASNLIGHGV 100


>gi|260597444|ref|YP_003210015.1| flagellar basal body rod modification protein [Cronobacter
          turicensis z3032]
 gi|260216621|emb|CBA29915.1| Basal-body rod modification protein flgD [Cronobacter turicensis
          z3032]
          Length = 202

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 5/70 (7%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL----QELLKSNNLA 80
          Q +FL LL+ Q+K+QDPT PM+ +E   QLA  S +    ++N+TL     ++  S +LA
Sbjct: 10 QSSFLTLLVAQLKNQDPTNPMQNNELTTQLAQISTVSGIEKLNTTLGSISGQIDNSQSLA 69

Query: 81 QASSYIGKNI 90
           AS+ IG  +
Sbjct: 70 -ASALIGHGV 78


>gi|134297199|ref|YP_001120934.1| flagellar basal body rod modification protein [Burkholderia
           vietnamiensis G4]
 gi|134140356|gb|ABO56099.1| flagellar hook capping protein [Burkholderia vietnamiensis G4]
          Length = 248

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+NS+L  L   L +    Q
Sbjct: 39  QATFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNSSLSSLSTQLAAGQQTQ 98

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 99  AALLIGTNV 107


>gi|86747890|ref|YP_484386.1| flagellar hook capping protein [Rhodopseudomonas palustris HaA2]
 gi|86570918|gb|ABD05475.1| Flagellar hook capping protein [Rhodopseudomonas palustris HaA2]
          Length = 220

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%), Gaps = 3/67 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN---LAQASS 84
          F+ LLIT++++Q+P EP   ++ V QL  ++  EQ   +N+ L  L  S N      +S+
Sbjct: 31 FMTLLITELQNQNPLEPTSTTDFVNQLTSYANYEQQQTLNANLTTLTTSLNSLLTLNSSN 90

Query: 85 YIGKNIT 91
          YIG+ +T
Sbjct: 91 YIGQTVT 97


>gi|300716217|ref|YP_003741020.1| flagellar biosynthesis, initiation of hook assembly [Erwinia
          billingiae Eb661]
 gi|299062053|emb|CAX59169.1| Flagellar biosynthesis, initiation of hook assembly [Erwinia
          billingiae Eb661]
          Length = 223

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
          Q  FL LL+TQ+++QDPT PM  S+   QLA  + +    ++N+TL  +   + S    Q
Sbjct: 31 QSNFLTLLVTQLQNQDPTNPMDNSQLTTQLAQINTLSGIEKLNTTLGSISGQINSGQSLQ 90

Query: 82 ASSYIGKNI 90
          A++ IG  +
Sbjct: 91 ATTLIGHGV 99


>gi|89902476|ref|YP_524947.1| flagellar hook capping protein [Rhodoferax ferrireducens T118]
 gi|89347213|gb|ABD71416.1| flagellar hook capping protein [Rhodoferax ferrireducens T118]
          Length = 223

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           QD FLKLL+ Q+ +QDP  PM  ++  +Q+A  + +    Q+N TL+ +     S  + Q
Sbjct: 36  QDRFLKLLVAQLNNQDPMNPMDNAQMTSQMAQINTVTGIQQVNETLKSMAAQFTSLQVLQ 95

Query: 82  ASSYIGKNI 90
            +S +G N+
Sbjct: 96  GASMVGHNV 104


>gi|237751427|ref|ZP_04581907.1| flagellar basal body rod modification protein [Helicobacter bilis
          ATCC 43879]
 gi|229372793|gb|EEO23184.1| flagellar basal body rod modification protein [Helicobacter bilis
          ATCC 43879]
          Length = 507

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 36/54 (66%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
          L +DAF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T++E+ ++
Sbjct: 28 LDKDAFMKLFLEQLKNQDPTSPMETDKIITQTAQLTQVEMQEENKKTMKEVAQA 81


>gi|262276418|ref|ZP_06054227.1| flagellar basal-body rod modification protein FlgD [Grimontia
           hollisae CIP 101886]
 gi|262220226|gb|EEY71542.1| flagellar basal-body rod modification protein FlgD [Grimontia
           hollisae CIP 101886]
          Length = 248

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 51/90 (56%), Gaps = 11/90 (12%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQELLKSNNL 79
           L Q+ FL LL  Q+ +QDP +P+   + +AQ+A F+ ++   +MN    +L   + S+  
Sbjct: 41  LKQEDFLSLLTKQLANQDPFKPVDNEQMIAQMASFATVDGIGKMNEQFGSLNAAMTSSQA 100

Query: 80  AQASSYIGKNI--------TNADGSISGVV 101
            QASS +G+++         + +G I+G+V
Sbjct: 101 LQASSLVGQDVLVPGNEGFKSVEGGIAGMV 130


>gi|87119677|ref|ZP_01075574.1| flagellar basal body rod modification protein [Marinomonas sp.
           MED121]
 gi|86165153|gb|EAQ66421.1| flagellar basal body rod modification protein [Marinomonas sp.
           MED121]
          Length = 230

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 3/79 (3%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL- 73
           +K  SK     D F+ L I Q+K QDPT+P   ++ V+Q+A  S +E+   +++ L+ + 
Sbjct: 30  AKEDSKALTDTDVFMTLYIEQLKAQDPTDPQDTNKMVSQIAEMSSLEELSTISTQLESMT 89

Query: 74  --LKSNNLAQASSYIGKNI 90
             L S+    AS+ +G+ I
Sbjct: 90  SALTSSQAISASTLVGQKI 108


>gi|207092211|ref|ZP_03239998.1| flagellar basal body rod modification protein [Helicobacter
          pylori HPKX_438_AG0C1]
          Length = 311

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|84514660|ref|ZP_01002024.1| Possible FlgD protein [Loktanella vestfoldensis SKA53]
 gi|84511711|gb|EAQ08164.1| Possible FlgD protein [Loktanella vestfoldensis SKA53]
          Length = 183

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 38/60 (63%)

Query: 31 LLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIGKNI 90
          +L  Q+K+QDP  P+++++   QLA FS +EQ+V  N  L+ L     ++  +S++GK +
Sbjct: 1  MLTAQMKNQDPLNPVESADFATQLATFSGVEQAVLTNDLLRGLSLQIGVSGLASWVGKEV 60


>gi|291276998|ref|YP_003516770.1| flagellar-hook assembly protein FlgD [Helicobacter mustelae
          12198]
 gi|290964192|emb|CBG40038.1| Putative flagellar-hook assembly protein, FlgD [Helicobacter
          mustelae 12198]
          Length = 279

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (66%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          L +DAF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T++E+
Sbjct: 29 LDKDAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMKEV 79


>gi|317014316|gb|ADU81752.1| flagellar basal body rod modification protein [Helicobacter
          pylori Gambia94/24]
          Length = 301

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|254779510|ref|YP_003057616.1| flagellar basal body rod modification protein [Helicobacter
          pylori B38]
 gi|254001422|emb|CAX29417.1| Flagellar hook assembly protein FlgD [Helicobacter pylori B38]
          Length = 306

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|163744353|ref|ZP_02151713.1| Flagellar hook capping protein [Oceanibulbus indolifex HEL-45]
 gi|161381171|gb|EDQ05580.1| Flagellar hook capping protein [Oceanibulbus indolifex HEL-45]
          Length = 222

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 36/48 (75%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          ++FL LL  QI +QDP  P+ +++ V+QLA  +Q+EQS+  N++L+++
Sbjct: 30 NSFLTLLTAQISNQDPLNPVDSTQFVSQLAQLTQVEQSIATNASLEQI 77


>gi|114046837|ref|YP_737387.1| flagellar basal body rod modification protein [Shewanella sp. MR-7]
 gi|113888279|gb|ABI42330.1| flagellar hook capping protein [Shewanella sp. MR-7]
          Length = 256

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 48/85 (56%), Gaps = 4/85 (4%)

Query: 9   PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
           P+Q    ++KS++ L Q+ F  LL  Q+  QDP +P+   + +AQ+A FS ++   ++N 
Sbjct: 44  PSQSAVPEAKSQQ-LTQEDFFSLLSQQLSMQDPFKPVDNDQMIAQMASFSTVDGISKLND 102

Query: 69  ---TLQELLKSNNLAQASSYIGKNI 90
               L  ++ S+   QAS  +G+ +
Sbjct: 103 EIVNLNSVMTSSQALQASGLVGRKV 127


>gi|208434812|ref|YP_002266478.1| hook assembly protein, flagella [Helicobacter pylori G27]
 gi|208432741|gb|ACI27612.1| hook assembly protein, flagella [Helicobacter pylori G27]
          Length = 316

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|15645523|ref|NP_207699.1| flagellar basal body rod modification protein [Helicobacter
          pylori 26695]
 gi|2314043|gb|AAD07953.1| hook assembly protein, flagella (flgD) [Helicobacter pylori
          26695]
          Length = 301

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|308183060|ref|YP_003927187.1| flagellar basal body rod modification protein [Helicobacter
          pylori PeCan4]
 gi|308065245|gb|ADO07137.1| flagellar basal body rod modification protein [Helicobacter
          pylori PeCan4]
          Length = 306

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|295096226|emb|CBK85316.1| Flagellar hook capping protein [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 236

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT PM+ +E   QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 36  QSSFLTLLVAQLKNQDPTNPMQNNELTTQLAQISTVSGIEKLNTTLGSVSGQIDNSQSLQ 95

Query: 82  ASSYIGKNI 90
           A++ IG  +
Sbjct: 96  AANLIGHGV 104


>gi|33596139|ref|NP_883782.1| flagellar basal body rod modification protein [Bordetella
          parapertussis 12822]
 gi|33573142|emb|CAE36789.1| basal-body rod modification protein FlgD [Bordetella
          parapertussis]
          Length = 234

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ--- 81
          QD FL LL+TQ+++QDP  PM+ +E  +QLA  S +E    + +T+  +    +++Q   
Sbjct: 28 QDQFLTLLVTQLRNQDPLNPMENAELTSQLAQISTVEGINNLKNTMLAISGQIDVSQSMD 87

Query: 82 ASSYIGKNI 90
          A S IGK +
Sbjct: 88 AVSMIGKGV 96


>gi|317009563|gb|ADU80143.1| flagellar basal body rod modification protein [Helicobacter
          pylori India7]
          Length = 306

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|217032454|ref|ZP_03437947.1| hypothetical protein HPB128_175g15 [Helicobacter pylori B128]
 gi|298736141|ref|YP_003728666.1| Flagellar hook capping protein FlgD [Helicobacter pylori B8]
 gi|216945862|gb|EEC24482.1| hypothetical protein HPB128_175g15 [Helicobacter pylori B128]
 gi|298355330|emb|CBI66202.1| Flagellar hook capping protein FlgD [Helicobacter pylori B8]
          Length = 341

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|322378867|ref|ZP_08053284.1| flagellar basal body rod modification protein [Helicobacter suis
          HS1]
 gi|322380409|ref|ZP_08054615.1| flagellar basal body rod modification protein [Helicobacter suis
          HS5]
 gi|321147199|gb|EFX41893.1| flagellar basal body rod modification protein [Helicobacter suis
          HS5]
 gi|321148677|gb|EFX43160.1| flagellar basal body rod modification protein [Helicobacter suis
          HS1]
          Length = 446

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (66%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          L +DAF+KL + Q+K+QDPT PM+  + ++Q A  SQ+E   +    ++E+
Sbjct: 40 LNKDAFMKLFLEQLKNQDPTAPMETDKIISQTAQLSQVEMQEENKKAMKEV 90


>gi|33601540|ref|NP_889100.1| flagellar basal body rod modification protein [Bordetella
          bronchiseptica RB50]
 gi|33575976|emb|CAE33055.1| basal-body rod modification protein FlgD [Bordetella
          bronchiseptica RB50]
          Length = 234

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ--- 81
          QD FL LL+TQ+++QDP  PM+ +E  +QLA  S +E    + +T+  +    +++Q   
Sbjct: 28 QDQFLTLLVTQLRNQDPLNPMENAELTSQLAQISTVEGINNLKNTMLAISGQIDVSQSMD 87

Query: 82 ASSYIGKNI 90
          A S IGK +
Sbjct: 88 AVSMIGKGV 96


>gi|238028850|ref|YP_002913081.1| flagellar basal body rod modification protein [Burkholderia glumae
           BGR1]
 gi|237878044|gb|ACR30377.1| Flagellar hook capping protein [Burkholderia glumae BGR1]
          Length = 258

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q  FLKLL+TQ+++QDPT P+ +S+  +QLA  + +    Q+NS+L  L   + +    Q
Sbjct: 38  QQTFLKLLVTQLQNQDPTSPVDSSQMTSQLAQINTVSGIAQLNSSLSSLSSQITAGQQTQ 97

Query: 82  ASSYIGKNI 90
           A+  IG N+
Sbjct: 98  AALLIGSNV 106


>gi|33592478|ref|NP_880122.1| flagellar basal body rod modification protein [Bordetella
          pertussis Tohama I]
 gi|33572124|emb|CAE41666.1| basal-body rod modification protein FlgD [Bordetella pertussis
          Tohama I]
 gi|332381895|gb|AEE66742.1| flagellar basal body rod modification protein [Bordetella
          pertussis CS]
          Length = 234

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ--- 81
          QD FL LL+TQ+++QDP  PM+ +E  +QLA  S +E    + +T+  +    +++Q   
Sbjct: 28 QDQFLTLLVTQLRNQDPLNPMENAELTSQLAQISTVEGINNLKNTMLAISGQIDVSQSMD 87

Query: 82 ASSYIGKNI 90
          A S IGK +
Sbjct: 88 AVSMIGKGV 96


>gi|90422389|ref|YP_530759.1| flagellar hook capping protein [Rhodopseudomonas palustris
          BisB18]
 gi|90104403|gb|ABD86440.1| flagellar hook capping protein [Rhodopseudomonas palustris
          BisB18]
          Length = 218

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 41/67 (61%), Gaps = 3/67 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN---LAQASS 84
          FL LL+T++++Q+P +P   ++ V+Q+  ++  EQ   +N+ L  L  S N      +++
Sbjct: 29 FLTLLVTELQNQNPLDPTDTTDFVSQMTSYANFEQQQTLNTNLSSLATSFNSLLTLNSTN 88

Query: 85 YIGKNIT 91
          YIG+ +T
Sbjct: 89 YIGQTVT 95


>gi|221069323|ref|ZP_03545428.1| flagellar hook capping protein [Comamonas testosteroni KF-1]
 gi|220714346|gb|EED69714.1| flagellar hook capping protein [Comamonas testosteroni KF-1]
          Length = 220

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
          QD FLKLL+ Q+ +QDP  PM  +E  +Q+A  + +    Q+N T+  +     +  + Q
Sbjct: 30 QDRFLKLLVAQLNNQDPMNPMDNAEMTSQMAQINTVTGIQQLNQTMASMSSQFSAMQVLQ 89

Query: 82 ASSYIGKNI 90
           +S IG+ +
Sbjct: 90 GTSMIGRTV 98


>gi|317177696|dbj|BAJ55485.1| flagellar basal body rod modification protein [Helicobacter
          pylori F16]
          Length = 311

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|307637596|gb|ADN80046.1| Flagellar basal-body rod modification protein [Helicobacter
          pylori 908]
 gi|325996189|gb|ADZ51594.1| Flagellar basal-body rod modification protein [Helicobacter
          pylori 2018]
 gi|325997785|gb|ADZ49993.1| Flagellar basal-body rod modification protein [Helicobacter
          pylori 2017]
          Length = 325

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|260779348|ref|ZP_05888240.1| flagellar basal-body rod modification protein FlgD [Vibrio
          coralliilyticus ATCC BAA-450]
 gi|260605512|gb|EEX31807.1| flagellar basal-body rod modification protein FlgD [Vibrio
          coralliilyticus ATCC BAA-450]
          Length = 226

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 33/47 (70%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          ++ F+ L++ QI++QDP  P+  +E V+QLA FSQ++ +  M S +Q
Sbjct: 38 ENEFISLMVAQIQNQDPLNPLDGTEYVSQLAQFSQVQSTENMASMMQ 84


>gi|297380104|gb|ADI34991.1| hook assembly protein, flagella [Helicobacter pylori v225d]
          Length = 316

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|317012716|gb|ADU83324.1| flagellar basal body rod modification protein [Helicobacter
          pylori Lithuania75]
          Length = 316

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|317182207|dbj|BAJ59991.1| flagellar basal body rod modification protein [Helicobacter
          pylori F57]
          Length = 321

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|217034409|ref|ZP_03439823.1| hypothetical protein HP9810_884g14 [Helicobacter pylori 98-10]
 gi|216943140|gb|EEC22612.1| hypothetical protein HP9810_884g14 [Helicobacter pylori 98-10]
          Length = 324

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVANAMKSN 85


>gi|168186124|ref|ZP_02620759.1| flagellar hook assembly protein FlgD [Clostridium botulinum C str.
           Eklund]
 gi|169295774|gb|EDS77907.1| flagellar hook assembly protein FlgD [Clostridium botulinum C str.
           Eklund]
          Length = 274

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 40/68 (58%), Gaps = 7/68 (10%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           + ++AFLK+L  ++ +QDP     +++ ++QLA FS +EQ   +NST+       +   A
Sbjct: 64  MDKNAFLKILTAELTNQDPMNAKDSTQYISQLAQFSSLEQMANLNSTM-------SFNSA 116

Query: 83  SSYIGKNI 90
            S +GK +
Sbjct: 117 GSMVGKTV 124


>gi|108563314|ref|YP_627630.1| flagellar basal body rod modification protein [Helicobacter
          pylori HPAG1]
 gi|107837087|gb|ABF84956.1| hook assembly protein, flagella [Helicobacter pylori HPAG1]
          Length = 327

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|315586852|gb|ADU41233.1| hook assembly protein [Helicobacter pylori 35A]
          Length = 316

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|332673745|gb|AEE70562.1| hook assembly protein [Helicobacter pylori 83]
          Length = 319

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|226939375|ref|YP_002794448.1| flagellar hook capping protein [Laribacter hongkongensis HLHK9]
 gi|226714301|gb|ACO73439.1| flagellar hook capping protein [Laribacter hongkongensis HLHK9]
          Length = 239

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 10/81 (12%)

Query: 3  INTEVNPT---QQEFS-------KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVA 52
          + T VNPT   +  F+       K+KS+    QD FLKLLITQ++ QDP  P+   +  +
Sbjct: 1  MTTAVNPTSSTEDPFAGINGTNTKTKSEADEIQDRFLKLLITQLQTQDPLNPLDNYQMTS 60

Query: 53 QLAVFSQMEQSVQMNSTLQEL 73
          Q+A  S ++   ++NS++  L
Sbjct: 61 QMAQISSVQGIEKLNSSVSAL 81


>gi|153953784|ref|YP_001394549.1| hypothetical protein CKL_1159 [Clostridium kluyveri DSM 555]
 gi|219854400|ref|YP_002471522.1| hypothetical protein CKR_1057 [Clostridium kluyveri NBRC 12016]
 gi|146346665|gb|EDK33201.1| FlgD [Clostridium kluyveri DSM 555]
 gi|219568124|dbj|BAH06108.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 265

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 60/114 (52%), Gaps = 16/114 (14%)

Query: 20  KKTLGQDA----FLKLLITQIKHQDPTEPMK--ASEQVAQLAVFSQMEQSVQMNSTLQEL 73
           KK  G D     FLK+L  ++++QDPT+     ++E ++QLA FS ++Q + +N+T    
Sbjct: 62  KKNTGYDMDLNMFLKILCAELENQDPTDSSSQGSTEYISQLAQFSALQQMMNLNNT---- 117

Query: 74  LKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGI 127
              N +  A+S + K +T +D    G  N I     G+     D+ E+ + TGI
Sbjct: 118 ---NKVTTANSLVNKYVTLSDRDSEG--NYITGKVVGVVK-DGDDVELKLITGI 165


>gi|117919771|ref|YP_868963.1| flagellar basal body rod modification protein [Shewanella sp.
           ANA-3]
 gi|117612103|gb|ABK47557.1| basal-body rod modification protein FlgD [Shewanella sp. ANA-3]
          Length = 259

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 62/126 (49%), Gaps = 10/126 (7%)

Query: 9   PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
           PT     ++KS++ L Q+ F  LL  Q+  QDP +P+   + +AQ+A FS ++   ++N 
Sbjct: 47  PTSSAVPEAKSQQ-LTQEDFFSLLSQQLSMQDPFKPVDNDQMIAQMASFSTVDGISKLND 105

Query: 69  ---TLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITT 125
               L  ++ S+   QAS  +G+ +      +      I   S GL  +   + +IP+  
Sbjct: 106 QIVNLNSVMTSSQALQASGLVGRKVL-----LPTDTGYISAESPGLNGVISTSEKIPVIN 160

Query: 126 GIRISN 131
            +RI +
Sbjct: 161 -VRIED 165


>gi|210135098|ref|YP_002301537.1| flagellar basal body rod modification protein [Helicobacter
          pylori P12]
 gi|210133066|gb|ACJ08057.1| flagellar hook assembly protein [Helicobacter pylori P12]
          Length = 339

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|269960115|ref|ZP_06174491.1| Flagellar basal-body rod modification protein flgD [Vibrio
          harveyi 1DA3]
 gi|269835086|gb|EEZ89169.1| Flagellar basal-body rod modification protein flgD [Vibrio
          harveyi 1DA3]
          Length = 228

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 33/47 (70%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          Q+ F+ L++ QI++QDP  P+  +E V+QLA FSQ++ +  M+  +Q
Sbjct: 40 QNEFISLMVAQIQNQDPLNPLDGTEYVSQLAQFSQVQSTENMSMLMQ 86


>gi|119469949|ref|ZP_01612754.1| flagellar basal body rod modification protein D [Alteromonadales
           bacterium TW-7]
 gi|119446659|gb|EAW27932.1| flagellar basal body rod modification protein D [Alteromonadales
           bacterium TW-7]
          Length = 226

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNL 79
           L Q+ F  LL  Q+  QDP++P    + +AQ+  F+  E    +NS  + L   + SN+ 
Sbjct: 32  LTQEDFFSLLTQQLSFQDPSKPADNDQMIAQMTNFTMAEGISNLNSNFESLAASMTSNSA 91

Query: 80  AQASSYIGK 88
            QAS+ +GK
Sbjct: 92  LQASTLVGK 100


>gi|161503736|ref|YP_001570848.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865083|gb|ABX21706.1| hypothetical protein SARI_01821 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 232

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           Q +FL LL+ Q+K+QDPT P++ +E   QLA  S +    ++N+TL  +   + ++   Q
Sbjct: 33  QSSFLTLLVAQLKNQDPTNPLQNNELTTQLAQISTVSGIEKLNTTLGAISGQIDNSQSLQ 92

Query: 82  ASSYIGKNI 90
           A++ IG  +
Sbjct: 93  ATTLIGHGV 101


>gi|156976140|ref|YP_001447046.1| flagellar basal body rod modification protein [Vibrio harveyi
          ATCC BAA-1116]
 gi|156527734|gb|ABU72819.1| hypothetical protein VIBHAR_04911 [Vibrio harveyi ATCC BAA-1116]
          Length = 228

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 33/47 (70%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          Q+ F+ L++ QI++QDP  P+  +E V+QLA FSQ++ +  M+  +Q
Sbjct: 40 QNEFISLMVAQIQNQDPLNPLDGTEYVSQLAQFSQVQSTENMSMLMQ 86


>gi|153831740|ref|ZP_01984407.1| flagellar basal body rod modification protein [Vibrio harveyi
          HY01]
 gi|148872250|gb|EDL71067.1| flagellar basal body rod modification protein [Vibrio harveyi
          HY01]
          Length = 228

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 33/47 (70%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          Q+ F+ L++ QI++QDP  P+  +E V+QLA FSQ++ +  M+  +Q
Sbjct: 40 QNEFISLMVAQIQNQDPLNPLDGTEYVSQLAQFSQVQSTENMSMLMQ 86


>gi|238793997|ref|ZP_04637615.1| Flagellar hook capping protein [Yersinia intermedia ATCC 29909]
 gi|238726629|gb|EEQ18165.1| Flagellar hook capping protein [Yersinia intermedia ATCC 29909]
          Length = 230

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 33/49 (67%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          Q++FL LL+ Q+K+QDPT PM+ +E   QLA  + +    ++N+TL  +
Sbjct: 34 QNSFLTLLVAQLKNQDPTNPMQNNELTTQLAQINTVSGIEKLNTTLGSI 82


>gi|253681624|ref|ZP_04862421.1| flagellar hook assembly protein FlgD [Clostridium botulinum D str.
           1873]
 gi|253561336|gb|EES90788.1| flagellar hook assembly protein FlgD [Clostridium botulinum D str.
           1873]
          Length = 272

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 41/68 (60%), Gaps = 7/68 (10%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           + ++AFLK+L  ++ +QDP     +++ ++QLA FS +EQ   +NST+       +   A
Sbjct: 62  MDKNAFLKILTAELTNQDPMNAKDSTQYISQLAQFSSLEQMANLNSTM-------SFNSA 114

Query: 83  SSYIGKNI 90
           S+ +GK +
Sbjct: 115 SNMVGKTV 122


>gi|332533176|ref|ZP_08409045.1| flagellar basal-body rod modification protein FlgD
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332037458|gb|EGI73912.1| flagellar basal-body rod modification protein FlgD
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 226

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 3/81 (3%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           QQ  +       L Q+ F  LL  Q+ +QDP+ P    + +AQ+  F+  +    +N+  
Sbjct: 20  QQVATSDNESDALTQEDFFSLLTQQLSYQDPSNPADNDQMIAQMTSFTMAQGITDLNTNF 79

Query: 71  QEL---LKSNNLAQASSYIGK 88
           + L   + SN+  QAS+ +GK
Sbjct: 80  ESLASSMTSNSALQASTLVGK 100


>gi|238911004|ref|ZP_04654841.1| flagellar basal body rod modification protein [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
          Length = 232

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQM 60
           NT V  T    S + S     Q +FL LL+ Q+K+QDPT P++ +E   Q+AQ++  S +
Sbjct: 12  NTGVKTTTGSGSMTGSNAADLQSSFLTLLVAQLKNQDPTNPLQNNELTTQLAQISTVSGI 71

Query: 61  EQSVQMNSTLQELLKSNNLAQASSYIGKNI 90
           E+   M   +   + ++   QA++ IG  +
Sbjct: 72  EKLNTMLGAISGQIDNSQSLQATTLIGHGV 101


>gi|264676569|ref|YP_003276475.1| flagellar hook capping protein [Comamonas testosteroni CNB-2]
 gi|299531287|ref|ZP_07044697.1| flagellar hook capping protein [Comamonas testosteroni S44]
 gi|262207081|gb|ACY31179.1| flagellar hook capping protein [Comamonas testosteroni CNB-2]
 gi|298720694|gb|EFI61641.1| flagellar hook capping protein [Comamonas testosteroni S44]
          Length = 220

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
          QD FLKLL+ Q+ +QDP  PM  +E  +Q+A  + +    Q+N T+  +     +  + Q
Sbjct: 30 QDRFLKLLVAQLNNQDPMNPMDNAEMTSQMAQINTVTGIQQLNQTMASMSSQFTAMQVLQ 89

Query: 82 ASSYIGKNI 90
           +S IG+ +
Sbjct: 90 GTSMIGRTV 98


>gi|308184692|ref|YP_003928825.1| flagellar basal body rod modification protein [Helicobacter
          pylori SJM180]
 gi|308060612|gb|ADO02508.1| flagellar basal body rod modification protein [Helicobacter
          pylori SJM180]
          Length = 346

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|317178741|dbj|BAJ56529.1| flagellar basal body rod modification protein [Helicobacter
          pylori F30]
          Length = 329

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|261838283|gb|ACX98049.1| hook assembly protein [Helicobacter pylori 51]
          Length = 334

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|312884835|ref|ZP_07744527.1| flagellar basal body rod modification protein [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309367487|gb|EFP95047.1| flagellar basal body rod modification protein [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 223

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE---LLKSNNLAQ 81
           Q+ F+ L++ QI++QDP  P+  +E V+QLA FSQ++ +  M +  Q    LL +  +  
Sbjct: 35  QNEFISLMVAQIQNQDPLNPLDGTEYVSQLAQFSQVQSTENMTTMTQNSMVLLDNLQVLS 94

Query: 82  ASSYIGKNI 90
            ++ +GK +
Sbjct: 95  TANLVGKTV 103


>gi|238785498|ref|ZP_04629481.1| Flagellar hook capping protein [Yersinia bercovieri ATCC 43970]
 gi|238713600|gb|EEQ05629.1| Flagellar hook capping protein [Yersinia bercovieri ATCC 43970]
          Length = 230

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 33/49 (67%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          Q++FL LL+ Q+K+QDPT PM+ +E   QLA  + +    ++N+TL  +
Sbjct: 34 QNSFLTLLVAQLKNQDPTNPMQNNELTTQLAQINTVSGIEKLNTTLGSI 82


>gi|212709491|ref|ZP_03317619.1| hypothetical protein PROVALCAL_00533 [Providencia alcalifaciens DSM
           30120]
 gi|212687829|gb|EEB47357.1| hypothetical protein PROVALCAL_00533 [Providencia alcalifaciens DSM
           30120]
          Length = 288

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
           +D FLK+++TQ+++QDPT+PM  ++   Q+AQ+A    M +     + + + + S    Q
Sbjct: 35  RDTFLKMIVTQMQNQDPTKPMDNADLTGQLAQIATLESMNKLSDSVTGISQQIGSGQSLQ 94

Query: 82  ASSYIGKNI 90
           A+  +GK +
Sbjct: 95  ATQLVGKGV 103


>gi|317180243|dbj|BAJ58029.1| flagellar basal body rod modification protein [Helicobacter
          pylori F32]
          Length = 329

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|90577343|ref|ZP_01233154.1| flagellar basal body rod modification protein [Vibrio angustum
          S14]
 gi|90440429|gb|EAS65609.1| flagellar basal body rod modification protein [Vibrio angustum
          S14]
          Length = 225

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (65%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          ++ F+ L++ QI++QDP  P+  +E V QLA FSQ+E +  M   +Q
Sbjct: 37 KNEFINLMVAQIQNQDPLNPLDGTEYVGQLAQFSQVESTENMAKLMQ 83


>gi|330447902|ref|ZP_08311550.1| flagellar hook capping family protein [Photobacterium leiognathi
          subsp. mandapamensis svers.1.1.]
 gi|328492093|dbj|GAA06047.1| flagellar hook capping family protein [Photobacterium leiognathi
          subsp. mandapamensis svers.1.1.]
          Length = 225

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (65%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          ++ F+ L++ QI++QDP  P+  +E V QLA FSQ+E +  M   +Q
Sbjct: 37 KNEFINLMVAQIQNQDPLNPLDGTEYVGQLAQFSQVESTENMAKLMQ 83


>gi|121997320|ref|YP_001002107.1| flagellar hook capping protein [Halorhodospira halophila SL1]
 gi|121588725|gb|ABM61305.1| flagellar hook capping protein [Halorhodospira halophila SL1]
          Length = 293

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 44/73 (60%), Gaps = 3/73 (4%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
           +++G + FL+L++ Q+++QDPT+P    + + Q+A F+      Q+ S  +E    ++S+
Sbjct: 95  QSIGHEDFLELMMVQLQNQDPTDPQDTEQMMGQIAQFTTASGIEQLQSDFREFFEHMRSD 154

Query: 78  NLAQASSYIGKNI 90
              +AS  +G+ +
Sbjct: 155 QSLRASQLVGREV 167


>gi|238799106|ref|ZP_04642562.1| Flagellar hook capping protein [Yersinia mollaretii ATCC 43969]
 gi|238717053|gb|EEQ08913.1| Flagellar hook capping protein [Yersinia mollaretii ATCC 43969]
          Length = 230

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 33/49 (67%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          Q++FL LL+ Q+K+QDPT PM+ +E   QLA  + +    ++N+TL  +
Sbjct: 34 QNSFLTLLVAQLKNQDPTNPMQNNELTTQLAQINTVSGIEKLNTTLGSI 82


>gi|89072316|ref|ZP_01158895.1| flagellar basal body rod modification protein [Photobacterium sp.
          SKA34]
 gi|89051848|gb|EAR57300.1| flagellar basal body rod modification protein [Photobacterium sp.
          SKA34]
          Length = 226

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (65%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          ++ F+ L++ QI++QDP  P+  +E V QLA FSQ+E +  M   +Q
Sbjct: 37 KNEFINLMVAQIQNQDPLNPLDGTEYVGQLAQFSQVESTENMAKLMQ 83


>gi|188592116|ref|YP_001796714.1| flagellar basal body rod modification protein [Cupriavidus
          taiwanensis LMG 19424]
 gi|170938490|emb|CAP63477.1| FlgD: Basal-body rod modification protein [Cupriavidus
          taiwanensis LMG 19424]
          Length = 221

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 4/79 (5%)

Query: 15 SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
          S S S   L Q+ FL +L+TQ+ +QDP  PM  ++  +QLA  S +     MN+TL +LL
Sbjct: 20 SGSASASEL-QNNFLTMLVTQMNNQDPLNPMDNAQLTSQLAQISTVSGMQTMNATLSQLL 78

Query: 75 KSNNLAQA---SSYIGKNI 90
             + ++A   ++ IG+ +
Sbjct: 79 GQVSASRAMDSAALIGRTV 97


>gi|323492339|ref|ZP_08097492.1| flagellar basal body rod modification protein [Vibrio
          brasiliensis LMG 20546]
 gi|323313386|gb|EGA66497.1| flagellar basal body rod modification protein [Vibrio
          brasiliensis LMG 20546]
          Length = 226

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 34/47 (72%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          ++ F+ L++ QI++QDP  P+  +E V+QLA FSQ++ +  M++ +Q
Sbjct: 38 ENEFISLMVAQIQNQDPLNPLDGTEYVSQLAQFSQVQSTENMSTMMQ 84


>gi|15611910|ref|NP_223561.1| flagellar basal body rod modification protein [Helicobacter
          pylori J99]
 gi|4155413|gb|AAD06421.1| putative FLAGELLAR BIOSYNTHESIS PROTEIN [Helicobacter pylori J99]
          Length = 363

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|238764391|ref|ZP_04625341.1| Flagellar hook capping protein [Yersinia kristensenii ATCC 33638]
 gi|238697417|gb|EEP90184.1| Flagellar hook capping protein [Yersinia kristensenii ATCC 33638]
          Length = 228

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 33/49 (67%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          Q++FL LL+ Q+K+QDPT PM+ +E   QLA  + +    ++N+TL  +
Sbjct: 32 QNSFLTLLVAQLKNQDPTNPMQNNELTTQLAQINTVSGIEKLNTTLGSI 80


>gi|163750571|ref|ZP_02157809.1| flagellar basal body rod modification protein [Shewanella benthica
           KT99]
 gi|161329726|gb|EDQ00715.1| flagellar basal body rod modification protein [Shewanella benthica
           KT99]
          Length = 268

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 41/75 (54%), Gaps = 3/75 (4%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS---TLQELLK 75
           S + L QD F  LL  Q+  QDP +P+   + +AQ+A FS ++   ++N     L  ++ 
Sbjct: 65  SSQGLSQDDFFSLLSQQLSMQDPFKPVDNDQMIAQMAAFSTVDGISKLNDEIINLNAVMT 124

Query: 76  SNNLAQASSYIGKNI 90
           S+   QAS  +G+ +
Sbjct: 125 SSQALQASGLVGQKV 139


>gi|238796903|ref|ZP_04640407.1| Flagellar hook capping protein [Yersinia mollaretii ATCC 43969]
 gi|238719163|gb|EEQ10975.1| Flagellar hook capping protein [Yersinia mollaretii ATCC 43969]
          Length = 237

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 41/68 (60%), Gaps = 3/68 (4%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ---ELLKSNNLAQA 82
          ++F+ LL+ Q+++QDPT PM  ++  +QLA FS      Q+NST+     L+ S     A
Sbjct: 29 NSFMTLLVAQMQNQDPTNPMDNNQLTSQLAQFSTASGVQQLNSTVMAVGSLVTSMQQMNA 88

Query: 83 SSYIGKNI 90
          + ++G+ +
Sbjct: 89 ADWVGRQV 96


>gi|23011250|ref|ZP_00051667.1| COG1843: Flagellar hook capping protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 223

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 46/72 (63%), Gaps = 4/72 (5%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KSNNLAQASS 84
           FL LL TQ+K+Q+P +P+  ++   QL  F+ +EQ ++ N++L  +L   K++  + AS 
Sbjct: 32  FLTLLTTQLKNQNPLDPLDTNQFTQQLVQFAGVEQQLKTNASLDTILTNSKASAASSASG 91

Query: 85  YIGKNITNADGS 96
            IG+ +  ADG+
Sbjct: 92  LIGRTVV-ADGA 102


>gi|261839697|gb|ACX99462.1| flagellar basal body rod modification protein [Helicobacter
          pylori 52]
          Length = 354

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSN 77
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+   +KSN
Sbjct: 28 LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEVASAMKSN 85


>gi|224825163|ref|ZP_03698269.1| flagellar hook capping protein [Lutiella nitroferrum 2002]
 gi|224602834|gb|EEG09011.1| flagellar hook capping protein [Lutiella nitroferrum 2002]
          Length = 230

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 40/67 (59%), Gaps = 3/67 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ--- 81
           Q+ FL LL TQ+K QDP  PM+ +E  +Q+A  SQ+     ++ ++  LL+S    Q   
Sbjct: 34  QNRFLTLLTTQLKSQDPLNPMENNEITSQMAQISQVTGLENLSKSINSLLQSQYGTQSLL 93

Query: 82  ASSYIGK 88
           A+S +GK
Sbjct: 94  AASLVGK 100


>gi|24374759|ref|NP_718802.1| flagellar basal body rod modification protein [Shewanella
           oneidensis MR-1]
 gi|24349425|gb|AAN56246.1|AE015762_3 basal-body rod modification protein FlgD [Shewanella oneidensis
           MR-1]
          Length = 253

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 62/126 (49%), Gaps = 10/126 (7%)

Query: 9   PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
           P+     ++KS++ L Q+ F  LL  Q+  QDP +P+   + +AQ+A FS ++   ++N 
Sbjct: 41  PSNSAVPEAKSQQ-LTQEDFFSLLSQQLSMQDPFKPVDNDQMIAQMASFSTVDGISKLND 99

Query: 69  ---TLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITT 125
               L  ++ S+   QAS  +G+ +      +      I   S GL  +   + +IP+  
Sbjct: 100 QIVNLNSVMTSSQALQASGLVGRKVL-----LPTDTGYISAESPGLNGVISTSEKIPVIN 154

Query: 126 GIRISN 131
            IRI +
Sbjct: 155 -IRIED 159


>gi|238758111|ref|ZP_04619291.1| Flagellar hook capping protein [Yersinia aldovae ATCC 35236]
 gi|238703649|gb|EEP96186.1| Flagellar hook capping protein [Yersinia aldovae ATCC 35236]
          Length = 230

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 33/49 (67%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          Q++FL LL+ Q+K+QDPT PM+ +E   QLA  + +    ++N+TL  +
Sbjct: 34 QNSFLTLLVAQLKNQDPTNPMQNNELTTQLAQINTVSGIEKLNTTLGSI 82


>gi|213615927|ref|ZP_03371753.1| flagellar basal body rod modification protein [Salmonella
          enterica subsp. enterica serovar Typhi str. E98-2068]
          Length = 97

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%)

Query: 4  NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
          NT V  T    S + S     Q +FL LL+ Q+K+QDPT P++ +E   QLA  S +   
Sbjct: 12 NTGVKTTTGSGSMTGSNAADLQSSFLTLLVAQLKNQDPTNPLQNNELTTQLAQISTVSGI 71

Query: 64 VQMNSTL 70
           ++N+TL
Sbjct: 72 EKLNTTL 78


>gi|317047690|ref|YP_004115338.1| flagellar hook capping protein [Pantoea sp. At-9b]
 gi|316949307|gb|ADU68782.1| flagellar hook capping protein [Pantoea sp. At-9b]
          Length = 224

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 46/76 (60%), Gaps = 6/76 (7%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL----QELLKSNNLA 80
           Q+ FL +L+TQ+++QDPT PM  S+   QLA  + +    ++N+TL     ++  S NL 
Sbjct: 32  QNQFLTMLVTQLQNQDPTNPMDNSQLTTQLAQINTLSGIEKLNTTLGSISGQISTSQNL- 90

Query: 81  QASSYIGKNITNADGS 96
           Q+++ IG  +   DGS
Sbjct: 91  QSTTLIGHGVM-VDGS 105


>gi|149189835|ref|ZP_01868115.1| flagellar basal body rod modification protein D [Vibrio shilonii
          AK1]
 gi|148836321|gb|EDL53278.1| flagellar basal body rod modification protein D [Vibrio shilonii
          AK1]
          Length = 225

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 33/47 (70%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          Q+ F+ L++ QI++QDP  P+  +E V+QLA FSQ++ +  M+  +Q
Sbjct: 37 QNEFITLMVAQIQNQDPLNPLDGTEYVSQLAQFSQVQSTENMSMLMQ 83


>gi|224436454|ref|ZP_03657468.1| flagellar basal body rod modification protein [Helicobacter
          cinaedi CCUG 18818]
 gi|313142966|ref|ZP_07805159.1| flagellar basal body rod modification protein [Helicobacter
          cinaedi CCUG 18818]
 gi|313127997|gb|EFR45614.1| flagellar basal body rod modification protein [Helicobacter
          cinaedi CCUG 18818]
          Length = 273

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 37/62 (59%)

Query: 12 QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          +E  K ++   L  DAF++L + Q+K+QDPT PM+  + + Q A  +Q+E   Q   T+ 
Sbjct: 17 KEKEKVRNINELDNDAFMRLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEQNKKTMV 76

Query: 72 EL 73
          E+
Sbjct: 77 EV 78


>gi|85710163|ref|ZP_01041228.1| Flagellar hook capping protein [Erythrobacter sp. NAP1]
 gi|85688873|gb|EAQ28877.1| Flagellar hook capping protein [Erythrobacter sp. NAP1]
          Length = 117

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%)

Query: 16 KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          +  +  +L  + FL+L+  Q+ +QDP EP    + +AQLA FS +E      +TL E+
Sbjct: 27 RESAAASLDSEDFLRLMTAQLANQDPLEPQSNEQMLAQLAQFSNLENGTASRATLDEI 84


>gi|21672603|ref|NP_660670.1| basal-body rod modification protein FlgD [Buchnera aphidicola str.
           Sg (Schizaphis graminum)]
 gi|25008457|sp|Q8K9K7|FLGD_BUCAP RecName: Full=Basal-body rod modification protein flgD
 gi|21623234|gb|AAM67881.1| basal-body rod modification protein FlgD [Buchnera aphidicola str.
           Sg (Schizaphis graminum)]
          Length = 226

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%), Gaps = 5/70 (7%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL----QELLKSNNLA 80
           Q  FL LL+ Q+K+QDPT+P+K SE  +QLA  +      ++NST+     ++ +S N+ 
Sbjct: 32  QKNFLSLLMAQMKNQDPTDPIKNSELTSQLAQINTATGIERLNSTVGIFSNKINQSQNI- 90

Query: 81  QASSYIGKNI 90
           Q SS IG ++
Sbjct: 91  QVSSLIGHHV 100


>gi|308186392|ref|YP_003930523.1| Basal-body rod modification protein flgD [Pantoea vagans C9-1]
 gi|308056902|gb|ADO09074.1| Basal-body rod modification protein flgD [Pantoea vagans C9-1]
          Length = 224

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 3/74 (4%)

Query: 3  INTEVNPTQQEFSKSKSKKTLGQDA---FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
          +N +++PT    S +       QD    FL +L+TQ+K+QDPT PM  S+   QLA  + 
Sbjct: 7  VNEKLDPTVLSSSSTSGTGNNAQDLQNQFLTMLVTQLKNQDPTNPMDNSQLTTQLAQINT 66

Query: 60 MEQSVQMNSTLQEL 73
          +    ++N+TL  +
Sbjct: 67 LSGIEKLNTTLGSI 80


>gi|238788314|ref|ZP_04632108.1| Flagellar hook capping protein [Yersinia frederiksenii ATCC
          33641]
 gi|238723560|gb|EEQ15206.1| Flagellar hook capping protein [Yersinia frederiksenii ATCC
          33641]
          Length = 230

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 33/49 (67%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          Q++FL LL+ Q+K+QDPT PM+ +E   QLA  + +    ++N+TL  +
Sbjct: 34 QNSFLTLLVAQLKNQDPTNPMQNNELTTQLAQINTVSGIEKLNTTLGAI 82


>gi|331269320|ref|YP_004395812.1| flagellar hook assembly protein FlgD [Clostridium botulinum
           BKT015925]
 gi|329125870|gb|AEB75815.1| flagellar hook assembly protein FlgD [Clostridium botulinum
           BKT015925]
          Length = 275

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 40/68 (58%), Gaps = 7/68 (10%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           + ++AFLK+L  ++ +QDP     +++ ++QLA FS +EQ   +NST+       +   A
Sbjct: 65  MDKNAFLKILTAELTNQDPMNAKDSTQYISQLAQFSGLEQMANLNSTM-------SFNSA 117

Query: 83  SSYIGKNI 90
            S +GK +
Sbjct: 118 GSMVGKTL 125


>gi|296274023|ref|YP_003656654.1| flagellar hook capping protein [Arcobacter nitrofigilis DSM 7299]
 gi|296098197|gb|ADG94147.1| flagellar hook capping protein [Arcobacter nitrofigilis DSM 7299]
          Length = 156

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 63/109 (57%), Gaps = 3/109 (2%)

Query: 2   EINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME 61
           E+++  +   Q+++++ S   L  + FLKL++ Q+K QDPT+P  +   + Q    S ++
Sbjct: 5   EVSSVTDANGQQYTQAISNDKLTNEDFLKLMLEQMKQQDPTKPQDSQNMLNQQMQMSSIQ 64

Query: 62  QSVQMNSTLQEL---LKSNNLAQASSYIGKNITNADGSISGVVNAIQVS 107
            ++ M+++++ L    + ++L+ A++ I K +   +   +G++ +  VS
Sbjct: 65  TNLDMSNSMKALQATFQQSSLSNATNLINKIVDTGEVDDNGILKSYAVS 113


>gi|300722683|ref|YP_003711973.1| flagellar hook assembly initiation protein [Xenorhabdus
          nematophila ATCC 19061]
 gi|297629190|emb|CBJ89786.1| flagellar biosynthesis; initiation of hook assembly [Xenorhabdus
          nematophila ATCC 19061]
          Length = 233

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 36/58 (62%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
          +D FL LL+ Q+K+QDPT PM+ +E   Q+A  S ++   ++N TL  ++   +  QA
Sbjct: 34 KDNFLNLLVAQLKNQDPTNPMQNNELTTQIAQISTVQGVEKLNKTLGSIVGQMDHNQA 91


>gi|258625235|ref|ZP_05720147.1| Flagellar basal-body rod modification protein flgD [Vibrio
          mimicus VM603]
 gi|258582482|gb|EEW07319.1| Flagellar basal-body rod modification protein flgD [Vibrio
          mimicus VM603]
          Length = 227

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 32/47 (68%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          Q+ F+ +++ QI++QDP  P+  +E V+QLA FSQ++    M+  +Q
Sbjct: 42 QNEFITMMVAQIQNQDPLNPLDGTEYVSQLAQFSQVQSMENMSGLMQ 88


>gi|146293691|ref|YP_001184115.1| flagellar basal body rod modification protein [Shewanella
           putrefaciens CN-32]
 gi|145565381|gb|ABP76316.1| flagellar hook capping protein [Shewanella putrefaciens CN-32]
 gi|319427090|gb|ADV55164.1| flagellar hook capping protein [Shewanella putrefaciens 200]
          Length = 253

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 48/85 (56%), Gaps = 4/85 (4%)

Query: 9   PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
           PT+    ++KS++ L Q+ F  LL  Q+  QDP +P+   + +AQ+A FS ++   ++N 
Sbjct: 41  PTESIVPEAKSQQ-LTQEDFFSLLSQQLSMQDPFKPVDNDQMIAQMASFSTVDGISKLNK 99

Query: 69  ---TLQELLKSNNLAQASSYIGKNI 90
               L  ++ S+   QAS  +G+ +
Sbjct: 100 EIVNLNSVMTSSQALQASGLVGRKV 124


>gi|167770212|ref|ZP_02442265.1| hypothetical protein ANACOL_01555 [Anaerotruncus colihominis DSM
           17241]
 gi|167667534|gb|EDS11664.1| hypothetical protein ANACOL_01555 [Anaerotruncus colihominis DSM
           17241]
          Length = 249

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 7/76 (9%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSY 85
           D FL L++ Q+++QD   P+  ++ V QLA F+ M Q       +QEL  +     A S 
Sbjct: 53  DDFLSLMVAQLQNQDFMNPVDDTQYVTQLAQFATMSQ-------MQELAANMKNNYALSL 105

Query: 86  IGKNITNADGSISGVV 101
           +G N+T A  ++SG +
Sbjct: 106 VGTNVTAAKFAVSGAL 121


>gi|116694218|ref|YP_728429.1| flagellar basal body rod modification protein [Ralstonia eutropha
          H16]
 gi|113528717|emb|CAJ95064.1| flagellar basal body rod modification protein [Ralstonia eutropha
          H16]
          Length = 221

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 15 SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
          S S S   L Q+ FL +L+TQ+ +QDP  PM  ++  +QLA  S +     MN+TL +LL
Sbjct: 20 SGSASASEL-QNNFLTMLVTQMNNQDPLNPMDNAQLTSQLAQISTVSGMQTMNATLSQLL 78


>gi|32265683|ref|NP_859715.1| flagellar basal body rod modification protein [Helicobacter
          hepaticus ATCC 51449]
 gi|32261731|gb|AAP76781.1| flagellar hook assembly protein FlgD [Helicobacter hepaticus ATCC
          51449]
          Length = 273

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 4/72 (5%)

Query: 6  EVNPTQQEFSKSKSK----KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME 61
          EV  +  + +K K K      L  DAF++L + Q+K+QDPT PM+  + + Q A  +Q+E
Sbjct: 7  EVTGSAAKIAKEKEKVRNINELDNDAFMRLFLEQLKNQDPTAPMETDKIITQTAQLTQVE 66

Query: 62 QSVQMNSTLQEL 73
             Q   T+ E+
Sbjct: 67 MQEQNKKTMVEV 78


>gi|94312668|ref|YP_585877.1| flagellar hook capping protein [Cupriavidus metallidurans CH34]
 gi|93356520|gb|ABF10608.1| flagellar hook capping protein [Cupriavidus metallidurans CH34]
          Length = 222

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA-- 82
          Q+ FL +L+TQ+ +QDP  P+  S+  +QLA  S +     MN+T+ +LL+    ++A  
Sbjct: 30 QNQFLTMLVTQMNNQDPLNPLDNSQLTSQLAQISTVSGLQTMNTTMTQLLQQTAASRAMD 89

Query: 83 -SSYIGKNI 90
           ++ IGK +
Sbjct: 90 SANLIGKTV 98


>gi|319944136|ref|ZP_08018414.1| basal-body rod modification protein FlgD [Lautropia mirabilis ATCC
           51599]
 gi|319742630|gb|EFV95039.1| basal-body rod modification protein FlgD [Lautropia mirabilis ATCC
           51599]
          Length = 256

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 47/87 (54%), Gaps = 5/87 (5%)

Query: 7   VNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQM 66
            NP   +  +S +  T  +D FLKLL+ Q+++QDP  PM+ +E  +QLA  S +     +
Sbjct: 46  ANPNVNKNDESTADGT--EDRFLKLLVAQMRNQDPMNPMENAEVTSQLAQISTVRGIESL 103

Query: 67  NSTLQELLKS--NNLAQAS-SYIGKNI 90
           N ++     S   N A AS + IGK +
Sbjct: 104 NKSMANFTASAAQNTALASVNMIGKKV 130


>gi|308050025|ref|YP_003913591.1| flagellar hook capping protein [Ferrimonas balearica DSM 9799]
 gi|307632215|gb|ADN76517.1| flagellar hook capping protein [Ferrimonas balearica DSM 9799]
          Length = 222

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 27/37 (72%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME 61
          ++ FL L++ QI++QDP  P+  +E V QLA FSQ+E
Sbjct: 31 KNEFLTLMVAQIQNQDPLNPLDGTEYVTQLAQFSQVE 67


>gi|85060037|ref|YP_455739.1| putative flagellar hook formation protein FlgD [Sodalis
           glossinidius str. 'morsitans']
 gi|84780557|dbj|BAE75334.1| putative flagellar hook formation protein FlgD [Sodalis
           glossinidius str. 'morsitans']
          Length = 138

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 54/96 (56%), Gaps = 14/96 (14%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
           Q+ FL LL+ Q+++QDPT P+  +E   Q+AQ+++ S +E    +N+ L   + S NL Q
Sbjct: 32  QNNFLTLLVAQLRNQDPTNPLDNAELTTQLAQISILSSIE---NLNTMLGS-ISSQNL-Q 86

Query: 82  ASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVD 117
           A++ +G  +   DGS      A+  S  G  ++  D
Sbjct: 87  ATTLVGHGVM-VDGS-----GAVYYSRNGEFSLNAD 116


>gi|1857437|gb|AAC45655.1| FlgD [Proteus mirabilis]
          Length = 182

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 9  PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
          P+     K  S    G   FL LLITQ+++QDPT PM+ +E  +QLA  S +E    +N 
Sbjct: 14 PSSYHTKKGGSDDIKGN--FLTLLITQMQNQDPTNPMQNNELTSQLAQISTVEGIETLNK 71

Query: 69 TLQELLKSNNLAQA 82
          T+  ++   + +QA
Sbjct: 72 TVNTIVGQIDQSQA 85


>gi|160896080|ref|YP_001561662.1| flagellar hook capping protein [Delftia acidovorans SPH-1]
 gi|160361664|gb|ABX33277.1| flagellar hook capping protein [Delftia acidovorans SPH-1]
          Length = 220

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 15 SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL- 73
          S S +     QD FLKLL+ Q+ +QDP  PM  ++  +Q+A  + +    Q+N T++ + 
Sbjct: 21 SNSTTDPAAAQDRFLKLLVAQLNNQDPMNPMDNAQMTSQMAQINTVTGIQQLNKTMESMA 80

Query: 74 --LKSNNLAQASSYIGKNI 90
              +  + Q +  IG+ +
Sbjct: 81 GQFTAMQVLQGTQMIGRTV 99


>gi|118443090|ref|YP_877981.1| flagellar hook assembly protein FlgD [Clostridium novyi NT]
 gi|118133546|gb|ABK60590.1| flagellar hook assembly protein FlgD [Clostridium novyi NT]
          Length = 274

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 35/53 (66%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           K  + + ++AFLK+L  ++ +QDP     +++ ++QLA FS +EQ   +NST+
Sbjct: 59  KKGQEMDKNAFLKILTAELTNQDPMNAKDSTQYISQLAQFSSLEQMANLNSTM 111


>gi|227356002|ref|ZP_03840394.1| flagellar basal body rod modification protein [Proteus mirabilis
          ATCC 29906]
 gi|227163990|gb|EEI48892.1| flagellar basal body rod modification protein [Proteus mirabilis
          ATCC 29906]
          Length = 268

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 9  PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
          P+     K  S    G   FL LLITQ+++QDPT PM+ +E  +QLA  S +E    +N 
Sbjct: 20 PSSYHTKKGGSDDIKGN--FLTLLITQMQNQDPTNPMQNNELTSQLAQISTVEGIETLNK 77

Query: 69 TLQELLKSNNLAQA 82
          T+  ++   + +QA
Sbjct: 78 TVNTIVGQIDQSQA 91


>gi|119947178|ref|YP_944858.1| flagellar basal body rod modification protein [Psychromonas
          ingrahamii 37]
 gi|119865782|gb|ABM05259.1| flagellar basal-body rod modification protein FlgD [Psychromonas
          ingrahamii 37]
          Length = 230

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 30/45 (66%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE 72
          F+ L++ QI++QDP  P   +E V+QLA FSQ+E +  M S +Q 
Sbjct: 39 FITLMVAQIQNQDPLNPGDGTEYVSQLAQFSQVESAENMVSLMQR 83


>gi|322432990|ref|YP_004210239.1| flagellar hook capping protein [Acidobacterium sp. MP5ACTX9]
 gi|321165217|gb|ADW70921.1| flagellar hook capping protein [Acidobacterium sp. MP5ACTX9]
          Length = 162

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 30/43 (69%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
          FL LL+ ++++QDPT PM ++  V Q+   +Q++Q + +N TL
Sbjct: 54 FLNLLVKELQNQDPTAPMDSTAMVGQMISLNQLDQLISINQTL 96


>gi|261344143|ref|ZP_05971787.1| basal-body rod modification protein FlgD [Providencia rustigianii
           DSM 4541]
 gi|282567735|gb|EFB73270.1| basal-body rod modification protein FlgD [Providencia rustigianii
           DSM 4541]
          Length = 285

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 41/69 (59%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
           +D FL +++TQ+++QDPT+PM  ++   Q+AQ+A    M +     S + + + S    Q
Sbjct: 35  RDTFLTMIVTQMQNQDPTKPMDNADLTGQLAQIATLESMNKLSDSVSGISQQIGSGQSLQ 94

Query: 82  ASSYIGKNI 90
           A+  +GK +
Sbjct: 95  ATQLVGKGV 103


>gi|148980303|ref|ZP_01815990.1| flagellar basal body rod modification protein D [Vibrionales
          bacterium SWAT-3]
 gi|145961322|gb|EDK26632.1| flagellar basal body rod modification protein D [Vibrionales
          bacterium SWAT-3]
          Length = 222

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (62%), Gaps = 6/54 (11%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME------QSVQMNSTLQELLK 75
          F+ L++ QI++QDP  P   +E VAQLA FSQ+E      Q  Q NST+ + L+
Sbjct: 35 FITLMVAQIENQDPLNPTDGTEYVAQLAQFSQVESTENLVQLTQNNSTMLDNLQ 88


>gi|83593868|ref|YP_427620.1| flagellar hook capping protein [Rhodospirillum rubrum ATCC 11170]
 gi|83576782|gb|ABC23333.1| Flagellar hook capping protein [Rhodospirillum rubrum ATCC 11170]
          Length = 229

 Score = 43.9 bits (102), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 3/66 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN---LAQASS 84
          FL +L TQ+K+Q+P  P   +E   QL  +SQ+EQ +  N  L+ L+ S N      A +
Sbjct: 34 FLTVLTTQLKNQNPLNPTDPNEMTQQLISYSQVEQQILGNQYLENLVLSTNNQTAETALA 93

Query: 85 YIGKNI 90
          ++GK +
Sbjct: 94 FVGKEV 99


>gi|207110586|ref|ZP_03244748.1| flagellar basal body rod modification protein [Helicobacter
          pylori HPKX_438_CA4C1]
          Length = 95

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (66%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          L ++AF+KL + Q+K+QDPT PM+  + + Q A  +Q+E   +   T+QE+
Sbjct: 9  LDKNAFMKLFLEQLKNQDPTAPMETDKIITQTAQLTQVEMQEENKKTMQEV 59


>gi|295097204|emb|CBK86294.1| Flagellar hook capping protein [Enterobacter cloacae subsp.
          cloacae NCTC 9394]
          Length = 232

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST---LQELLKSNNLAQASS 84
          F+KLL+ Q+++QDPT PM  ++  +QLA F+      ++N++   +Q L+       A+S
Sbjct: 29 FMKLLVAQMQNQDPTNPMDNNQLTSQLAQFNTAAGVEKLNASVGNVQALMAQLGSMSAAS 88

Query: 85 YIGKNI 90
          ++G+ +
Sbjct: 89 WVGRGV 94


>gi|258622487|ref|ZP_05717509.1| Flagellar basal-body rod modification protein flgD [Vibrio
          mimicus VM573]
 gi|262173353|ref|ZP_06041030.1| flagellar basal-body rod modification protein FlgD [Vibrio
          mimicus MB-451]
 gi|258585187|gb|EEW09914.1| Flagellar basal-body rod modification protein flgD [Vibrio
          mimicus VM573]
 gi|261890711|gb|EEY36698.1| flagellar basal-body rod modification protein FlgD [Vibrio
          mimicus MB-451]
          Length = 227

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 32/47 (68%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          Q+ F+ +++ QI++QDP  P+  +E V+QLA FSQ++    M+  +Q
Sbjct: 42 QNEFITMMVAQIQNQDPLNPLDGTEYVSQLAQFSQVQSIENMSGLMQ 88


>gi|320107028|ref|YP_004182618.1| flagellar hook capping protein [Terriglobus saanensis SP1PR4]
 gi|319925549|gb|ADV82624.1| flagellar hook capping protein [Terriglobus saanensis SP1PR4]
          Length = 94

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 3  INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
          ++T  NPT      + S  T+  D F+ LL+ ++++QDPT P   ++ + QL   + ++Q
Sbjct: 19 MDTSTNPT-----TATSNDTITSDDFMTLLVAEMQNQDPTAPSDPTQYIQQLVGVNSLQQ 73

Query: 63 SVQMNSTLQELLKS 76
           + +N+ + EL  S
Sbjct: 74 LIGINTGIGELTSS 87


>gi|88704307|ref|ZP_01102021.1| flagellar basal-body rod modification protein FlgD [Congregibacter
           litoralis KT71]
 gi|88701358|gb|EAQ98463.1| flagellar basal-body rod modification protein FlgD [Congregibacter
           litoralis KT71]
          Length = 232

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 48/81 (59%), Gaps = 5/81 (6%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQASS 84
           FL L++ ++++QDPT P   S+ + QLA F  +    ++N++   L   L      QA+S
Sbjct: 33  FLALMVAELENQDPTNPNSNSDMMGQLAQFGTVSGIDELNASFGGLSSALTGGQALQAAS 92

Query: 85  YIGKNI-TNAD-GSISGVVNA 103
            +G+++ T+++ G ++G  NA
Sbjct: 93  LVGRSVMTDSNLGQLTGAANA 113


>gi|160939660|ref|ZP_02087008.1| hypothetical protein CLOBOL_04552 [Clostridium bolteae ATCC
           BAA-613]
 gi|158437451|gb|EDP15215.1| hypothetical protein CLOBOL_04552 [Clostridium bolteae ATCC
           BAA-613]
          Length = 233

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (54%), Gaps = 8/86 (9%)

Query: 14  FSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
           F     KK +  D FL L++ Q+K+QD   P+  ++ V QLA  S M+Q       ++E+
Sbjct: 86  FGDGDDKK-VSMDDFLTLMVAQLKNQDFMNPVDDTQYVTQLAQISTMQQ-------MEEM 137

Query: 74  LKSNNLAQASSYIGKNITNADGSISG 99
             +   +  +S +GKN++ A  ++SG
Sbjct: 138 AYNAKSSYVASLVGKNVSAAKFTVSG 163


>gi|217972597|ref|YP_002357348.1| flagellar basal body rod modification protein [Shewanella baltica
           OS223]
 gi|217497732|gb|ACK45925.1| flagellar hook capping protein [Shewanella baltica OS223]
          Length = 256

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 4/85 (4%)

Query: 9   PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
           P      ++KS++ L QD F  LL  Q+  QDP +P+   + +AQ+A FS ++   ++N 
Sbjct: 44  PKDSIVPEAKSQQ-LTQDDFFSLLSQQLSMQDPFKPVDNDQMIAQMASFSTVDGIGKLND 102

Query: 69  ---TLQELLKSNNLAQASSYIGKNI 90
               L  ++ S+   QAS  +G+ +
Sbjct: 103 EIVNLNSVMTSSQALQASGLVGRKV 127


>gi|197285511|ref|YP_002151383.1| basal-body rod modification protein [Proteus mirabilis HI4320]
 gi|194682998|emb|CAR43447.1| basal-body rod modification protein [Proteus mirabilis HI4320]
          Length = 264

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 9  PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
          P+     K  S    G   FL LLITQ+++QDPT PM+ +E  +QLA  S +E    +N 
Sbjct: 20 PSSYHTKKGGSDDIKGN--FLTLLITQMQNQDPTNPMQNNELTSQLAQISTVEGIETLNK 77

Query: 69 TLQELLKSNNLAQA 82
          T+  ++   + +QA
Sbjct: 78 TVNTIVGQIDQSQA 91


>gi|153001473|ref|YP_001367154.1| flagellar basal body rod modification protein [Shewanella baltica
           OS185]
 gi|160876204|ref|YP_001555520.1| flagellar basal body rod modification protein [Shewanella baltica
           OS195]
 gi|151366091|gb|ABS09091.1| flagellar hook capping protein [Shewanella baltica OS185]
 gi|160861726|gb|ABX50260.1| flagellar hook capping protein [Shewanella baltica OS195]
 gi|315268394|gb|ADT95247.1| flagellar hook capping protein [Shewanella baltica OS678]
          Length = 256

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 4/85 (4%)

Query: 9   PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
           P      ++KS++ L QD F  LL  Q+  QDP +P+   + +AQ+A FS ++   ++N 
Sbjct: 44  PKDSIVPEAKSQQ-LTQDDFFSLLSQQLSMQDPFKPVDNDQMIAQMASFSTVDGIGKLND 102

Query: 69  ---TLQELLKSNNLAQASSYIGKNI 90
               L  ++ S+   QAS  +G+ +
Sbjct: 103 QIVNLNSVMTSSQALQASGLVGRKV 127


>gi|237653584|ref|YP_002889898.1| flagellar hook capping protein [Thauera sp. MZ1T]
 gi|237624831|gb|ACR01521.1| flagellar hook capping protein [Thauera sp. MZ1T]
          Length = 224

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 39/66 (59%), Gaps = 3/66 (4%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK---SNNLAQASS 84
           FL LL TQ+K+QDP  PM+ +E  +QLA  S ++   ++N   Q  +    + +  QA++
Sbjct: 36  FLTLLTTQLKNQDPLNPMENAEVTSQLAQMSTVDGIERLNKMFQSFVDGQSAYDSMQAAA 95

Query: 85  YIGKNI 90
            +G+ +
Sbjct: 96  LVGRGV 101


>gi|254286493|ref|ZP_04961450.1| flagellar hook capping protein [Vibrio cholerae AM-19226]
 gi|150423442|gb|EDN15386.1| flagellar hook capping protein [Vibrio cholerae AM-19226]
          Length = 101

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 3/68 (4%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKS 76
           +K+L Q+ FL LL  Q+  QDP +P+   + +AQ+A F+ ++   +MN+  + L   + S
Sbjct: 33  QKSLKQEDFLSLLTKQLAQQDPFKPVSNDQMIAQMASFATVDGIGKMNTQFESLNSSMTS 92

Query: 77  NNLAQASS 84
           N   QASS
Sbjct: 93  NQALQASS 100


>gi|149191152|ref|ZP_01869410.1| flagellar basal body rod modification protein D [Vibrio shilonii
          AK1]
 gi|148834990|gb|EDL51969.1| flagellar basal body rod modification protein D [Vibrio shilonii
          AK1]
          Length = 221

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%), Gaps = 6/54 (11%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME------QSVQMNSTLQELLK 75
          F+ L++ QI++QDP  P   +E VAQLA FSQ+E      Q +Q N+T+ + L+
Sbjct: 35 FITLMVAQIENQDPLNPTDGTEYVAQLAQFSQVESTENLVQLMQNNTTMLDNLQ 88


>gi|326319096|ref|YP_004236768.1| flagellar hook capping protein [Acidovorax avenae subsp. avenae
          ATCC 19860]
 gi|323375932|gb|ADX48201.1| flagellar hook capping protein [Acidovorax avenae subsp. avenae
          ATCC 19860]
          Length = 216

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 15 SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ--- 71
          S S +     QD FLKLL+ Q+ +QDP  P+  ++  +Q+A  + +    Q+N ++Q   
Sbjct: 18 SNSATDPAAAQDRFLKLLVAQLNNQDPMNPLDNAQMTSQMAQINTVTGIQQLNLSMQTMA 77

Query: 72 ELLKSNNLAQASSYIGKNI 90
          E   +    Q +  IG+N+
Sbjct: 78 EQFTTMQTLQGTMMIGRNV 96


>gi|126175147|ref|YP_001051296.1| flagellar basal body rod modification protein [Shewanella baltica
           OS155]
 gi|125998352|gb|ABN62427.1| flagellar hook capping protein [Shewanella baltica OS155]
          Length = 256

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 4/85 (4%)

Query: 9   PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
           P      ++KS++ L QD F  LL  Q+  QDP +P+   + +AQ+A FS ++   ++N 
Sbjct: 44  PKDSIVPEAKSQQ-LTQDDFFSLLSQQLSMQDPFKPVDNDQMIAQMASFSTVDGIGKLND 102

Query: 69  ---TLQELLKSNNLAQASSYIGKNI 90
               L  ++ S+   QAS  +G+ +
Sbjct: 103 EIVNLNSVMTSSQALQASGLVGRKV 127


>gi|51597638|ref|YP_071829.1| flagellar basal body rod modification protein [Yersinia
          pseudotuberculosis IP 32953]
 gi|186896772|ref|YP_001873884.1| flagellar basal body rod modification protein [Yersinia
          pseudotuberculosis PB1/+]
 gi|51590920|emb|CAH22576.1| Possible FlgD-like basal-body rod modification protein [Yersinia
          pseudotuberculosis IP 32953]
 gi|186699798|gb|ACC90427.1| flagellar hook capping protein [Yersinia pseudotuberculosis
          PB1/+]
          Length = 218

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 4/55 (7%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
          F+ LL+ QIK+QDP  P   +E V+Q+A  SQ    VQ    + +LLKSN +  A
Sbjct: 33 FMTLLVAQIKNQDPLNPADGTEFVSQMAQLSQ----VQATENMAKLLKSNTVQMA 83


>gi|304409979|ref|ZP_07391598.1| flagellar hook capping protein [Shewanella baltica OS183]
 gi|307302308|ref|ZP_07582066.1| flagellar hook capping protein [Shewanella baltica BA175]
 gi|304351388|gb|EFM15787.1| flagellar hook capping protein [Shewanella baltica OS183]
 gi|306914346|gb|EFN44767.1| flagellar hook capping protein [Shewanella baltica BA175]
          Length = 256

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 3/71 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS---TLQELLKSNNL 79
           L QD F  LL  Q+  QDP +P+   + +AQ+A FS ++   ++N     L  ++ S+  
Sbjct: 57  LTQDDFFSLLSQQLSMQDPFKPVDNDQMIAQMASFSTVDGIGKLNDQIVNLNSVMTSSQA 116

Query: 80  AQASSYIGKNI 90
            QAS  +G+ +
Sbjct: 117 LQASGLVGRKV 127


>gi|152975164|ref|YP_001374681.1| flagellar basal body rod modification protein [Bacillus cereus
           subsp. cytotoxis NVH 391-98]
 gi|152023916|gb|ABS21686.1| flagellar hook capping protein [Bacillus cytotoxicus NVH 391-98]
          Length = 174

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 63/118 (53%), Gaps = 15/118 (12%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQELL 74
           K+   +G+D FLKL +T +++QDP   M   + + Q++  S MEQ   M    + L++ +
Sbjct: 35  KTPGVMGKDDFLKLFLTSLQYQDPFNAMDMDQMMNQMSQMSLMEQVQNMTKAVNALKDTV 94

Query: 75  KSNNLAQASSYIGKNI--TNADGS-ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
            +  L     ++GK I   + DG+ ISG V+A+++++         N EI +  G +I
Sbjct: 95  NTTALDGGMKFLGKYILGPSTDGNQISGKVDAVRLAA---------NNEIQLVVGDKI 143


>gi|170022970|ref|YP_001719475.1| flagellar basal body rod modification protein [Yersinia
          pseudotuberculosis YPIII]
 gi|169749504|gb|ACA67022.1| flagellar hook capping protein [Yersinia pseudotuberculosis
          YPIII]
          Length = 218

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 4/55 (7%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
          F+ LL+ QIK+QDP  P   +E V+Q+A  SQ    VQ    + +LLKSN +  A
Sbjct: 33 FMTLLVAQIKNQDPLNPADGTEFVSQMAQLSQ----VQATENMAKLLKSNTVQMA 83


>gi|163803168|ref|ZP_02197051.1| flagellar basal body rod modification protein D [Vibrio sp. AND4]
 gi|159173068|gb|EDP57901.1| flagellar basal body rod modification protein D [Vibrio sp. AND4]
          Length = 228

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 32/47 (68%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          ++ F+ L++ QI++QDP  P+  +E V+QLA FSQ++ +  M   +Q
Sbjct: 40 ENEFISLMVAQIQNQDPLNPLDGTEYVSQLAQFSQVQSTENMAMLMQ 86


>gi|103488386|ref|YP_617947.1| flagellar hook capping protein [Sphingopyxis alaskensis RB2256]
 gi|98978463|gb|ABF54614.1| flagellar hook capping protein [Sphingopyxis alaskensis RB2256]
          Length = 100

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%)

Query: 14 FSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          F    + + +GQ  FL+L+  Q+  QDP  P+  +E VAQ+A FS +    + N+ L ++
Sbjct: 13 FHSPGTSQQMGQSDFLRLMTAQLSQQDPFNPVDNTEMVAQMAQFSSLAGISETNTVLAQI 72


>gi|153948005|ref|YP_001399633.1| flagellar basal body rod modification protein [Yersinia
          pseudotuberculosis IP 31758]
 gi|152959500|gb|ABS46961.1| basal-body rod modification protein FlgD [Yersinia
          pseudotuberculosis IP 31758]
          Length = 218

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 4/55 (7%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
          F+ LL+ QIK+QDP  P   +E V+Q+A  SQ    VQ    + +LLKSN +  A
Sbjct: 33 FMTLLVAQIKNQDPLNPADGTEFVSQMAQLSQ----VQATENMAKLLKSNTVQMA 83


>gi|22127328|ref|NP_670751.1| flagellar basal body rod modification protein [Yersinia pestis
          KIM 10]
 gi|45442795|ref|NP_994334.1| flagellar basal body rod modification protein [Yersinia pestis
          biovar Microtus str. 91001]
 gi|108809056|ref|YP_652972.1| flagellar basal body rod modification protein [Yersinia pestis
          Antiqua]
 gi|108810747|ref|YP_646514.1| flagellar basal body rod modification protein [Yersinia pestis
          Nepal516]
 gi|145597816|ref|YP_001161892.1| flagellar basal body rod modification protein [Yersinia pestis
          Pestoides F]
 gi|150260250|ref|ZP_01916978.1| lateral flagellar hook capping protein [Yersinia pestis
          CA88-4125]
 gi|162420922|ref|YP_001604848.1| flagellar basal body rod modification protein [Yersinia pestis
          Angola]
 gi|165925067|ref|ZP_02220899.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Orientalis str. F1991016]
 gi|165939088|ref|ZP_02227640.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Orientalis str. IP275]
 gi|166008806|ref|ZP_02229704.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Antiqua str. E1979001]
 gi|166211874|ref|ZP_02237909.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Antiqua str. B42003004]
 gi|167398737|ref|ZP_02304261.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Antiqua str. UG05-0454]
 gi|167418933|ref|ZP_02310686.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167425065|ref|ZP_02316818.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|167466341|ref|ZP_02331045.1| basal-body rod modification protein FlgD [Yersinia pestis FV-1]
 gi|218927911|ref|YP_002345786.1| flagellar basal body rod modification protein [Yersinia pestis
          CO92]
 gi|229837407|ref|ZP_04457570.1| flagellar basal-body rod modification protein flgD [Yersinia
          pestis Pestoides A]
 gi|229840620|ref|ZP_04460779.1| flagellar basal-body rod modification protein flgD [Yersinia
          pestis biovar Orientalis str. PEXU2]
 gi|229842829|ref|ZP_04462981.1| flagellar basal-body rod modification protein flgD [Yersinia
          pestis biovar Orientalis str. India 195]
 gi|229900944|ref|ZP_04516068.1| flagellar basal-body rod modification protein flgD [Yersinia
          pestis Nepal516]
 gi|270487674|ref|ZP_06204748.1| flagellar hook capping protein [Yersinia pestis KIM D27]
 gi|294502787|ref|YP_003566849.1| flagellar basal body rod modification protein [Yersinia pestis
          Z176003]
 gi|21960409|gb|AAM87002.1|AE013948_10 putative flagellar assembly protein [Yersinia pestis KIM 10]
 gi|45437661|gb|AAS63211.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Microtus str. 91001]
 gi|108774395|gb|ABG16914.1| basal-body rod modification protein [Yersinia pestis Nepal516]
 gi|108780969|gb|ABG15027.1| putative basal-body rod modification protein [Yersinia pestis
          Antiqua]
 gi|115346522|emb|CAL19398.1| putative basal-body rod modification protein [Yersinia pestis
          CO92]
 gi|145209512|gb|ABP38919.1| basal-body rod modification protein [Yersinia pestis Pestoides F]
 gi|149289658|gb|EDM39735.1| lateral flagellar hook capping protein [Yersinia pestis
          CA88-4125]
 gi|162353737|gb|ABX87685.1| basal-body rod modification protein FlgD [Yersinia pestis Angola]
 gi|165913044|gb|EDR31669.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Orientalis str. IP275]
 gi|165923267|gb|EDR40418.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Orientalis str. F1991016]
 gi|165992145|gb|EDR44446.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Antiqua str. E1979001]
 gi|166206620|gb|EDR51100.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Antiqua str. B42003004]
 gi|166962927|gb|EDR58948.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Orientalis str. MG05-1020]
 gi|167051241|gb|EDR62649.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Antiqua str. UG05-0454]
 gi|167055828|gb|EDR65609.1| basal-body rod modification protein FlgD [Yersinia pestis biovar
          Mediaevalis str. K1973002]
 gi|229682283|gb|EEO78375.1| flagellar basal-body rod modification protein flgD [Yersinia
          pestis Nepal516]
 gi|229690096|gb|EEO82153.1| flagellar basal-body rod modification protein flgD [Yersinia
          pestis biovar Orientalis str. India 195]
 gi|229696986|gb|EEO87033.1| flagellar basal-body rod modification protein flgD [Yersinia
          pestis biovar Orientalis str. PEXU2]
 gi|229705530|gb|EEO91540.1| flagellar basal-body rod modification protein flgD [Yersinia
          pestis Pestoides A]
 gi|262360819|gb|ACY57540.1| flagellar basal body rod modification protein [Yersinia pestis
          D106004]
 gi|262364763|gb|ACY61320.1| flagellar basal body rod modification protein [Yersinia pestis
          D182038]
 gi|270336178|gb|EFA46955.1| flagellar hook capping protein [Yersinia pestis KIM D27]
 gi|294353246|gb|ADE63587.1| flagellar basal body rod modification protein [Yersinia pestis
          Z176003]
 gi|320016712|gb|ADW00284.1| Flagellar basal-body rod modification proteinflgD [Yersinia
          pestis biovar Medievalis str. Harbin 35]
          Length = 218

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 4/55 (7%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
          F+ LL+ QIK+QDP  P   +E V+Q+A  SQ    VQ    + +LLKSN +  A
Sbjct: 33 FMTLLVAQIKNQDPLNPADGTEFVSQMAQLSQ----VQATENMAKLLKSNTVQMA 83


>gi|332162902|ref|YP_004299479.1| Basal-body rod modification protein [Yersinia enterocolitica
          subsp. palearctica 105.5R(r)]
 gi|318604251|emb|CBY25749.1| flagellar basal-body rod modification protein FlgD [Yersinia
          enterocolitica subsp. palearctica Y11]
 gi|325667132|gb|ADZ43776.1| Basal-body rod modification protein [Yersinia enterocolitica
          subsp. palearctica 105.5R(r)]
 gi|330863352|emb|CBX73475.1| hypothetical protein YEW_ES20700 [Yersinia enterocolitica W22703]
          Length = 219

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 4/50 (8%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
          F+ LL+ QI++QDP  PM  +E V Q+A  SQ    VQ    + ++LKSN
Sbjct: 34 FMTLLVAQIQNQDPLNPMDGTEFVGQMAQLSQ----VQSTENMAKMLKSN 79


>gi|120598231|ref|YP_962805.1| flagellar basal body rod modification protein [Shewanella sp.
           W3-18-1]
 gi|120558324|gb|ABM24251.1| flagellar hook capping protein [Shewanella sp. W3-18-1]
          Length = 253

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 48/85 (56%), Gaps = 4/85 (4%)

Query: 9   PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
           PT+    ++KS++ L Q+ F  LL  Q+  QDP +P+   + +AQ+A FS ++   ++N 
Sbjct: 41  PTESIVPEAKSQQ-LTQEDFFSLLSQQLSMQDPFKPVDNDQMIAQMASFSTVDGISKLNK 99

Query: 69  ---TLQELLKSNNLAQASSYIGKNI 90
               L  ++ S+   QA+  +G+ +
Sbjct: 100 EIVNLNSVMTSSQALQATGLVGRKV 124


>gi|56460253|ref|YP_155534.1| flagellar basal body rod modification protein [Idiomarina
           loihiensis L2TR]
 gi|56179263|gb|AAV81985.1| Flagellar hook capping protein [Idiomarina loihiensis L2TR]
          Length = 227

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 42/80 (52%), Gaps = 3/80 (3%)

Query: 14  FSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
           ++    +  L Q+ F +LL  Q+  QDP++P++  + +AQ+  F+  E    ++    + 
Sbjct: 23  YADPDERSKLEQEDFFRLLTEQLSMQDPSKPVENDQMIAQMTNFTMAEGITGLSERFDQF 82

Query: 74  ---LKSNNLAQASSYIGKNI 90
              + SN   QAS+ +G+ +
Sbjct: 83  ASDMTSNQALQASTMVGRKV 102


>gi|302387790|ref|YP_003823612.1| flagellar hook capping protein [Clostridium saccharolyticum WM1]
 gi|302198418|gb|ADL05989.1| flagellar hook capping protein [Clostridium saccharolyticum WM1]
          Length = 192

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 62/125 (49%), Gaps = 11/125 (8%)

Query: 14  FSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
            + + S   L  D F KLL  Q+++QD + PM  SE + Q+   + M+     ++ +++ 
Sbjct: 17  LTDNSSSGGLTTDGFFKLLAAQLQNQDMSSPMDNSEMMTQMTQIAMMQAMNNFSTAMEDF 76

Query: 74  LKSNNLAQASSYIGKN--ITNADGS-----ISGVVNAIQVSSTGLTAITVDNTEIPITTG 126
            + N +   +S +GK   I  AD +     I+G V  + + S G+  I +++ +    TG
Sbjct: 77  SQINTINYGTSMMGKEVMIAAADKTGQIKKINGTVTRVDIFS-GIPTIYINDDD---KTG 132

Query: 127 IRISN 131
             I+N
Sbjct: 133 YSIAN 137


>gi|167644974|ref|YP_001682637.1| flagellar hook capping protein [Caulobacter sp. K31]
 gi|167347404|gb|ABZ70139.1| flagellar hook capping protein [Caulobacter sp. K31]
          Length = 232

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 46/94 (48%), Gaps = 3/94 (3%)

Query: 1  MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
          M +    N    + + S++     +  FLKLL TQ+K+QDP  P   S+  +Q+   + +
Sbjct: 1  MAVTATSNTVTDKINNSRTSLASNEQTFLKLLTTQLKNQDPLSPTDTSQMTSQITQMTGV 60

Query: 61 EQSVQMNSTLQELLK---SNNLAQASSYIGKNIT 91
          EQ +  N  L  L+       +++  + +GK +T
Sbjct: 61 EQQLVTNELLTALVGMSTGGGISEGVNLMGKQVT 94


>gi|32490789|ref|NP_871043.1| hypothetical protein WGLp040 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25165995|dbj|BAC24186.1| flgD [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 279

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 44/69 (63%), Gaps = 9/69 (13%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSV---QMNSTLQELLKSNNLAQA 82
           D FLK+++ QIK+QDPT P+  +    Q+   +QM  ++   ++N ++QE+ ++ N +Q 
Sbjct: 84  DNFLKMILVQIKNQDPTHPIDNNHLTTQM---TQMHTALGIEKLNKSIQEIKQTMNNSQY 140

Query: 83  ---SSYIGK 88
              S++IGK
Sbjct: 141 INLSNWIGK 149


>gi|307546969|ref|YP_003899448.1| flagellar basal body rod modification protein [Halomonas elongata
          DSM 2581]
 gi|307218993|emb|CBV44263.1| flagellar basal body rod modification protein [Halomonas elongata
          DSM 2581]
          Length = 230

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 3/66 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQASS 84
          F+ LL+TQ+++QDP  PM   +  +QLA  + +    ++N +L E+   + +    QAS 
Sbjct: 33 FMTLLVTQLQNQDPLNPMDNHQTTSQLAQINTVSGIEKLNDSLSEINGQIDAGQSLQASG 92

Query: 85 YIGKNI 90
           IGK +
Sbjct: 93 LIGKGV 98


>gi|325109019|ref|YP_004270087.1| flagellar hook capping protein [Planctomyces brasiliensis DSM
          5305]
 gi|324969287|gb|ADY60065.1| flagellar hook capping protein [Planctomyces brasiliensis DSM
          5305]
          Length = 160

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 3  INTEVNPTQQEFSKSKSKKT----LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFS 58
          I T  +PT Q         T    L  +AFLKL+I Q+++QDPTEP    E + Q++   
Sbjct: 4  IETVYSPTGQPVQIVDGNDTGFNALDPEAFLKLMIVQLQNQDPTEPTSNEELLNQISTMR 63

Query: 59 QMEQSVQMNSTLQELLKS 76
           ++ S+++   +  L  S
Sbjct: 64 SLQSSIELEDMIASLANS 81


>gi|300900361|ref|ZP_07118537.1| flagellar hook capping protein [Escherichia coli MS 198-1]
 gi|300356129|gb|EFJ71999.1| flagellar hook capping protein [Escherichia coli MS 198-1]
          Length = 225

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 6/56 (10%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNSTLQELLKSN 77
          D FL L + +I++QDPT+P  A+E + QL+  +Q+    E SVQ N+    +L SN
Sbjct: 25 DTFLTLFVAEIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANT--NAVLMSN 78


>gi|300936124|ref|ZP_07151063.1| flagellar hook capping protein [Escherichia coli MS 21-1]
 gi|306813305|ref|ZP_07447498.1| putative lateral flagellar hook assembly protein [Escherichia
          coli NC101]
 gi|300458702|gb|EFK22195.1| flagellar hook capping protein [Escherichia coli MS 21-1]
 gi|305854068|gb|EFM54507.1| putative lateral flagellar hook assembly protein [Escherichia
          coli NC101]
          Length = 237

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 4/47 (8%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
          D FL L + +I++QDPT+P  A+E + QL+  +Q+    E SVQ N+
Sbjct: 37 DTFLTLFVAEIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANT 83


>gi|330818586|ref|YP_004362291.1| basal-body rod modification protein FlgD [Burkholderia gladioli
           BSR3]
 gi|327370979|gb|AEA62335.1| basal-body rod modification protein FlgD [Burkholderia gladioli
           BSR3]
          Length = 259

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 48/92 (52%), Gaps = 6/92 (6%)

Query: 5   TEVNPTQQEFSKSKSKKTLGQD---AFLKLLITQIKHQDPTEPMKASE---QVAQLAVFS 58
           T VN T  +   + S  T   D    FL LL+TQ+++QDPT P+ +S+   Q+AQ+   S
Sbjct: 12  TTVNNTPTDTMNANSSNTSAADLQQTFLTLLVTQLQNQDPTSPVDSSQMTSQLAQINTVS 71

Query: 59  QMEQSVQMNSTLQELLKSNNLAQASSYIGKNI 90
            + Q     ++L   + +    QA+  +G N+
Sbjct: 72  GIAQLNSSLTSLSSQITAGQQTQAAMLVGSNV 103


>gi|327254553|gb|EGE66169.1| flagellar hook capping family protein [Escherichia coli STEC_7v]
          Length = 237

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 4/47 (8%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
          D FL L + +I++QDPT+P  A+E + QL+  +Q+    E SVQ N+
Sbjct: 37 DTFLTLFVAEIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANT 83


>gi|323975931|gb|EGB71025.1| flagellar hook capping protein [Escherichia coli TW10509]
          Length = 237

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 4/47 (8%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
          D FL L + +I++QDPT+P  A+E + QL+  +Q+    E SVQ N+
Sbjct: 37 DTFLTLFVAEIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANT 83


>gi|119775451|ref|YP_928191.1| flagellar basal body rod modification protein [Shewanella
           amazonensis SB2B]
 gi|119767951|gb|ABM00522.1| flagellar hook capping protein [Shewanella amazonensis SB2B]
          Length = 242

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 5/84 (5%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS---TLQELLKS 76
           K+ L Q+ F  LL  Q+  QDP +P++  + +AQ+A FS ++    +N     L  ++ S
Sbjct: 40  KQELTQEDFFALLSQQLSMQDPFKPVENDQMIAQMASFSTVDGIANLNDHIVNLNTVMTS 99

Query: 77  NNLAQASSYIGKN--ITNADGSIS 98
           +   QAS  +G+   I +A G +S
Sbjct: 100 SQALQASGLVGQKVLIPSASGHVS 123


>gi|323191537|gb|EFZ76798.1| flagellar hook capping family protein [Escherichia coli RN587/1]
          Length = 237

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 4/47 (8%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
          D FL L + +I++QDPT+P  A+E + QL+  +Q+    E SVQ N+
Sbjct: 37 DTFLTLFVAEIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANT 83


>gi|218703524|ref|YP_002411043.1| lateral flagellar rod FlgD-like protein [Escherichia coli UMN026]
 gi|293403354|ref|ZP_06647445.1| predicted protein [Escherichia coli FVEC1412]
 gi|298378966|ref|ZP_06988847.1| flagellar basal-body rod modification protein FlgD [Escherichia
          coli FVEC1302]
 gi|218430621|emb|CAR11487.1| Lateral flagellar rod protein (FlgD-like) [Escherichia coli
          UMN026]
 gi|291429207|gb|EFF02227.1| predicted protein [Escherichia coli FVEC1412]
 gi|298280079|gb|EFI21583.1| flagellar basal-body rod modification protein FlgD [Escherichia
          coli FVEC1302]
          Length = 237

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 4/47 (8%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
          D FL L + +I++QDPT+P  A+E + QL+  +Q+    E SVQ N+
Sbjct: 37 DTFLTLFVAEIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANT 83


>gi|331645417|ref|ZP_08346521.1| putative flagellar hook capping protein [Escherichia coli M605]
 gi|331045579|gb|EGI17705.1| putative flagellar hook capping protein [Escherichia coli M605]
          Length = 237

 Score = 42.7 bits (99), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 4/47 (8%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
          D FL L + +I++QDPT+P  A+E + QL+  +Q+    E SVQ N+
Sbjct: 37 DTFLTLFVAEIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANT 83


>gi|170021361|ref|YP_001726315.1| flagellar hook capping protein [Escherichia coli ATCC 8739]
 gi|260853465|ref|YP_003227356.1| putative lateral flagellar hook assembly protein [Escherichia
          coli O26:H11 str. 11368]
 gi|260866412|ref|YP_003232814.1| putative lateral flagellar hook assembly protein [Escherichia
          coli O111:H- str. 11128]
 gi|169756289|gb|ACA78988.1| flagellar hook capping protein [Escherichia coli ATCC 8739]
 gi|257752114|dbj|BAI23616.1| predicted lateral flagellar hook assembly protein [Escherichia
          coli O26:H11 str. 11368]
 gi|257762768|dbj|BAI34263.1| predicted lateral flagellar hook assembly protein [Escherichia
          coli O111:H- str. 11128]
 gi|323158104|gb|EFZ44203.1| flagellar hook capping family protein [Escherichia coli EPECa14]
 gi|323178495|gb|EFZ64073.1| flagellar hook capping family protein [Escherichia coli 1180]
          Length = 237

 Score = 42.7 bits (99), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 4/47 (8%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
          D FL L + +I++QDPT+P  A+E + QL+  +Q+    E SVQ N+
Sbjct: 37 DTFLTLFVAEIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANT 83


>gi|170679856|ref|YP_001742372.1| lateral flagellar rod protein LfgD [Escherichia coli SMS-3-5]
 gi|170517574|gb|ACB15752.1| lateral flagellar rod protein LfgD [Escherichia coli SMS-3-5]
          Length = 237

 Score = 42.7 bits (99), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 4/47 (8%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
          D FL L + +I++QDPT+P  A+E + QL+  +Q+    E SVQ N+
Sbjct: 37 DTFLTLFVAEIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANT 83


>gi|315616828|gb|EFU97445.1| flagellar hook capping family protein [Escherichia coli 3431]
          Length = 244

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 4/47 (8%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
          D FL L + +I++QDPT+P  A+E + QL+  +Q+    E SVQ N+
Sbjct: 37 DTFLTLFVAEIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANT 83


>gi|307136857|ref|ZP_07496213.1| putative lateral flagellar hook assembly protein [Escherichia
          coli H736]
 gi|331640712|ref|ZP_08341859.1| putative flagellar hook capping protein [Escherichia coli H736]
 gi|331040086|gb|EGI12294.1| putative flagellar hook capping protein [Escherichia coli H736]
          Length = 237

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 4/47 (8%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
          D FL L + +I++QDPT+P  A+E + QL+  +Q+    E SVQ N+
Sbjct: 37 DTFLTLFVAEIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANT 83


>gi|331671803|ref|ZP_08372599.1| putative flagellar hook capping protein [Escherichia coli TA280]
 gi|331070792|gb|EGI42151.1| putative flagellar hook capping protein [Escherichia coli TA280]
          Length = 237

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 4/47 (8%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
          D FL L + +I++QDPT+P  A+E + QL+  +Q+    E SVQ N+
Sbjct: 37 DTFLTLFVAEIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANT 83


>gi|300817271|ref|ZP_07097489.1| flagellar hook capping protein [Escherichia coli MS 107-1]
 gi|307313520|ref|ZP_07593141.1| flagellar hook capping protein [Escherichia coli W]
 gi|300530247|gb|EFK51309.1| flagellar hook capping protein [Escherichia coli MS 107-1]
 gi|306906688|gb|EFN37199.1| flagellar hook capping protein [Escherichia coli W]
 gi|315059541|gb|ADT73868.1| flagellar hook assembly protein [Escherichia coli W]
 gi|323379900|gb|ADX52168.1| flagellar hook capping protein [Escherichia coli KO11]
          Length = 237

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 4/47 (8%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
          D FL L + +I++QDPT+P  A+E + QL+  +Q+    E SVQ N+
Sbjct: 37 DTFLTLFVAEIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANT 83


>gi|241766919|ref|ZP_04764725.1| flagellar hook capping protein [Acidovorax delafieldii 2AN]
 gi|241362623|gb|EER58471.1| flagellar hook capping protein [Acidovorax delafieldii 2AN]
          Length = 220

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 47/88 (53%), Gaps = 10/88 (11%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           QD FLKLL+ Q+ +QDP  P+  ++  +Q+A  + +    Q+N T++ +     +  + Q
Sbjct: 32  QDRFLKLLVAQLNNQDPMNPLDNAQMTSQMAQINTVTGIQQLNQTMKSMADQFSALQVLQ 91

Query: 82  ASSYIGK-------NITNADGSISGVVN 102
            +S IG+       N+  ADG   G+ +
Sbjct: 92  GASMIGRSVVTEGNNLPVADGVGKGMFD 119


>gi|323181546|gb|EFZ66966.1| flagellar hook capping family protein [Escherichia coli 1357]
          Length = 237

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 4/47 (8%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
          D FL L + +I++QDPT+P  A+E + QL+  +Q+    E SVQ N+
Sbjct: 37 DTFLTLFVAEIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANT 83


>gi|238762360|ref|ZP_04623331.1| Basal-body rod modification protein [Yersinia kristensenii ATCC
          33638]
 gi|238699345|gb|EEP92091.1| Basal-body rod modification protein [Yersinia kristensenii ATCC
          33638]
          Length = 219

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 4/50 (8%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
          F+ LL+ QI++QDP  PM  +E V+Q+A  SQ    VQ    + ++LKSN
Sbjct: 34 FMTLLVAQIQNQDPLNPMDGTEFVSQMAQLSQ----VQSTENMAKMLKSN 79


>gi|293408366|ref|ZP_06652205.1| conserved hypothetical protein [Escherichia coli B354]
 gi|291471544|gb|EFF14027.1| conserved hypothetical protein [Escherichia coli B354]
          Length = 234

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 4/47 (8%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
          D FL L + +I++QDPT+P  A+E + QL+  +Q+    E SVQ N+
Sbjct: 34 DTFLTLFVAEIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANT 80


>gi|301648571|ref|ZP_07248286.1| flagellar hook capping protein [Escherichia coli MS 146-1]
 gi|301073358|gb|EFK88164.1| flagellar hook capping protein [Escherichia coli MS 146-1]
          Length = 246

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 4/47 (8%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
          D FL L + +I++QDPT+P  A+E + QL+  +Q+    E SVQ N+
Sbjct: 46 DTFLTLFVAEIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANT 92


>gi|256020227|ref|ZP_05434092.1| flagellar hook capping protein [Shigella sp. D9]
 gi|332281389|ref|ZP_08393802.1| lateral flagellar rod protein [Shigella sp. D9]
 gi|332103741|gb|EGJ07087.1| lateral flagellar rod protein [Shigella sp. D9]
          Length = 237

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 4/47 (8%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
          D FL L + +I++QDPT+P  A+E + QL+  +Q+    E SVQ N+
Sbjct: 37 DTFLTLFVAEIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANT 83


>gi|149184206|ref|ZP_01862524.1| flagellar hook capping protein [Erythrobacter sp. SD-21]
 gi|148831526|gb|EDL49959.1| flagellar hook capping protein [Erythrobacter sp. SD-21]
          Length = 71

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 33/52 (63%)

Query: 22 TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          +LGQ  FL+LL  Q++ QDP  P+   E ++Q+A FS +    + N++L+ +
Sbjct: 3  SLGQGDFLRLLTVQMQQQDPFNPVDNKEMLSQMAQFSSLAGVAETNASLERI 54


>gi|296103612|ref|YP_003613758.1| Flagellar basal-body rod modification protein, FlgD [Enterobacter
          cloacae subsp. cloacae ATCC 13047]
 gi|295058071|gb|ADF62809.1| Flagellar basal-body rod modification protein, FlgD [Enterobacter
          cloacae subsp. cloacae ATCC 13047]
          Length = 234

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST---LQELLKSNNLAQASS 84
          F+ LL+ Q+K+QDPT PM  ++  +QLA F+      ++NS+   +Q ++       AS+
Sbjct: 28 FMTLLVAQMKNQDPTNPMDNNQLTSQLAQFNMAAGVEKLNSSVAGVQAMMIQLGSMSASA 87

Query: 85 YIGKNI 90
          ++G+++
Sbjct: 88 WVGRSV 93


>gi|170743225|ref|YP_001771880.1| flagellar hook capping protein [Methylobacterium sp. 4-46]
 gi|168197499|gb|ACA19446.1| flagellar hook capping protein [Methylobacterium sp. 4-46]
          Length = 233

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 46/79 (58%), Gaps = 4/79 (5%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL---KSNNLAQASS 84
           FL LL TQ+K+Q+P +P+  ++   QL  F+ +EQ ++ N  L  ++   K+   + A+ 
Sbjct: 33  FLTLLTTQLKNQNPLDPLDTNQFTQQLVQFASVEQQLKTNDRLDTMVAASKAATASSAAG 92

Query: 85  YIGKNITNADGSISGVVNA 103
            +GK +T ADG+ + +   
Sbjct: 93  LVGKTVT-ADGATAALAGG 110


>gi|121607562|ref|YP_995369.1| flagellar hook capping protein [Verminephrobacter eiseniae EF01-2]
 gi|121552202|gb|ABM56351.1| flagellar hook capping protein [Verminephrobacter eiseniae EF01-2]
          Length = 236

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 41/69 (59%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
           QD FLKLL+ Q+ +QDP  P+  ++  +Q+A  + +    Q+N T+Q +     +  + Q
Sbjct: 48  QDRFLKLLVAQLNNQDPMNPLDNAQMTSQIAQINTVTGIQQLNQTMQRMAAQFDALQVMQ 107

Query: 82  ASSYIGKNI 90
            ++ +G+++
Sbjct: 108 GAALVGRSV 116


>gi|327478808|gb|AEA82118.1| flagellar basal body rod modification protein [Pseudomonas
          stutzeri DSM 4166]
          Length = 221

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 37/61 (60%), Gaps = 5/61 (8%)

Query: 19 SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
          S  T  ++ F+ L++ QIK+QDPT+P+ ++E + Q +V SQ++    M S     L  NN
Sbjct: 27 SDATTMENNFISLMVAQIKYQDPTKPVDSTEFLNQFSVMSQVKSMENMTS-----LAQNN 81

Query: 79 L 79
          L
Sbjct: 82 L 82


>gi|238752867|ref|ZP_04614332.1| Basal-body rod modification protein [Yersinia rohdei ATCC 43380]
 gi|238708906|gb|EEQ01159.1| Basal-body rod modification protein [Yersinia rohdei ATCC 43380]
          Length = 218

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 11/77 (14%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL------AQ 81
           F+ LL+ QI++QDP  P   +E V+Q+A  SQ    VQ    + +LLKSN +      A 
Sbjct: 33  FMTLLVAQIQNQDPLNPTDGTEFVSQMAQLSQ----VQSTENMAKLLKSNTVQMEKMQAM 88

Query: 82  ASS-YIGKNITNADGSI 97
           A++  +G+N+    G+I
Sbjct: 89  ATANLVGQNVMVESGTI 105


>gi|113969605|ref|YP_733398.1| flagellar basal body rod modification protein [Shewanella sp. MR-4]
 gi|113884289|gb|ABI38341.1| flagellar hook capping protein [Shewanella sp. MR-4]
          Length = 256

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 4/85 (4%)

Query: 9   PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
           P      ++KS++ L Q+ F  LL  Q+  QDP +P+   + +AQ+A FS ++   ++N 
Sbjct: 44  PGNSVVPEAKSQQ-LTQEDFFSLLSQQLSMQDPFKPVDNDQMIAQMASFSTVDGISKLND 102

Query: 69  ---TLQELLKSNNLAQASSYIGKNI 90
               L  ++ S+   QAS  +G+ +
Sbjct: 103 EIVNLNSVMTSSQALQASGLVGRKV 127


>gi|261341495|ref|ZP_05969353.1| putative basal-body rod modification protein FlgD [Enterobacter
           cancerogenus ATCC 35316]
 gi|288316291|gb|EFC55229.1| putative basal-body rod modification protein FlgD [Enterobacter
           cancerogenus ATCC 35316]
          Length = 234

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 9/80 (11%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---------LKSNN 78
           F+KLL+ QI++QDP  P   +E V QLA  +Q++    M   +Q +         L + N
Sbjct: 35  FMKLLVAQIQNQDPLNPTDGTEYVGQLAQLTQVQSMENMTVGMQNIGVLMDNLQTLSTGN 94

Query: 79  LAQASSYIGKNITNADGSIS 98
           L      +  +    DGS S
Sbjct: 95  LVGQKVMVQTDTLQTDGSTS 114


>gi|242278415|ref|YP_002990544.1| flagellar hook capping protein [Desulfovibrio salexigens DSM 2638]
 gi|242121309|gb|ACS79005.1| flagellar hook capping protein [Desulfovibrio salexigens DSM 2638]
          Length = 226

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 10/112 (8%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS-NNLAQ 81
           L Q  FL LL TQ+++QDPT P   +  + Q+  ++ +++ V  N  L+ ++   + LA 
Sbjct: 30  LDQVDFLTLLTTQLQYQDPTNPTDNTAMINQMTNYAMLDEDVAQNENLEAIINQLDALAS 89

Query: 82  ASS--YIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            S+   IG+ +    GS S       V     T +T+D  +     GI I +
Sbjct: 90  LSTAGLIGEEVMAPGGSFS-------VEGGEATGVTIDLQDDASEVGINIYD 134


>gi|74101657|gb|AAZ99747.1| FlgDL [Aeromonas hydrophila]
          Length = 231

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 42/67 (62%), Gaps = 5/67 (7%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE----LLKSNNLAQAS 83
           FL++++ QI++QDPT P+  ++ V QLA FS +E  V+    LQ+    ++ +  + Q++
Sbjct: 45  FLQMMVAQIQNQDPTNPLDGAQYVTQLAQFSMVE-GVESLKVLQQKSINMMDTQQVLQST 103

Query: 84  SYIGKNI 90
           + I K +
Sbjct: 104 ALIDKEV 110


>gi|34497158|ref|NP_901373.1| flagellar basal body rod modification protein [Chromobacterium
          violaceum ATCC 12472]
 gi|34103015|gb|AAQ59378.1| basal-body rod modification protein FlgD [Chromobacterium
          violaceum ATCC 12472]
          Length = 225

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 30/48 (62%)

Query: 24 GQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          G D F+ LL+ QI++Q P +P   S+ V+QLA  SQM+ +  M   LQ
Sbjct: 35 GNDMFMTLLLAQIRNQSPLDPADPSQFVSQLAQMSQMQSTQDMLKQLQ 82


>gi|114562341|ref|YP_749854.1| flagellar basal body rod modification protein [Shewanella
           frigidimarina NCIMB 400]
 gi|114333634|gb|ABI71016.1| flagellar hook capping protein [Shewanella frigidimarina NCIMB 400]
          Length = 261

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 4/85 (4%)

Query: 9   PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
           P +    +SK  + L Q+ F  LL  Q+  QDP +P+   + +AQ+A FS ++    +N 
Sbjct: 49  PEESAIPESK-DQMLKQEDFFALLSQQLSMQDPFKPVDNDQMIAQMASFSTVDGISNLND 107

Query: 69  ---TLQELLKSNNLAQASSYIGKNI 90
               L  ++ S+   QAS  +G+ +
Sbjct: 108 EILNLNTVMSSSQALQASGLVGRKV 132


>gi|291617019|ref|YP_003519761.1| FlgD [Pantoea ananatis LMG 20103]
 gi|291152049|gb|ADD76633.1| FlgD [Pantoea ananatis LMG 20103]
 gi|327393470|dbj|BAK10892.1| basal-body rod modification protein FlgD [Pantoea ananatis
          AJ13355]
          Length = 223

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 31/46 (67%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
          Q+ FL +L+TQ+++QDPT PM  S+   QLA  + +    ++N+TL
Sbjct: 31 QNQFLTMLVTQLQNQDPTNPMDNSQLTTQLAQINTLSGIEKLNTTL 76


>gi|149927797|ref|ZP_01916048.1| Flagellar hook capping protein [Limnobacter sp. MED105]
 gi|149823419|gb|EDM82650.1| Flagellar hook capping protein [Limnobacter sp. MED105]
          Length = 223

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQ 81
          Q+ F+ LL+ Q+K+QDP  PM  ++  +Q+A  + +     +N+T++ +   + +N   Q
Sbjct: 31 QERFMSLLVAQLKNQDPLAPMDNAQVTSQMAQLNTVTGINTLNATMEGVAASINANQTVQ 90

Query: 82 ASSYIGKNI 90
          A+S +G+ +
Sbjct: 91 ATSMLGRAV 99


>gi|123442785|ref|YP_001006762.1| flagellar basal body rod modification protein [Yersinia
          enterocolitica subsp. enterocolitica 8081]
 gi|122089746|emb|CAL12599.1| basal-body rod modification protein FlgD [Yersinia enterocolitica
          subsp. enterocolitica 8081]
          Length = 191

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 39/63 (61%), Gaps = 3/63 (4%)

Query: 31 LLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQASSYIG 87
          +L+ Q+K+QDPT PM+ +E   QLA  + +    ++N+TL  +   + ++   QASS IG
Sbjct: 1  MLVAQLKNQDPTNPMQNNELTTQLAQINTVSGIEKLNTTLGSISGQIDNSQSLQASSLIG 60

Query: 88 KNI 90
          + +
Sbjct: 61 RGV 63


>gi|291562026|emb|CBL40842.1| Flagellar hook capping protein [butyrate-producing bacterium
          SS3/4]
          Length = 189

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 47/93 (50%), Gaps = 2/93 (2%)

Query: 3  INTEVNPTQQEF--SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
          +++  NP Q     + S SK T+  ++F+KLL  Q+ +QD T PM  SE ++Q+   + +
Sbjct: 7  VSSTANPYQAGVYSAGSNSKNTMDVNSFIKLLAAQLSNQDMTSPMDNSEMMSQMTNMAMV 66

Query: 61 EQSVQMNSTLQELLKSNNLAQASSYIGKNITNA 93
          +    M  +L           A S IG+ +T A
Sbjct: 67 QSLTAMTESLNTSAAVTTQTYAGSLIGQEVTVA 99


>gi|220925889|ref|YP_002501191.1| flagellar hook capping protein [Methylobacterium nodulans ORS
          2060]
 gi|219950496|gb|ACL60888.1| flagellar hook capping protein [Methylobacterium nodulans ORS
          2060]
          Length = 228

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 30/47 (63%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
          FL LL TQ+++Q+P +P+  ++   QL  F+ +EQ ++ N  L  LL
Sbjct: 35 FLTLLTTQLRNQNPLDPLDTNQFTQQLVQFASVEQQLKTNDRLDSLL 81


>gi|255021353|ref|ZP_05293401.1| Flagellar basal-body rod modification protein FlgD
           [Acidithiobacillus caldus ATCC 51756]
 gi|254969216|gb|EET26730.1| Flagellar basal-body rod modification protein FlgD
           [Acidithiobacillus caldus ATCC 51756]
          Length = 231

 Score = 41.6 bits (96), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK---SNNLAQASS 84
           F  LL+TQ+ +QDP  P+   +  AQLA FS       + S+L  L+     N   QA+S
Sbjct: 41  FYNLLVTQLTNQDPLNPLSNQDLSAQLAQFSVANGVQAIQSSLTGLMSQINQNQGLQAAS 100

Query: 85  YIGKNIT 91
            IGK++T
Sbjct: 101 LIGKSVT 107


>gi|332525067|ref|ZP_08401247.1| flagellar hook capping protein [Rubrivivax benzoatilyticus JA2]
 gi|332108356|gb|EGJ09580.1| flagellar hook capping protein [Rubrivivax benzoatilyticus JA2]
          Length = 213

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 49/92 (53%), Gaps = 9/92 (9%)

Query: 3  INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
          INT   PT+   SK+    +   D FLKLL+ Q+++QDP  PM  ++  +Q+A  + +  
Sbjct: 10 INT---PTE---SKNAGTASASADRFLKLLVAQMQNQDPLNPMDNAQVTSQMAQINTVTG 63

Query: 63 SVQMNSTLQEL---LKSNNLAQASSYIGKNIT 91
            ++N T+  L          Q +S IG+++T
Sbjct: 64 IEKLNETVTGLNSQFLQMQAMQGASLIGRDVT 95


>gi|296135674|ref|YP_003642916.1| flagellar hook capping protein [Thiomonas intermedia K12]
 gi|295795796|gb|ADG30586.1| flagellar hook capping protein [Thiomonas intermedia K12]
          Length = 232

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 9/79 (11%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFS------QMEQSVQMNSTLQELLKSNNL 79
           + F  LL+TQ+ +QDP  PM  ++  AQLA FS       M+QS+   +TL   L     
Sbjct: 38  NTFYTLLVTQLTNQDPMNPMSNTDLSAQLAQFSTASGIQSMQQSM---ATLTAQLAQTQG 94

Query: 80  AQASSYIGKNITNADGSIS 98
            QA++ +G+ +   + SIS
Sbjct: 95  LQAANLVGQTVVFDNNSIS 113


>gi|127512278|ref|YP_001093475.1| flagellar basal body rod modification protein [Shewanella loihica
           PV-4]
 gi|126637573|gb|ABO23216.1| flagellar hook capping protein [Shewanella loihica PV-4]
          Length = 260

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 47/84 (55%), Gaps = 4/84 (4%)

Query: 11  QQEFSKSKSK-KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS- 68
           Q+E S  ++K + L Q+ F  LL  Q+  QDP +P+   + +AQ+A FS ++   ++N  
Sbjct: 48  QEESSIPEAKSQELTQEDFFSLLSQQLSMQDPFKPVDNDQMIAQMASFSTVDGITKLNEE 107

Query: 69  --TLQELLKSNNLAQASSYIGKNI 90
              L  ++ S+   QAS  +G+ +
Sbjct: 108 IVNLNTVMTSSQALQASGLVGQKV 131


>gi|301631990|ref|XP_002945074.1| PREDICTED: basal-body rod modification protein flgD-like [Xenopus
           (Silurana) tropicalis]
          Length = 222

 Score = 41.2 bits (95), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ---ELLKSNNLAQ 81
           QD FLKLL+ Q+ +QDP  PM  ++  +Q+A  + +    Q+N ++Q   E   +    Q
Sbjct: 32  QDRFLKLLVAQLNNQDPMNPMDNAQMTSQMAQINTVTGIQQLNLSMQNMSEQFAAMQTLQ 91

Query: 82  ASSYIGKNI 90
            +  IG+++
Sbjct: 92  GTMMIGRSV 100


>gi|170737037|ref|YP_001778297.1| flagellar hook capping protein [Burkholderia cenocepacia MC0-3]
 gi|169819225|gb|ACA93807.1| flagellar hook capping protein [Burkholderia cenocepacia MC0-3]
          Length = 241

 Score = 41.2 bits (95), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 25/34 (73%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME 61
          F +LL+ Q+K+QDP  PM+A++ V Q A  SQ+E
Sbjct: 33 FTRLLVAQVKNQDPLAPMEANQFVTQFAQMSQVE 66


>gi|294140183|ref|YP_003556161.1| basal-body rod modification protein FlgD [Shewanella violacea
           DSS12]
 gi|293326652|dbj|BAJ01383.1| basal-body rod modification protein FlgD [Shewanella violacea
           DSS12]
          Length = 235

 Score = 41.2 bits (95), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 4/85 (4%)

Query: 9   PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
           P ++   ++ S+  L Q+ F  LL  Q+  QDP +P+   + +AQ+A FS ++    +N 
Sbjct: 23  PEEKSIPEANSQG-LSQEDFFSLLSQQLSMQDPFKPVDNDQMIAQMAAFSTVDGISNLND 81

Query: 69  ---TLQELLKSNNLAQASSYIGKNI 90
               L  ++ S+   QAS  +G+ +
Sbjct: 82  EIINLNTVMTSSQALQASGLVGQKV 106


>gi|71282499|ref|YP_268221.1| basal-body rod modification protein FlgD [Colwellia psychrerythraea
           34H]
 gi|71148239|gb|AAZ28712.1| basal-body rod modification protein FlgD [Colwellia psychrerythraea
           34H]
          Length = 256

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 3/75 (4%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LK 75
           S+  L Q  F  LL  ++ +QDPT+P+  ++ ++Q+  FS  +    +N +       + 
Sbjct: 52  SEGMLTQSDFFALLTKELANQDPTKPVDNNQMISQMTAFSTTDGVRTLNDSFGSFAGSMT 111

Query: 76  SNNLAQASSYIGKNI 90
           S+   QASS +G+++
Sbjct: 112 SSQALQASSLVGRSV 126


>gi|295690743|ref|YP_003594436.1| flagellar hook capping protein [Caulobacter segnis ATCC 21756]
 gi|295432646|gb|ADG11818.1| flagellar hook capping protein [Caulobacter segnis ATCC 21756]
          Length = 242

 Score = 40.8 bits (94), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN---NLAQASS 84
          FLKLL TQ+K+QDP  P   ++   Q+   + +EQ +  N  L  L+  N    L +  S
Sbjct: 31 FLKLLTTQLKNQDPLSPTDTTQMTQQITQMTGVEQQLVTNDLLAALVGMNTGTGLTEGVS 90

Query: 85 YIGKNIT 91
           IGK +T
Sbjct: 91 MIGKQVT 97


>gi|120613058|ref|YP_972736.1| flagellar hook capping protein [Acidovorax citrulli AAC00-1]
 gi|120591522|gb|ABM34962.1| flagellar hook capping protein [Acidovorax citrulli AAC00-1]
          Length = 216

 Score = 40.8 bits (94), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 15 SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ--- 71
          S S +     QD FLKLL+ Q+ +QDP  P+  ++  +Q+A  + +    Q+N ++Q   
Sbjct: 18 SNSATDPAAAQDRFLKLLVAQLNNQDPMNPLDNAQMTSQMAQINTVTGIQQLNLSMQTMA 77

Query: 72 ELLKSNNLAQASSYIGKNI 90
          E   +    Q +  IG+++
Sbjct: 78 EQFSTMQTLQGTMMIGRSV 96


>gi|224825776|ref|ZP_03698880.1| flagellar basal body rod modification protein [Lutiella
          nitroferrum 2002]
 gi|224602000|gb|EEG08179.1| flagellar basal body rod modification protein [Lutiella
          nitroferrum 2002]
          Length = 226

 Score = 40.8 bits (94), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 31/47 (65%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE 72
          D F+ LL+ QIK+Q+P +P   S+ V QL   +QM+ S+ M S L++
Sbjct: 33 DMFMTLLMAQIKNQNPLDPADPSQFVNQLVQMNQMQTSLGMLSQLKD 79


>gi|226944491|ref|YP_002799564.1| flagellar basal body rod modification protein [Azotobacter
          vinelandii DJ]
 gi|226719418|gb|ACO78589.1| Flagellar hook capping protein [Azotobacter vinelandii DJ]
          Length = 222

 Score = 40.4 bits (93), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 40/66 (60%), Gaps = 3/66 (4%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNLAQASS 84
          F+ LLI Q+++QDP +PM+ +E  +QLA  + +    ++N+TL+ +   +      QA++
Sbjct: 32 FMTLLIAQLQNQDPLKPMENAELTSQLAQINTLNGIEELNATLEGITGQIDETQALQAAA 91

Query: 85 YIGKNI 90
           +G  +
Sbjct: 92 LVGHGV 97


>gi|270156915|ref|ZP_06185572.1| flagellar basal body rod modification protein FlgD [Legionella
          longbeachae D-4968]
 gi|289164658|ref|YP_003454796.1| Flagellar basal-body rod modification protein FlgD [Legionella
          longbeachae NSW150]
 gi|269988940|gb|EEZ95194.1| flagellar basal body rod modification protein FlgD [Legionella
          longbeachae D-4968]
 gi|288857831|emb|CBJ11677.1| Flagellar basal-body rod modification protein FlgD [Legionella
          longbeachae NSW150]
          Length = 224

 Score = 40.4 bits (93), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 42/74 (56%), Gaps = 3/74 (4%)

Query: 20 KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKS 76
          KK   +  FL  ++ QI++QD  +     E ++QLA F+  +  + M  +LQ++   L+S
Sbjct: 24 KKNFEEQVFLHSMVEQIENQDMMQRQINHEFLSQLAQFATHDGCIAMQESLQQMSTSLQS 83

Query: 77 NNLAQASSYIGKNI 90
          N   QAS+ +G+ +
Sbjct: 84 NQALQASALVGRKV 97


>gi|124268255|ref|YP_001022259.1| flagellar hook capping protein [Methylibium petroleiphilum PM1]
 gi|124261030|gb|ABM96024.1| flagellar hook capping protein [Methylibium petroleiphilum PM1]
          Length = 217

 Score = 40.4 bits (93), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 24/32 (75%)

Query: 24 GQDAFLKLLITQIKHQDPTEPMKASEQVAQLA 55
          G + FLKLL+TQ+K+QDP  PM  ++  +Q+A
Sbjct: 28 GSERFLKLLVTQMKNQDPMNPMDNAQVTSQIA 59


>gi|188493605|ref|ZP_03000875.1| flagellar hook capping protein [Escherichia coli 53638]
 gi|188488804|gb|EDU63907.1| flagellar hook capping protein [Escherichia coli 53638]
          Length = 237

 Score = 40.4 bits (93), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (65%), Gaps = 4/47 (8%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
          D FL L + +I++Q+PT+P  A+E + QL+  +Q+    E SVQ N+
Sbjct: 37 DTFLTLFVAEIQNQEPTDPTDATEYIDQLSSMAQVAMMEEMSVQANT 83


>gi|294339844|emb|CAZ88207.1| putative Basal-body rod modification protein flgD [Thiomonas sp.
           3As]
          Length = 232

 Score = 40.0 bits (92), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 9/79 (11%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFS------QMEQSVQMNSTLQELLKSNNL 79
           + F  LL+TQ+ +QDP  PM  ++  AQLA FS       M+QS+   +TL   L     
Sbjct: 38  NTFYTLLVTQLTNQDPMNPMSNTDLSAQLAQFSTASGIQSMQQSM---ATLTAQLAQTQG 94

Query: 80  AQASSYIGKNITNADGSIS 98
            QA++ +G+ +   + S+S
Sbjct: 95  LQAANLVGQTVVFDNNSLS 113


>gi|254255086|ref|ZP_04948403.1| Flagellar hook capping protein [Burkholderia dolosa AUO158]
 gi|124899731|gb|EAY71574.1| Flagellar hook capping protein [Burkholderia dolosa AUO158]
          Length = 220

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 23/34 (67%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME 61
          F  LLI QI++QDP  PM AS+ V Q A  SQ+E
Sbjct: 36 FTTLLIAQIRNQDPLAPMDASQFVNQFAQMSQVE 69


>gi|266623342|ref|ZP_06116277.1| flagellar hook capping protein [Clostridium hathewayi DSM 13479]
 gi|288864880|gb|EFC97178.1| flagellar hook capping protein [Clostridium hathewayi DSM 13479]
          Length = 205

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 44/81 (54%), Gaps = 7/81 (8%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
           S K +  + FL L++ Q+K+QD   P+  ++ V QLA  S M+Q       ++E+  +  
Sbjct: 63  SDKAVSMEDFLTLMVAQLKNQDFMNPVDDTQYVTQLAQISTMQQ-------MEEMAYNAK 115

Query: 79  LAQASSYIGKNITNADGSISG 99
               +S +GK +T A  +++G
Sbjct: 116 STYVTSLVGKTVTAAKFTVAG 136


>gi|153840218|ref|ZP_01992885.1| flagellar basal body rod modification protein [Vibrio
          parahaemolyticus AQ3810]
 gi|149746114|gb|EDM57244.1| flagellar basal body rod modification protein [Vibrio
          parahaemolyticus AQ3810]
          Length = 59

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 28/41 (68%)

Query: 31 LLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
          L++ QI++QDP  P+  +E V QLA FSQ++ +  M+  +Q
Sbjct: 1  LMVAQIQNQDPLNPLDGTEYVGQLAQFSQVQSTENMSKVMQ 41


>gi|50954408|ref|YP_061696.1| flagellar hook assembly protein [Leifsonia xyli subsp. xyli str.
          CTCB07]
 gi|50950890|gb|AAT88591.1| flagellar hook assembly protein [Leifsonia xyli subsp. xyli str.
          CTCB07]
          Length = 90

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 29/44 (65%), Gaps = 3/44 (6%)

Query: 21 KTLGQDAFLKLLITQIKHQDPTEPMKAS---EQVAQLAVFSQME 61
          +T+G + F+ LL+ Q+++QDPT PM  +   +Q  QLA+   M+
Sbjct: 27 QTMGAEQFMHLLVVQLQNQDPTSPMDTAQMVQQTTQLAMMRSMQ 70


>gi|319764538|ref|YP_004128475.1| flagellar hook capping protein [Alicycliphilus denitrificans BC]
 gi|330826754|ref|YP_004390057.1| flagellar hook capping protein [Alicycliphilus denitrificans K601]
 gi|317119099|gb|ADV01588.1| flagellar hook capping protein [Alicycliphilus denitrificans BC]
 gi|329312126|gb|AEB86541.1| flagellar hook capping protein [Alicycliphilus denitrificans K601]
          Length = 220

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 57/122 (46%), Gaps = 16/122 (13%)

Query: 25  QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ---ELLKSNNLAQ 81
           QD FLKLL+ Q+ +QDP  P+  ++   Q+A  + +     +N T+Q   E   +    Q
Sbjct: 32  QDRFLKLLVAQLNNQDPMNPLDNAQMTTQMAQINTVTGLQTLNLTMQTMAEQFSTMQQIQ 91

Query: 82  ASSYIGKNITN-------ADGS------ISGVVNAIQVSSTGLTAITVDNTEIPITTGIR 128
             S IG+++ +       ADG+      ++G    ++V       + VD+ ++    G R
Sbjct: 92  GISLIGRSVLSEGDRMSFADGTGKGMFDLAGAATNVKVDIVTAGGVVVDSIDMGAQEGGR 151

Query: 129 IS 130
            S
Sbjct: 152 HS 153


>gi|260768783|ref|ZP_05877717.1| flagellar basal-body rod modification protein FlgD [Vibrio
          furnissii CIP 102972]
 gi|260616813|gb|EEX41998.1| flagellar basal-body rod modification protein FlgD [Vibrio
          furnissii CIP 102972]
          Length = 234

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 28/43 (65%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
          F+ L++ Q+++QDP  P   ++ V QLA F+Q++ +  M S L
Sbjct: 37 FITLMVAQVQNQDPLNPTDGTQYVTQLAQFAQVQSTDNMVSIL 79


>gi|170725954|ref|YP_001759980.1| flagellar basal body rod modification protein [Shewanella woodyi
           ATCC 51908]
 gi|169811301|gb|ACA85885.1| flagellar hook capping protein [Shewanella woodyi ATCC 51908]
          Length = 270

 Score = 39.3 bits (90), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 3/71 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS---TLQELLKSNNL 79
           L Q+ F  LL  Q+  QDP +P+   + +AQ+A FS ++    +N     L  ++ S+  
Sbjct: 71  LTQEDFFSLLSQQLSMQDPFKPVDNDQMIAQMASFSTVDGINNLNDEIVNLNTVMTSSQA 130

Query: 80  AQASSYIGKNI 90
            QAS  +G+ +
Sbjct: 131 LQASGLVGQKV 141


>gi|91792663|ref|YP_562314.1| flagellar basal body rod modification protein [Shewanella
           denitrificans OS217]
 gi|91714665|gb|ABE54591.1| flagellar hook capping protein [Shewanella denitrificans OS217]
          Length = 263

 Score = 39.3 bits (90), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 4/85 (4%)

Query: 9   PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
           PT+    ++K  ++L Q  F  LL  Q+  QDP +P+   + + Q+A FS ++   ++N 
Sbjct: 51  PTESAIPEAK-DQSLTQKDFFALLSQQLSMQDPFKPVDNDQMIQQMASFSTVDGITKLNE 109

Query: 69  ---TLQELLKSNNLAQASSYIGKNI 90
               L  +  S+   QAS  +G+ +
Sbjct: 110 EILNLTSVTSSSQALQASGLVGRKV 134


>gi|157147103|ref|YP_001454422.1| flagellar basal body rod modification protein [Citrobacter koseri
          ATCC BAA-895]
 gi|157084308|gb|ABV13986.1| hypothetical protein CKO_02880 [Citrobacter koseri ATCC BAA-895]
          Length = 227

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 25/34 (73%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME 61
          F++LL+ QI++QDP  P   +E V+QLA  +Q++
Sbjct: 35 FMQLLVAQIQNQDPLNPTDGTEYVSQLAQLTQVQ 68


>gi|283834456|ref|ZP_06354197.1| basal-body rod modification protein FlgD [Citrobacter youngae ATCC
           29220]
 gi|291070003|gb|EFE08112.1| basal-body rod modification protein FlgD [Citrobacter youngae ATCC
           29220]
          Length = 295

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 4/47 (8%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
           D FL L + +I++QDPT+P   +  + QL+  +Q+    E SVQ N+
Sbjct: 70  DTFLTLFVAEIENQDPTDPTDPTAYIDQLSSMAQVAMMEEMSVQANT 116


>gi|315180487|gb|ADT87401.1| flagellar basal body rod modification protein D [Vibrio furnissii
          NCTC 11218]
          Length = 164

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 28/43 (65%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
          F+ L++ Q+++QDP  P   ++ V QLA F+Q++ +  M S L
Sbjct: 37 FITLMVAQVQNQDPLNPTDGTQYVTQLAQFAQVQSTDNMVSIL 79


>gi|283784084|ref|YP_003363949.1| lateral flagellar rod protein [Citrobacter rodentium ICC168]
 gi|282947538|emb|CBG87090.1| lateral flagellar rod protein [Citrobacter rodentium ICC168]
          Length = 270

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 31/49 (63%), Gaps = 4/49 (8%)

Query: 24  GQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM----EQSVQMNS 68
           G + FL L + +I++QDPT+P   ++ + QL+  +Q+    E SVQ N+
Sbjct: 63  GVETFLTLFVAEIQNQDPTDPADPTDYIDQLSSMAQVAMMEEMSVQANT 111


>gi|167567749|ref|ZP_02360665.1| flagellar basal body rod modification protein [Burkholderia
          oklahomensis EO147]
 gi|167574700|ref|ZP_02367574.1| flagellar basal body rod modification protein [Burkholderia
          oklahomensis C6786]
          Length = 223

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%), Gaps = 5/61 (8%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSY 85
          D F KLL  QI++Q+P EPM +S+ V QL +   M+Q+  M +    +L + NLA  SS 
Sbjct: 35 DLFAKLLDAQIRNQNPLEPMDSSQFVTQLMM---MQQTQAMETV--AVLTNQNLATTSSM 89

Query: 86 I 86
          +
Sbjct: 90 L 90


>gi|114569240|ref|YP_755920.1| flagellar hook capping protein [Maricaulis maris MCS10]
 gi|114339702|gb|ABI64982.1| flagellar hook capping protein [Maricaulis maris MCS10]
          Length = 221

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSV 64
          FL LL  Q+K+QDP  P+ +++ V QL  FS +EQ +
Sbjct: 29 FLTLLTEQMKNQDPLNPLDSTQFVNQLVDFSSVEQQI 65


>gi|167948871|ref|ZP_02535945.1| flagellar basal body rod modification protein [Endoriftia
          persephone 'Hot96_1+Hot96_2']
          Length = 113

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 2/69 (2%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIG 87
          F+ L++T++ HQDP +PM+ +E   Q++ F+ +     +N +   L  S +L   ++  G
Sbjct: 33 FMNLMVTELTHQDPFKPMENTELATQISQFAAVSGIDDLNKSFTGLSSSMHLRSGAT--G 90

Query: 88 KNITNADGS 96
          +    A G+
Sbjct: 91 RQFVGAPGA 99


>gi|157376217|ref|YP_001474817.1| flagellar basal body rod modification protein [Shewanella sediminis
           HAW-EB3]
 gi|157318591|gb|ABV37689.1| flagellar hook capping protein [Shewanella sediminis HAW-EB3]
          Length = 282

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 47/92 (51%), Gaps = 12/92 (13%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS---TLQELLKSNNL 79
           L Q+ F  LL  Q+  QDP +P+   + ++Q+A FS ++    +N     L  ++ S+  
Sbjct: 71  LTQEDFFSLLSQQLSMQDPFKPVDNDQMISQMASFSTVDGIKNLNDEIVNLNSVMTSSQA 130

Query: 80  AQASSYIGKN---------ITNADGSISGVVN 102
            QAS  +G+          I+  D SI+G+++
Sbjct: 131 LQASGLVGQKVLIPSDTGYISAEDPSINGIIS 162


>gi|292489134|ref|YP_003532021.1| basal-body rod modification protein FlgD [Erwinia amylovora
          CFBP1430]
 gi|292900253|ref|YP_003539622.1| basal-body rod modification protein [Erwinia amylovora ATCC
          49946]
 gi|291200101|emb|CBJ47227.1| basal-body rod modification protein [Erwinia amylovora ATCC
          49946]
 gi|291554568|emb|CBA22182.1| Basal-body rod modification protein flgD [Erwinia amylovora
          CFBP1430]
 gi|312173292|emb|CBX81547.1| Basal-body rod modification protein flgD [Erwinia amylovora ATCC
          BAA-2158]
          Length = 226

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 6/91 (6%)

Query: 3  INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
          +N    P Q +   S +  +    +F+ LLI Q+++QDPT PM  ++  +QLA F+    
Sbjct: 6  VNNTRGPGQVDMGSSAADLS---GSFMTLLIAQMQNQDPTNPMDNNQLTSQLAQFNTASG 62

Query: 63 SVQMNSTLQ---ELLKSNNLAQASSYIGKNI 90
            ++N ++     +L       A+S++G+ +
Sbjct: 63 VEKLNDSVAIVGGMLVQMQEMGATSWVGREV 93


>gi|222112271|ref|YP_002554535.1| flagellar hook capping protein [Acidovorax ebreus TPSY]
 gi|221731715|gb|ACM34535.1| flagellar hook capping protein [Acidovorax ebreus TPSY]
          Length = 216

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ---ELLKSNNLAQ 81
          QD FLKLL+ Q+ +QDP  P+  ++   Q+A  + +     +N T+Q   E   +    Q
Sbjct: 28 QDRFLKLLVAQLNNQDPMNPLDNAQMTTQMAQINTVTGIQTLNLTMQTMAEEFSTMQQIQ 87

Query: 82 ASSYIGKNI 90
            S IG+++
Sbjct: 88 GISLIGRSV 96


>gi|121596116|ref|YP_988012.1| flagellar hook capping protein [Acidovorax sp. JS42]
 gi|120608196|gb|ABM43936.1| flagellar hook capping protein [Acidovorax sp. JS42]
          Length = 216

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ---ELLKSNNLAQ 81
          QD FLKLL+ Q+ +QDP  P+  ++   Q+A  + +     +N T+Q   E   +    Q
Sbjct: 28 QDRFLKLLVAQLNNQDPMNPLDNAQMTTQMAQINTVTGIQTLNLTMQTMAEEFSTMQQIQ 87

Query: 82 ASSYIGKNI 90
            S IG+++
Sbjct: 88 GISLIGRSV 96


>gi|310764861|gb|ADP09811.1| Flagellar basal-body rod modification protein, FlgD [Erwinia sp.
          Ejp617]
          Length = 226

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 6/91 (6%)

Query: 3  INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
          +N    P Q +   S +  +    +F+ LLI Q+++QDPT PM  ++  +QLA F+    
Sbjct: 6  VNNTRGPGQVDMGSSAADIS---GSFMTLLIAQMQNQDPTNPMDNNQLTSQLAQFNTAAG 62

Query: 63 SVQMNSTLQ---ELLKSNNLAQASSYIGKNI 90
            ++N ++     +L       A+S++G+ +
Sbjct: 63 VEKLNDSVAIVGGMLVQMQEMGATSWVGREV 93


>gi|259907633|ref|YP_002647989.1| Flagellar basal-body rod modification protein, FlgD [Erwinia
          pyrifoliae Ep1/96]
 gi|224963255|emb|CAX54739.1| Flagellar basal-body rod modification protein, FlgD [Erwinia
          pyrifoliae Ep1/96]
 gi|283477475|emb|CAY73391.1| Basal-body rod modification protein flgD [Erwinia pyrifoliae DSM
          12163]
          Length = 226

 Score = 38.5 bits (88), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 6/91 (6%)

Query: 3  INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
          +N    P Q +   S +  +    +F+ LLI Q+++QDPT PM  ++  +QLA F+    
Sbjct: 6  VNNTRGPGQVDMGSSAADIS---GSFMTLLIAQMQNQDPTNPMDNNQLTSQLAQFNTAAG 62

Query: 63 SVQMNSTLQ---ELLKSNNLAQASSYIGKNI 90
            ++N ++     +L       A+S++G+ +
Sbjct: 63 VEKLNDSVAIVGGMLVQMQEMGATSWVGREV 93


>gi|167623360|ref|YP_001673654.1| flagellar basal body rod modification protein [Shewanella
           halifaxensis HAW-EB4]
 gi|167353382|gb|ABZ75995.1| flagellar hook capping protein [Shewanella halifaxensis HAW-EB4]
          Length = 267

 Score = 38.5 bits (88), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 12/92 (13%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQELLKSNNL 79
           L Q+ F  LL  Q+  QDP +P+   + + Q+A FS ++   ++N     L  L  S+  
Sbjct: 68  LSQEDFFSLLSQQLSMQDPFKPVDNDQMIQQMASFSTVDGISKLNEEIGNLNALTSSSQA 127

Query: 80  AQASSYIGK---------NITNADGSISGVVN 102
            QAS  +G+         +I+  D S+ G+++
Sbjct: 128 LQASGLVGQKVLIPSDTAHISAEDPSMKGIIS 159


>gi|85058010|ref|YP_453712.1| flagellar basal-body rod modification protein FlgD [Sodalis
           glossinidius str. 'morsitans']
 gi|84778530|dbj|BAE73307.1| flagellar basal-body rod modification protein FlgD [Sodalis
           glossinidius str. 'morsitans']
          Length = 269

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 44/71 (61%), Gaps = 9/71 (12%)

Query: 26  DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSV---QMNSTLQELLKSNNLAQA 82
           D FL++++ QIK+QDPT PM  ++  +Q+A   QM  ++   ++N+T+  +    N  QA
Sbjct: 72  DNFLQMMLAQIKNQDPTNPMDNNQLASQMA---QMHVALGVEKLNNTVLGMGNMVNSVQA 128

Query: 83  ---SSYIGKNI 90
              S+++G+ +
Sbjct: 129 VNLSNWVGRTV 139


>gi|305663892|ref|YP_003860180.1| AAA ATPase central domain protein [Ignisphaera aggregans DSM 17230]
 gi|304378461|gb|ADM28300.1| AAA ATPase central domain protein [Ignisphaera aggregans DSM 17230]
          Length = 480

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 40/82 (48%), Gaps = 2/82 (2%)

Query: 41  PTEP-MKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISG 99
           P +P ++   ++A++  F ++ +S  M   L ++ ++ NL      I   I  A+G +  
Sbjct: 145 PYDPSLRVLREIAEMVQFKKLSKS-DMRMVLNKICRAENLRCDEEAIDYIIERAEGDLRA 203

Query: 100 VVNAIQVSSTGLTAITVDNTEI 121
            +N +Q    G   +T+D  +I
Sbjct: 204 AINDLQAVGEGFGEVTLDRAKI 225


>gi|323171062|gb|EFZ56711.1| flagellar hook capping family protein [Escherichia coli LT-68]
          Length = 234

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 31/44 (70%), Gaps = 1/44 (2%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ-SVQMNS 68
          DAFL L + +I++QDPT+  +  +Q++ +A  + ME+ SVQ N+
Sbjct: 37 DAFLTLFVAEIQNQDPTDATEYIDQLSSMAQVAMMEEMSVQANT 80


>gi|157961170|ref|YP_001501204.1| flagellar basal body rod modification protein [Shewanella pealeana
           ATCC 700345]
 gi|157846170|gb|ABV86669.1| flagellar hook capping protein [Shewanella pealeana ATCC 700345]
          Length = 270

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 47/92 (51%), Gaps = 12/92 (13%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS---TLQELLKSNNL 79
           L Q+ F  LL  Q+  QDP +P++  + + Q+A FS ++   ++N     L  L  S+  
Sbjct: 71  LTQEDFFSLLSQQLSMQDPFKPVENDQMIQQMASFSTVDGISKLNEEIINLNALTSSSQA 130

Query: 80  AQASSYIGK---------NITNADGSISGVVN 102
            QAS  +G+         +I+  D S+ G+++
Sbjct: 131 LQASGLVGQKVLIPSDTAHISAEDPSMKGIIS 162


>gi|146305249|ref|YP_001185714.1| flagellar basal body rod modification protein [Pseudomonas
          mendocina ymp]
 gi|145573450|gb|ABP82982.1| flagellar hook capping protein [Pseudomonas mendocina ymp]
          Length = 225

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 4/50 (8%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
          FL L++ QI++QDPT+P+ ++E + Q A  SQ++    M S    L KSN
Sbjct: 36 FLTLMVAQIQNQDPTKPVDSTEFLNQFAAMSQVKSLENMAS----LSKSN 81


>gi|330501136|ref|YP_004378005.1| flagellar basal body rod modification protein [Pseudomonas
          mendocina NK-01]
 gi|328915422|gb|AEB56253.1| flagellar basal body rod modification protein [Pseudomonas
          mendocina NK-01]
          Length = 225

 Score = 38.1 bits (87), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 4/50 (8%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
          FL L++ QI++QDPT+P+ ++E + Q A  SQ++    M S    L KSN
Sbjct: 36 FLTLMVAQIQNQDPTKPVDSTEFLNQFAAMSQVKSLENMAS----LSKSN 81


>gi|212634347|ref|YP_002310872.1| flagellar basal body rod modification protein [Shewanella
           piezotolerans WP3]
 gi|212555831|gb|ACJ28285.1| Flagellar hook capping protein [Shewanella piezotolerans WP3]
          Length = 267

 Score = 37.7 bits (86), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS---TLQELLKSNNL 79
           L Q+ F  LL  Q+  QDP +P+   + + Q+A FS ++   ++N     L  L  S+  
Sbjct: 68  LSQEDFFSLLSQQLSMQDPFKPVDNDQMIQQMASFSTVDGISKLNEEIVNLNALTTSSQA 127

Query: 80  AQASSYIGKNI 90
            QAS  +G+ +
Sbjct: 128 LQASGLVGQKV 138


>gi|167614836|ref|ZP_02383471.1| flagellar basal body rod modification protein [Burkholderia
          thailandensis Bt4]
 gi|257141421|ref|ZP_05589683.1| flagellar basal body rod modification protein [Burkholderia
          thailandensis E264]
          Length = 241

 Score = 37.7 bits (86), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (66%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME 61
          D F KLL  QI++Q+P EPM AS+ V Q+ +  Q E
Sbjct: 44 DLFAKLLAAQIQNQNPLEPMDASQFVTQIMMGQQTE 79


>gi|167576661|ref|ZP_02369535.1| flagellar basal body rod modification protein [Burkholderia
          thailandensis TXDOH]
          Length = 241

 Score = 37.7 bits (86), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (66%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME 61
          D F KLL  QI++Q+P EPM AS+ V Q+ +  Q E
Sbjct: 44 DLFAKLLAAQIQNQNPLEPMDASQFVTQIMMGQQTE 79


>gi|83716169|ref|YP_438388.1| flagellar basal body rod modification protein [Burkholderia
          thailandensis E264]
 gi|83649994|gb|ABC34058.1| basal-body rod modification protein FlgD, putative [Burkholderia
          thailandensis E264]
          Length = 231

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (66%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME 61
          D F KLL  QI++Q+P EPM AS+ V Q+ +  Q E
Sbjct: 34 DLFAKLLAAQIQNQNPLEPMDASQFVTQIMMGQQTE 69


>gi|254519416|ref|ZP_05131472.1| flagellar hook assembly protein FlgD [Clostridium sp. 7_2_43FAA]
 gi|226913165|gb|EEH98366.1| flagellar hook assembly protein FlgD [Clostridium sp. 7_2_43FAA]
          Length = 232

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 57/105 (54%), Gaps = 13/105 (12%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           K  + + ++AFL +L  ++ + DP     +++ V Q+A F+ MEQ   +N+T+       
Sbjct: 22  KPGQDMDKNAFLTILSAELSNMDPMGNNDSTQYVTQMAQFASMEQMTNLNTTMSSYAH-- 79

Query: 78  NLAQASSYIGKNIT----NADGS-ISGVVNAIQVSSTGLTAITVD 117
                +S +GK +T    +++G   +G+V ++  S++  T I+V+
Sbjct: 80  -----NSMVGKGVTLKSVDSEGKPYTGIVKSV-TSTSAKTTISVE 118


>gi|237752019|ref|ZP_04582499.1| flagellar biosynthesis protein [Helicobacter winghamensis ATCC
          BAA-430]
 gi|229376586|gb|EEO26677.1| flagellar biosynthesis protein [Helicobacter winghamensis ATCC
          BAA-430]
          Length = 262

 Score = 37.7 bits (86), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 29/45 (64%)

Query: 29 LKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          ++L + Q+K+QDPT PM+  E + Q A  +Q+E   +M   ++++
Sbjct: 1  MRLFLEQLKNQDPTAPMETQEILTQTAQLTQVEAQEKMKKAMEDM 45


>gi|126443508|ref|YP_001061245.1| flagellar basal body rod modification protein [Burkholderia
          pseudomallei 668]
 gi|134280664|ref|ZP_01767374.1| basal-body rod modification protein FlgD, putative [Burkholderia
          pseudomallei 305]
 gi|167725929|ref|ZP_02409165.1| flagellar basal body rod modification protein [Burkholderia
          pseudomallei DM98]
 gi|167905089|ref|ZP_02492294.1| flagellar basal body rod modification protein [Burkholderia
          pseudomallei NCTC 13177]
 gi|254299687|ref|ZP_04967136.1| LfgD [Burkholderia pseudomallei 406e]
 gi|126222999|gb|ABN86504.1| flagellar hook capping protein [Burkholderia pseudomallei 668]
 gi|134247686|gb|EBA47770.1| basal-body rod modification protein FlgD, putative [Burkholderia
          pseudomallei 305]
 gi|157809654|gb|EDO86824.1| LfgD [Burkholderia pseudomallei 406e]
          Length = 241

 Score = 37.7 bits (86), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (66%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME 61
          D F KLL  QI++Q+P EPM AS+ V Q+ +  Q E
Sbjct: 44 DLFAKLLAAQIQNQNPLEPMDASQFVTQIMMGQQTE 79


>gi|125657217|gb|ABN48705.1| flagellar hook capping protein [Burkholderia pseudomallei]
          Length = 231

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (66%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME 61
          D F KLL  QI++Q+P EPM AS+ V Q+ +  Q E
Sbjct: 34 DLFAKLLAAQIQNQNPLEPMDASQFVTQIMMGQQTE 69


>gi|302382559|ref|YP_003818382.1| flagellar hook capping protein [Brevundimonas subvibrioides ATCC
          15264]
 gi|302193187|gb|ADL00759.1| flagellar hook capping protein [Brevundimonas subvibrioides ATCC
          15264]
          Length = 222

 Score = 37.7 bits (86), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL---QELLKSNNLAQA 82
          + FL LL +Q+K+QDP  P+ +++   QL   S +EQ +  N  L       +   L  A
Sbjct: 27 ETFLSLLTSQLKNQDPLSPLDSNQFTQQLTQMSGVEQQLMTNDLLTSLLAAQQGGGLGGA 86

Query: 83 SSYIGKNIT 91
          ++YIGK+ T
Sbjct: 87 ANYIGKDAT 95


>gi|171059413|ref|YP_001791762.1| flagellar hook capping protein [Leptothrix cholodnii SP-6]
 gi|170776858|gb|ACB34997.1| flagellar hook capping protein [Leptothrix cholodnii SP-6]
          Length = 224

 Score = 37.4 bits (85), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 33/51 (64%), Gaps = 6/51 (11%)

Query: 26 DAFLKLLITQIKHQDPTEPM---KASEQVAQLAVFSQMEQSVQMNSTLQEL 73
          D FLKLL+ Q+++QDP  PM   + + Q+AQ+   S +E   ++N ++Q +
Sbjct: 34 DRFLKLLVAQMQNQDPLSPMDNAQVTSQMAQINTVSGIE---KVNESIQAM 81


>gi|16125153|ref|NP_419717.1| flagellar hook assembly protein FlgD [Caulobacter crescentus
          CB15]
 gi|221233883|ref|YP_002516319.1| basal-body rod modification protein FlgD [Caulobacter crescentus
          NA1000]
 gi|3493242|gb|AAC33328.1| putative scaffolding protein [Caulobacter crescentus CB15]
 gi|13422165|gb|AAK22885.1| flagellar hook assembly protein FlgD, putative [Caulobacter
          crescentus CB15]
 gi|220963055|gb|ACL94411.1| Basal-body rod modification protein FlgD [Caulobacter crescentus
          NA1000]
          Length = 227

 Score = 37.4 bits (85), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN---NLAQ 81
          ++ FL+LL TQ+K+QDP  P   ++   Q+   + +EQ +  N  L  L+  N    L++
Sbjct: 28 KETFLQLLTTQLKNQDPLSPTDTTQMTQQITQMTGVEQQLVTNDLLAALVGMNTGTGLSE 87

Query: 82 ASSYIGKNI 90
            + IGK +
Sbjct: 88 GVAMIGKQV 96


>gi|260222466|emb|CBA32058.1| hypothetical protein Csp_D30220 [Curvibacter putative symbiont of
          Hydra magnipapillata]
          Length = 184

 Score = 37.4 bits (85), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 29 LKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ---ELLKSNNLAQASSY 85
          +KLL+ Q+ +QDP  PM  ++  +Q+A  + +    ++N+T++   E   S  + Q +S 
Sbjct: 1  MKLLVAQLNNQDPMNPMDNAQMTSQIAQINTVSGIQELNATMKSMAEQFTSMQVLQGASM 60

Query: 86 IGKNITNADGSIS 98
          +G  +    G++S
Sbjct: 61 VGHGVLVESGTLS 73


>gi|289809013|ref|ZP_06539642.1| flagellar basal body rod modification protein [Salmonella
          enterica subsp. enterica serovar Typhi str. AG3]
          Length = 43

 Score = 37.4 bits (85), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 29/39 (74%), Gaps = 3/39 (7%)

Query: 27 AFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQ 62
          +FL LL+ Q+K+QDPT P++ +E   Q+AQ++  S +E+
Sbjct: 2  SFLTLLVAQLKNQDPTNPLQNNELTTQLAQISTVSGIEK 40


>gi|94968674|ref|YP_590722.1| putative basal-body rod modification protein FlgD [Candidatus
          Koribacter versatilis Ellin345]
 gi|94550724|gb|ABF40648.1| putative basal-body rod modification protein FlgD [Candidatus
          Koribacter versatilis Ellin345]
          Length = 92

 Score = 37.4 bits (85), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (67%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME 61
          F +LL+ Q+K QDPT PM  S+ V+QL   + ++
Sbjct: 30 FAQLLVAQLKSQDPTSPMDPSQLVSQLVGLNTLD 63


>gi|238782791|ref|ZP_04626820.1| Flagellar hook capping protein [Yersinia bercovieri ATCC 43970]
 gi|238716214|gb|EEQ08197.1| Flagellar hook capping protein [Yersinia bercovieri ATCC 43970]
          Length = 187

 Score = 37.0 bits (84), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 36 IKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE---LLKSNNLAQASSYIGKNI 90
          +++QDPT PM  ++  +QLA F+      Q+NSTL     L+ S     A+ ++G+N+
Sbjct: 1  MQNQDPTNPMDNNQLTSQLAQFNTASGVQQLNSTLNSVGTLVTSMQQMNAAEWVGRNV 58


>gi|39934379|ref|NP_946655.1| flagellar hook capping protein [Rhodopseudomonas palustris CGA009]
 gi|192289902|ref|YP_001990507.1| flagellar hook capping protein [Rhodopseudomonas palustris TIE-1]
 gi|39648228|emb|CAE26747.1| possible flagellar basal-body rod modification protein FlgD
           [Rhodopseudomonas palustris CGA009]
 gi|192283651|gb|ACF00032.1| flagellar hook capping protein [Rhodopseudomonas palustris TIE-1]
          Length = 237

 Score = 37.0 bits (84), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 50/96 (52%), Gaps = 12/96 (12%)

Query: 37  KHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQAS---SYIGKNITNA 93
           K+Q+PT+P+  ++   QL  F+ +EQ ++ N +L  L++    AQA+   S +G N    
Sbjct: 50  KNQNPTDPLDTNQFTQQLVQFAGIEQQLKTNDSLSSLVQLQTTAQATQAMSLVGAN---- 105

Query: 94  DGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
                 +V+  +V  T   AI   +T+ P++  + I
Sbjct: 106 -----AIVDGSKVQMTKGNAIWSLSTDKPVSAQVSI 136


>gi|325295416|ref|YP_004281930.1| flagellar hook capping protein [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065864|gb|ADY73871.1| flagellar hook capping protein [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 219

 Score = 37.0 bits (84), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 51/97 (52%), Gaps = 10/97 (10%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASE------QVAQLAVFSQMEQSVQMNSTLQELLKS 76
           + Q+ FLK+L+  I+ QDP      SE      ++ +L V +  E ++Q   T    L+S
Sbjct: 30  MSQEDFLKVLLADIQWQDPLNAKDISEFINNAVKLQELEVLNSFESNIQ---TFVSTLQS 86

Query: 77  NNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTA 113
            +L  AS++IGK +   +G+ + V N    +S  L++
Sbjct: 87  QSLFFASNFIGK-LVEYEGNQTYVQNGTGYASFSLSS 122


>gi|192289141|ref|YP_001989746.1| flagellar hook capping protein [Rhodopseudomonas palustris TIE-1]
 gi|192282890|gb|ACE99270.1| flagellar hook capping protein [Rhodopseudomonas palustris TIE-1]
          Length = 222

 Score = 37.0 bits (84), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 29/49 (59%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
          FL LLI+++++QDP      ++ + QL  ++   Q  ++NS++  L  S
Sbjct: 33 FLSLLISELQNQDPLNATSTTDFINQLTSYANFSQQQEINSSMTSLANS 81


>gi|239628986|ref|ZP_04672017.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239519132|gb|EEQ58998.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 213

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 38/72 (52%), Gaps = 7/72 (9%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIG 87
           FL L++ Q+K+QD   P+  ++ V QLA  S M+Q  QM    +           +S +G
Sbjct: 78  FLTLMVAQLKNQDFMNPVDDTQYVTQLAQISTMQQMEQMAYNAKSTY-------VTSLVG 130

Query: 88  KNITNADGSISG 99
           K ++ A  ++SG
Sbjct: 131 KYVSAAKFTVSG 142


>gi|439980|gb|AAA73466.1| unknown [Treponema phagedenis]
          Length = 97

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 8/65 (12%)

Query: 44  PMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL---AQASSYIGKNITNADGSI--S 98
           PM+ ++ VAQ+A F+ +E   QM +  Q   K NNL   ++A + +GK +   DGSI  S
Sbjct: 3   PMEDTQFVAQMAQFTSLE---QMTNVSQSFEKLNNLLSGSEAVNAVGKQVNIEDGSIKVS 59

Query: 99  GVVNA 103
           GV+ A
Sbjct: 60  GVITA 64


>gi|53713059|ref|YP_099051.1| hypothetical protein BF1770 [Bacteroides fragilis YCH46]
 gi|52215924|dbj|BAD48517.1| conserved hypothetical protein [Bacteroides fragilis YCH46]
          Length = 386

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 44/98 (44%), Gaps = 6/98 (6%)

Query: 7   VNPTQQEFSKSK--SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSV 64
           +N  + +F KS   + K  G DAF K    +    DP  P+  +        F++++   
Sbjct: 268 LNKIETDFKKSLNLAYKIFGNDAFRK----RYSETDPRNPINKAYFEVITVTFAELDDQA 323

Query: 65  QMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVN 102
             N T++  +  +NL QA   +G+ ++   G+   V N
Sbjct: 324 HDNLTVKAPILKHNLIQAMGTLGRYLSQGTGTTDSVFN 361


>gi|256420019|ref|YP_003120672.1| TonB-dependent receptor plug [Chitinophaga pinensis DSM 2588]
 gi|256034927|gb|ACU58471.1| TonB-dependent receptor plug [Chitinophaga pinensis DSM 2588]
          Length = 1109

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 5/62 (8%)

Query: 11  QQEFSK--SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
           Q + SK  S  ++TL QD +LKLL    K+   T+P+K ++Q  +  +FS+    V  N 
Sbjct: 351 QTDISKAISNRQRTLTQDEYLKLLYETYKN---TDPIKWTDQAIKSDLFSKFSYRVNGND 407

Query: 69  TL 70
           T+
Sbjct: 408 TI 409


>gi|229172399|ref|ZP_04299958.1| Flagellar hook assembly protein [Bacillus cereus MM3]
 gi|228610870|gb|EEK68133.1| Flagellar hook assembly protein [Bacillus cereus MM3]
          Length = 195

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASE---QVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           + +D FLKL +   + QDP   M  ++   Q AQL++  Q++   +    LQ  + S  L
Sbjct: 52  MNKDDFLKLFLASFQQQDPFNAMDTNQMMNQTAQLSLMEQVQNMTKAVDKLQATMYSTAL 111

Query: 80  AQASSYIGKNI 90
                ++GK +
Sbjct: 112 DGGMKFLGKYV 122


>gi|39933721|ref|NP_945997.1| basal-body rod modification protein flgD [Rhodopseudomonas
           palustris CGA009]
 gi|39647568|emb|CAE26088.1| possible basal-body rod modification protein flgD [Rhodopseudomonas
           palustris CGA009]
          Length = 265

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 29/49 (59%)

Query: 28  FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           FL LLI+++++QDP      ++ + QL  ++   Q  ++NS++  L  S
Sbjct: 76  FLSLLISELQNQDPLNATSTTDFINQLTSYANFSQQQEINSSMTSLANS 124


>gi|88858144|ref|ZP_01132786.1| flagellar basal body rod modification protein [Pseudoalteromonas
           tunicata D2]
 gi|88819761|gb|EAR29574.1| flagellar basal body rod modification protein [Pseudoalteromonas
           tunicata D2]
          Length = 240

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 3/71 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL---LKSNNL 79
           L Q  F  L+  Q+  QDP  P      +AQ+   S  E    M +   +    + SN  
Sbjct: 34  LSQSDFFTLMTKQLSMQDPMNPTDNEAMMAQMTNMSIAEGVSNMATKFDQFAVSMTSNQA 93

Query: 80  AQASSYIGKNI 90
            QASS +G+N+
Sbjct: 94  LQASSLVGRNV 104


>gi|59889779|emb|CAH19135.1| Lateral flagellar rod protein (FlgD-like) [Escherichia coli]
 gi|284920043|emb|CBG33100.1| lateral flagellar rod protein (FlgD-like) [Escherichia coli 042]
          Length = 234

 Score = 36.2 bits (82), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 30/44 (68%), Gaps = 1/44 (2%)

Query: 26 DAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ-SVQMNS 68
          D FL L + +I++QDPT+  +  +Q++ +A  + ME+ SVQ N+
Sbjct: 37 DTFLTLFVAEIQNQDPTDATEYIDQLSSMAQVAMMEEMSVQANT 80


>gi|313681186|ref|YP_004058924.1| flagellar hook capping protein [Sulfuricurvum kujiense DSM 16994]
 gi|313154046|gb|ADR32724.1| flagellar hook capping protein [Sulfuricurvum kujiense DSM 16994]
          Length = 224

 Score = 35.8 bits (81), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 37/57 (64%)

Query: 20 KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
          K +LG+D FLKLL+ ++K+QDPT PM + + ++Q +  + +E +   N  L+ L  S
Sbjct: 27 KSSLGKDDFLKLLLLELKYQDPTSPMDSEKILSQTSQLATLESTENTNKALETLAAS 83


>gi|228994536|ref|ZP_04154377.1| Polysaccharide deacetylase [Bacillus pseudomycoides DSM 12442]
 gi|228765215|gb|EEM13928.1| Polysaccharide deacetylase [Bacillus pseudomycoides DSM 12442]
          Length = 242

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 55/112 (49%), Gaps = 3/112 (2%)

Query: 13  EFSKSKSKKTLGQDAFLKLLITQIKHQ-DPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
           +F  S +K  + Q+  ++L   Q K +   T P K + QV ++A  +  +   Q    + 
Sbjct: 3   QFFTSPAKGVMNQENSVQLASEQTKGEMKKTAPDKYNGQVRKVAYLTFDDGPSQFQKEIL 62

Query: 72  ELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPI 123
           ++LKSNN+      IG NI     S+  +VN  +    G+ ++T DN ++ I
Sbjct: 63  DILKSNNIKGTFFMIGGNIPAHKESVKRLVN--EGHYPGVHSMTHDNKKLYI 112


>gi|115522803|ref|YP_779714.1| flagellar hook capping protein [Rhodopseudomonas palustris
          BisA53]
 gi|115516750|gb|ABJ04734.1| flagellar hook capping protein [Rhodopseudomonas palustris
          BisA53]
          Length = 221

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 39/71 (54%), Gaps = 11/71 (15%)

Query: 28 FLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ-------SVQMNSTLQELLKSNNLA 80
          FL LL+ ++++Q+P +P   ++  +QL  ++  EQ          ++++   LL  N   
Sbjct: 32 FLTLLVAELQNQNPLDPTSTTDFTSQLMSYASFEQQTALNSNLSSLSTSFNSLLTLN--- 88

Query: 81 QASSYIGKNIT 91
           +S+YIG+ +T
Sbjct: 89 -SSNYIGQTVT 98


>gi|188997540|ref|YP_001931791.1| flagellar hook capping protein [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932607|gb|ACD67237.1| flagellar hook capping protein [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 218

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 5/71 (7%)

Query: 23 LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME--QSVQ-MNSTLQELLKSNNL 79
          + Q+ FLK+L+  +K QDP      S+ +       QME   S+Q +  TL     +N++
Sbjct: 30 MSQNDFLKVLLADLKWQDPMNAKDISDFIDNSVKLRQMESLDSIQKLVDTLSTF--TNSI 87

Query: 80 AQASSYIGKNI 90
            ASS IGK +
Sbjct: 88 VNASSMIGKKV 98


>gi|71280743|ref|YP_270181.1| RND family efflux transporter MFP subunit [Colwellia
           psychrerythraea 34H]
 gi|71146483|gb|AAZ26956.1| efflux transporter, RND family, MFP subunit subfamily [Colwellia
           psychrerythraea 34H]
          Length = 421

 Score = 34.7 bits (78), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 54/99 (54%), Gaps = 14/99 (14%)

Query: 1   MEINTEVNPTQQEFSKSKS---KKTLGQDAFLKL---LITQIKHQDPTEPMKASEQVAQL 54
           +E++  V   Q++F++ K+   KK + Q AF ++   L  QIK+++  +  +  E + Q 
Sbjct: 149 IELDFSVLRLQKDFNRHKALIEKKIISQQAFERVEDELAFQIKYRETVKESQEKEAILQS 208

Query: 55  AVFSQMEQSVQMNSTLQELLKSNNLAQASSYIGKNITNA 93
              +Q+EQS+Q   TLQ     +NLA + S + K I  A
Sbjct: 209 QQLAQLEQSIQ---TLQ-----SNLAISRSSLDKLIIRA 239


>gi|167647108|ref|YP_001684771.1| Serine-type D-Ala-D-Ala carboxypeptidase [Caulobacter sp. K31]
 gi|167349538|gb|ABZ72273.1| Serine-type D-Ala-D-Ala carboxypeptidase [Caulobacter sp. K31]
          Length = 435

 Score = 34.7 bits (78), Expect = 4.9,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 8/104 (7%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMK------ASEQVAQLAVFSQMEQSVQMNST 69
           +  S++  G  A LK+++T   +  P  P+K      A++   + A  +  E SVQ+ + 
Sbjct: 311 RPSSEEGDGDQAGLKIVLTD--NPKPPAPLKVSPTLRAAQASTKPAKKAAGEWSVQVGAF 368

Query: 70  LQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTA 113
             + L    L+   S   K ++NA+G++ G   A +    G+TA
Sbjct: 369 KSKALAREQLSLVRSRFAKVVSNAEGAVEGAEGAFRAQFQGMTA 412


>gi|313905133|ref|ZP_07838502.1| flagellar hook capping protein [Eubacterium cellulosolvens 6]
 gi|313470036|gb|EFR65369.1| flagellar hook capping protein [Eubacterium cellulosolvens 6]
          Length = 176

 Score = 34.3 bits (77), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 51/108 (47%), Gaps = 9/108 (8%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K TL   ++ KLL  Q+ +QD + PM  S+ + Q+   SQM   VQ  + L E  KS   
Sbjct: 30  KNTLSITSYFKLLAAQLANQDMSNPMSTSDMMNQM---SQMAM-VQSLTALTESTKSATS 85

Query: 80  AQASSY----IGKNITNADGSISGVVNAIQVSSTGLTAITVD-NTEIP 122
               SY    IGK +T    S +     +Q  S   T ++V+ N E P
Sbjct: 86  MSQQSYAAGMIGKEVTYNGKSYTSNGTLVQAGSRTGTIVSVNFNGESP 133


>gi|299131956|ref|ZP_07025151.1| flagellar hook capping protein [Afipia sp. 1NLS2]
 gi|298592093|gb|EFI52293.1| flagellar hook capping protein [Afipia sp. 1NLS2]
          Length = 245

 Score = 34.3 bits (77), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 37/60 (61%), Gaps = 4/60 (6%)

Query: 40  DPTEPMKASEQVAQLAVFSQMEQSVQMN---STLQELLKSNNLAQASSYIGKNITNADGS 96
           +P +P+  ++  AQL  F+Q+EQ ++ N   S+L  L K+    QA S++G+ I+  DGS
Sbjct: 56  NPLDPLDTNQFTAQLVQFAQVEQQLKANDQLSSLVALQKTAQSTQALSFVGQTIS-VDGS 114


>gi|162147458|ref|YP_001601919.1| basal-body rod modification protein flgD [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209545567|ref|YP_002277796.1| flagellar hook capping protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786035|emb|CAP55617.1| putative basal-body rod modification protein flgD
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533244|gb|ACI53181.1| flagellar hook capping protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 258

 Score = 34.3 bits (77), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 40  DPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ---ASSYIGKNIT 91
           DP+ PM +     +LA F+ +EQ VQ N+ L  L+  N  +Q    +S +GK  T
Sbjct: 67  DPSSPMSSDTFTQELAQFAGVEQQVQTNTNLSTLISLNEESQLNSDASLVGKTAT 121


>gi|86751225|ref|YP_487721.1| flagellar hook capping protein [Rhodopseudomonas palustris HaA2]
 gi|86574253|gb|ABD08810.1| Flagellar hook capping protein [Rhodopseudomonas palustris HaA2]
          Length = 233

 Score = 33.9 bits (76), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 12/93 (12%)

Query: 40  DPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA---QASSYIGKNITNADGS 96
           +P EP+  ++   QL  F+ +EQ ++ N TL  LLK  + A   QA ++IG         
Sbjct: 50  NPLEPLDTNQFTQQLVQFAGVEQQLKTNETLSSLLKMQSTAQTTQAMNFIGA-------- 101

Query: 97  ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
            + VV+  +    G TA    +T+ P+T  + +
Sbjct: 102 -TAVVDGSKSHYDGKTAGWTLSTDKPVTAQVSV 133


>gi|225850268|ref|YP_002730502.1| flagellar hook capping protein FlgD [Persephonella marina EX-H1]
 gi|225645795|gb|ACO03981.1| flagellar hook capping protein FlgD [Persephonella marina EX-H1]
          Length = 215

 Score = 33.9 bits (76), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 42/69 (60%), Gaps = 9/69 (13%)

Query: 28 FLKLLITQIKHQDP------TEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
          FLK+L+  ++ QDP      T+ ++ + ++ ++ V +  +++V++   L+E  ++N+L  
Sbjct: 31 FLKVLLADLQWQDPLQANDITDFIQNTVKLREMEVLNSFQETVEL---LKETNEANSLLY 87

Query: 82 ASSYIGKNI 90
          AS  IGK +
Sbjct: 88 ASGLIGKKV 96


>gi|271499620|ref|YP_003332645.1| mechanosensitive ion channel protein MscS [Dickeya dadantii Ech586]
 gi|270343175|gb|ACZ75940.1| MscS Mechanosensitive ion channel [Dickeya dadantii Ech586]
          Length = 1137

 Score = 33.9 bits (76), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 48/79 (60%), Gaps = 10/79 (12%)

Query: 32  LITQIKHQDPT-EPMKASEQVA----QLAVFSQMEQ---SVQMNSTLQELLKSNNLAQAS 83
           L TQ+   DP+ EP++ S+QV     Q+ V  QMEQ   S+++N+TLQ+LL+      A+
Sbjct: 199 LRTQLSGLDPSQEPLRPSQQVLLQAEQVLVSLQMEQQRKSLEVNTTLQDLLQKQRDYTAA 258

Query: 84  SYIGKNITNADGSISGVVN 102
             IG+ + +   ++ GV+N
Sbjct: 259 Q-IGQ-LEHMVQTLQGVIN 275


>gi|229000969|ref|ZP_04160424.1| Polysaccharide deacetylase [Bacillus mycoides Rock3-17]
 gi|228758786|gb|EEM07875.1| Polysaccharide deacetylase [Bacillus mycoides Rock3-17]
          Length = 265

 Score = 33.9 bits (76), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 54/110 (49%), Gaps = 3/110 (2%)

Query: 13  EFSKSKSKKTLGQDAFLKLLITQIKHQ-DPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
           +F  S +K  + Q+  ++L   Q K +   T P K + +V ++A  +  +   Q    + 
Sbjct: 26  QFFTSPAKGVMNQENTVQLASEQTKGEIKKTAPDKYNGRVRKVAYLTFDDGPSQFQKEIL 85

Query: 72  ELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEI 121
           ++LKSNN+      IG NI     S+  +VN  +    G+ ++T DN ++
Sbjct: 86  DILKSNNIKGTFFMIGGNIPAHKESVKRLVN--EGHYPGVHSMTHDNKKL 133


Searching..................................................done


Results from round 2




>gi|254780520|ref|YP_003064933.1| flagellar basal body rod modification protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040197|gb|ACT56993.1| flagellar basal body rod modification protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 131

 Score =  153 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 131/131 (100%), Positives = 131/131 (100%)

Query: 1   MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
           MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM
Sbjct: 1   MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60

Query: 61  EQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE 120
           EQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE
Sbjct: 61  EQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE 120

Query: 121 IPITTGIRISN 131
           IPITTGIRISN
Sbjct: 121 IPITTGIRISN 131


>gi|255610098|ref|XP_002539132.1| conserved hypothetical protein [Ricinus communis]
 gi|223508457|gb|EEF23251.1| conserved hypothetical protein [Ricinus communis]
          Length = 228

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 49/109 (44%), Positives = 75/109 (68%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
            L  + FL+LLI Q+++QDPT+PM AS+Q++QLA FSQ+EQ +Q NS L+ +L++  ++Q
Sbjct: 27  NLNYNDFLQLLIAQMQNQDPTDPMDASQQISQLASFSQVEQQIQTNSHLETVLQNQWISQ 86

Query: 82  ASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           AS YIGK I +ADG  +G +  + V + G+ A T    +I I  G+ I+
Sbjct: 87  ASDYIGKQIMSADGKTTGTIKEVTVYTDGIIAQTDAGDKILIQAGVTIA 135


>gi|315122289|ref|YP_004062778.1| flagellar basal body rod modification protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495691|gb|ADR52290.1| flagellar basal body rod modification protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 125

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 94/125 (75%), Positives = 106/125 (84%)

Query: 7   VNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQM 66
           +N TQ+E   SK    +G DAF KLLI Q+KHQDPTEPMKASEQVAQLAVFSQMEQSVQM
Sbjct: 1   MNSTQKESLPSKPNTMMGHDAFFKLLIAQMKHQDPTEPMKASEQVAQLAVFSQMEQSVQM 60

Query: 67  NSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTG 126
           N+ L+ELL SNNLAQASSYIGKNI N DGS+SG+V A+QVSSTGLTAIT +N EIPI TG
Sbjct: 61  NTNLKELLNSNNLAQASSYIGKNIENVDGSMSGIVKAVQVSSTGLTAITAENQEIPIKTG 120

Query: 127 IRISN 131
           IR+S+
Sbjct: 121 IRVSS 125


>gi|237817497|ref|ZP_04596488.1| flagellar basal body rod modification protein [Brucella abortus
           str. 2308 A]
 gi|294852963|ref|ZP_06793635.1| flagellar hook capping protein [Brucella sp. NVSL 07-0026]
 gi|237787332|gb|EEP61549.1| flagellar basal body rod modification protein [Brucella abortus
           str. 2308 A]
 gi|294818618|gb|EFG35618.1| flagellar hook capping protein [Brucella sp. NVSL 07-0026]
          Length = 151

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 56/111 (50%), Positives = 82/111 (73%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K ++  D+FLKLL+TQ+++QDPT+PM  ++ V+QLA FS +EQSVQMNS L+ L+ + +L
Sbjct: 41  KASVDYDSFLKLLVTQMQNQDPTQPMDPTQYVSQLATFSNVEQSVQMNSKLETLIANTSL 100

Query: 80  AQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            QA  +IG+ +TNADGSISGVV ++ + S+G+ A   D   + I  G+RIS
Sbjct: 101 TQAEGWIGRTLTNADGSISGVVKSVTIQSSGMLAELEDGKTLTIGEGVRIS 151


>gi|121602800|ref|YP_989378.1| flagellar hook capping protein [Bartonella bacilliformis KC583]
 gi|120614977|gb|ABM45578.1| flagellar hook capping protein [Bartonella bacilliformis KC583]
          Length = 190

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 45/122 (36%), Positives = 74/122 (60%), Gaps = 3/122 (2%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           QQ+   + +KK    D F+KLL+ Q+K+QDPT PM ++E VAQLA FS +EQ+++MN  L
Sbjct: 19  QQDTPDTGAKKNTDYDTFVKLLVAQMKNQDPTNPMNSTEFVAQLASFSMVEQAIKMNDKL 78

Query: 71  QELLKSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGI 127
           +++L +  ++ A  Y+GK I   D     I G V ++ + S G+ A   +  ++ I  G+
Sbjct: 79  EQVLANGAISGAEGYVGKYIQFEDKDGNIIEGYVKSVDIYSDGIVATLDNGEKVLIGPGV 138

Query: 128 RI 129
            +
Sbjct: 139 TV 140


>gi|163758037|ref|ZP_02165125.1| flagellar basal-body rod modification protein D [Hoeflea
           phototrophica DFL-43]
 gi|162284326|gb|EDQ34609.1| flagellar basal-body rod modification protein D [Hoeflea
           phototrophica DFL-43]
          Length = 133

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 58/132 (43%), Positives = 91/132 (68%), Gaps = 3/132 (2%)

Query: 1   MEINTEVNPTQQEFSKSKS---KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVF 57
           M+I+     ++ + S + +   K TL  D FL LL+ Q+K+QDPT+PM ++EQ+AQLA F
Sbjct: 1   MDISPLAAASRSQGSAADTAANKATLDYDTFLTLLVEQMKNQDPTDPMDSTEQIAQLATF 60

Query: 58  SQMEQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVD 117
           SQ+EQ++Q N  L+ELL+S++L+QA S IG+ IT+ D ++SG +  +QV S GL A+  D
Sbjct: 61  SQVEQTIQTNKHLEELLQSSSLSQAGSLIGRTITSNDETVSGTIEEVQVYSDGLVAVLED 120

Query: 118 NTEIPITTGIRI 129
            T++ +  G+ I
Sbjct: 121 GTKVVVGPGVSI 132


>gi|319406999|emb|CBI80636.1| Flagellar hook capping protein (fragment) [Bartonella sp. 1-1C]
          Length = 170

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 44/116 (37%), Positives = 72/116 (62%), Gaps = 3/116 (2%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           + +KK    D F+KLL+ Q+K+QDPT+PM ++E V+QLA FS +EQ+++MN TL ++L +
Sbjct: 24  AGAKKNADYDMFIKLLVAQMKNQDPTKPMDSTEFVSQLASFSSVEQAIKMNETLSQMLSN 83

Query: 77  NNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
             +  A  Y+GK I   D     I G V +I + S G+ A   +  ++ I  G+++
Sbjct: 84  GLINGAEGYVGKYIQFTDEKDKVIEGYVVSIDIYSDGIVATLDNGEKVVIGPGVKV 139


>gi|319898661|ref|YP_004158754.1| flagellar hook capping protein [Bartonella clarridgeiae 73]
 gi|319402625|emb|CBI76170.1| Flagellar hook capping protein (fragment) [Bartonella clarridgeiae
           73]
          Length = 169

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 45/116 (38%), Positives = 73/116 (62%), Gaps = 3/116 (2%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           + +KK    D F+KLL+ Q+K+QDPT+PM ++E VAQLA FS +EQ+++MN TL ++L +
Sbjct: 23  AGAKKNADYDTFIKLLVAQMKNQDPTKPMDSTEFVAQLASFSSVEQAIKMNETLTQMLSN 82

Query: 77  NNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
            ++  A  Y+GK I   D     I G V +I + S G+ A   +  ++ I  G+++
Sbjct: 83  GSINGAEGYVGKYIQFTDEKDKIIEGYVVSIDIYSDGIVATLDNGEKVVIGPGVKV 138


>gi|319403983|emb|CBI77571.1| hypothetical protein BARRO_30152 [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 169

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 44/116 (37%), Positives = 72/116 (62%), Gaps = 3/116 (2%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           + +KK    D F+KLL+ Q+K+QDPT+PM ++E V+QLA FS +EQ+++MN TL ++L +
Sbjct: 23  AGAKKNADYDMFIKLLVAQMKNQDPTKPMDSTEFVSQLASFSSVEQAIKMNETLSQMLSN 82

Query: 77  NNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
             +  A  Y+GK I   D     I G V +I + S G+ A   +  ++ I  G+++
Sbjct: 83  GLINGAEGYVGKYIQFTDEKDKVIEGYVVSIDIYSDGIVATLDNGEKVVIGPGVKV 138


>gi|110632635|ref|YP_672843.1| flagellar basal body rod modification protein [Mesorhizobium sp.
           BNC1]
 gi|110283619|gb|ABG61678.1| flagellar hook capping protein [Chelativorans sp. BNC1]
          Length = 129

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 56/130 (43%), Positives = 90/130 (69%), Gaps = 1/130 (0%)

Query: 1   MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
           M ++T V  T Q    + + +T+   +FL+LL+ Q+K+QDPT PM++++ VAQLA FSQ+
Sbjct: 1   MNVST-VTSTPQNQQTASAPQTVDYQSFLRLLVAQMKNQDPTSPMESTDYVAQLATFSQV 59

Query: 61  EQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE 120
           EQSVQMNS L+++L ++ L+QA   IG+ IT+ADGS++G+V  +++ S G+ A      E
Sbjct: 60  EQSVQMNSKLEQILAASALSQAGGVIGREITSADGSVTGIVKEVKLYSDGVIAKLESGQE 119

Query: 121 IPITTGIRIS 130
           + +  G+ IS
Sbjct: 120 VVVGPGVVIS 129


>gi|323136996|ref|ZP_08072076.1| flagellar hook capping protein [Methylocystis sp. ATCC 49242]
 gi|322397757|gb|EFY00279.1| flagellar hook capping protein [Methylocystis sp. ATCC 49242]
          Length = 136

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 46/123 (37%), Positives = 79/123 (64%)

Query: 8   NPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN 67
           N T+     + +      +AFL+LL+T+++HQDP +PM  ++ V QLA F+ +EQ++Q N
Sbjct: 14  NSTRAASVANAAADAGNYNAFLQLLVTELRHQDPMKPMDPTQTVTQLATFASVEQAIQTN 73

Query: 68  STLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGI 127
           S L  L +++ L+QASS IG+ +++ADG  SGVV ++ +   G+ A+  D  ++ +  G+
Sbjct: 74  SLLASLNENSALSQASSLIGRTVSSADGKTSGVVKSVMIDDGGMIAVLADGRKVLLGPGV 133

Query: 128 RIS 130
            IS
Sbjct: 134 TIS 136


>gi|13472597|ref|NP_104164.1| flagellar basal body rod modification protein [Mesorhizobium loti
           MAFF303099]
 gi|14023343|dbj|BAB49950.1| flagellar hook assembly scaffolding protein; FlgD [Mesorhizobium
           loti MAFF303099]
          Length = 135

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 55/129 (42%), Positives = 93/129 (72%)

Query: 1   MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
           +++ T +       +KS SK  +   +FLKLLI ++K+QDPT+PM +++ VAQLA FSQ+
Sbjct: 3   VDMTTTIPVGANSTTKSTSKTAVDYQSFLKLLIAEMKNQDPTKPMDSTQYVAQLATFSQV 62

Query: 61  EQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE 120
           EQSVQ N+ L ++++S+ L+QA + IG++IT+ADG  +G+V ++ ++S+GL A+  D T+
Sbjct: 63  EQSVQSNTKLDQIMQSSALSQADAIIGRSITSADGKTTGIVASVTLASSGLIAVLQDGTK 122

Query: 121 IPITTGIRI 129
           +P+  G+ I
Sbjct: 123 VPVGPGVSI 131


>gi|325291967|ref|YP_004277831.1| flagellar basal body rod modification protein [Agrobacterium sp.
           H13-3]
 gi|325059820|gb|ADY63511.1| flagellar basal body rod modification protein [Agrobacterium sp.
           H13-3]
          Length = 156

 Score =  120 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 51/121 (42%), Positives = 80/121 (66%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
               S  KS  +L  D+FLKLLI Q+K+QDPT PM A +Q++QLA FSQ+EQ+++ N+ L
Sbjct: 17  AGASSNDKSAASLNYDSFLKLLIAQMKNQDPTSPMDAGQQMSQLASFSQVEQTIKTNTHL 76

Query: 71  QELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           + +L++  L +AS  +GK + +AD  ++GVV  ++V S G+ AIT    ++ +  G+  S
Sbjct: 77  KSMLQAEALTRASDLVGKTVKSADDKVTGVVKEVEVYSDGVVAITEAGDKVLLQAGVTFS 136

Query: 131 N 131
           N
Sbjct: 137 N 137


>gi|319405426|emb|CBI79045.1| Flagellar hook capping protein [Bartonella sp. AR 15-3]
          Length = 169

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 44/115 (38%), Positives = 71/115 (61%), Gaps = 3/115 (2%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
            +KK    D F+KLL+ Q+K+QDPT+PM ++E VA LA FS +EQ+++MN TL ++L + 
Sbjct: 24  GAKKNADYDTFIKLLVAQMKNQDPTKPMDSTEFVAHLASFSSVEQAIKMNETLAQMLSNG 83

Query: 78  NLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
           ++  A  Y+GK I   D     I G V +I + S G+ A   +  ++ I  G+++
Sbjct: 84  SINGAEGYVGKYIQFTDEKGTVIEGYVVSIDIYSDGIVATLDNGEKVVIGPGVKV 138


>gi|17988508|ref|NP_541141.1| flagellar basal body rod modification protein [Brucella melitensis
           bv. 1 str. 16M]
 gi|23500849|ref|NP_700289.1| flagellar basal body rod modification protein [Brucella suis 1330]
 gi|62317952|ref|YP_223805.1| flagellar basal body rod modification protein [Brucella abortus bv.
           1 str. 9-941]
 gi|83269929|ref|YP_419220.1| flagellar basal body rod modification protein [Brucella melitensis
           biovar Abortus 2308]
 gi|148557915|ref|YP_001257999.1| flagellar basal body rod modification protein [Brucella ovis ATCC
           25840]
 gi|161621177|ref|YP_001595063.1| flagellar basal body rod modification protein [Brucella canis ATCC
           23365]
 gi|163845452|ref|YP_001623107.1| flagellar basal body rod modification protein [Brucella suis ATCC
           23445]
 gi|189023203|ref|YP_001932944.1| flagellar basal body rod modification protein [Brucella abortus
           S19]
 gi|225628424|ref|ZP_03786458.1| flagellar basal body rod modification protein [Brucella ceti str.
           Cudo]
 gi|225686880|ref|YP_002734852.1| flagellar basal body rod modification protein [Brucella melitensis
           ATCC 23457]
 gi|254691616|ref|ZP_05154870.1| flagellar basal body rod modification protein [Brucella abortus bv.
           6 str. 870]
 gi|254695088|ref|ZP_05156916.1| flagellar basal body rod modification protein [Brucella abortus bv.
           3 str. Tulya]
 gi|254698184|ref|ZP_05160012.1| flagellar basal body rod modification protein [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254699258|ref|ZP_05161086.1| flagellar basal body rod modification protein [Brucella suis bv. 5
           str. 513]
 gi|254702378|ref|ZP_05164206.1| flagellar basal body rod modification protein [Brucella suis bv. 3
           str. 686]
 gi|254706501|ref|ZP_05168329.1| flagellar basal body rod modification protein [Brucella
           pinnipedialis M163/99/10]
 gi|254711214|ref|ZP_05173025.1| flagellar basal body rod modification protein [Brucella
           pinnipedialis B2/94]
 gi|254711813|ref|ZP_05173624.1| flagellar basal body rod modification protein [Brucella ceti
           M644/93/1]
 gi|254714882|ref|ZP_05176693.1| flagellar basal body rod modification protein [Brucella ceti
           M13/05/1]
 gi|254731629|ref|ZP_05190207.1| flagellar basal body rod modification protein [Brucella abortus bv.
           4 str. 292]
 gi|256015893|ref|YP_003105902.1| flagellar basal body rod modification protein [Brucella microti CCM
           4915]
 gi|256030157|ref|ZP_05443771.1| flagellar basal body rod modification protein [Brucella
           pinnipedialis M292/94/1]
 gi|256042861|ref|ZP_05445807.1| flagellar basal body rod modification protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256059809|ref|ZP_05450004.1| flagellar basal body rod modification protein [Brucella neotomae
           5K33]
 gi|256112181|ref|ZP_05453102.1| flagellar basal body rod modification protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|256158336|ref|ZP_05456240.1| flagellar basal body rod modification protein [Brucella ceti
           M490/95/1]
 gi|256252730|ref|ZP_05458266.1| flagellar basal body rod modification protein [Brucella ceti B1/94]
 gi|256256803|ref|ZP_05462339.1| flagellar basal body rod modification protein [Brucella abortus bv.
           9 str. C68]
 gi|256261983|ref|ZP_05464515.1| flagellar hook capping protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260166791|ref|ZP_05753602.1| flagellar basal body rod modification protein [Brucella sp. F5/99]
 gi|260544137|ref|ZP_05819958.1| flagellar hook capping protein [Brucella abortus NCTC 8038]
 gi|260564098|ref|ZP_05834583.1| flagellar hook capping protein [Brucella melitensis bv. 1 str. 16M]
 gi|260568719|ref|ZP_05839188.1| flagellar hook capping protein [Brucella suis bv. 4 str. 40]
 gi|260757247|ref|ZP_05869595.1| flagellar hook capping protein [Brucella abortus bv. 6 str. 870]
 gi|260759388|ref|ZP_05871736.1| flagellar hook capping protein [Brucella abortus bv. 4 str. 292]
 gi|260762631|ref|ZP_05874963.1| flagellar hook capping protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883051|ref|ZP_05894665.1| flagellar hook capping protein [Brucella abortus bv. 9 str. C68]
 gi|261215439|ref|ZP_05929720.1| flagellar hook capping protein [Brucella abortus bv. 3 str. Tulya]
 gi|261216572|ref|ZP_05930853.1| flagellar hook capping protein [Brucella ceti M13/05/1]
 gi|261219808|ref|ZP_05934089.1| flagellar hook capping protein [Brucella ceti B1/94]
 gi|261313955|ref|ZP_05953152.1| flagellar hook capping protein [Brucella pinnipedialis M163/99/10]
 gi|261318805|ref|ZP_05958002.1| flagellar hook capping protein [Brucella pinnipedialis B2/94]
 gi|261319442|ref|ZP_05958639.1| flagellar hook capping protein [Brucella ceti M644/93/1]
 gi|261323789|ref|ZP_05962986.1| flagellar hook capping protein [Brucella neotomae 5K33]
 gi|261749697|ref|ZP_05993406.1| flagellar hook capping protein [Brucella suis bv. 5 str. 513]
 gi|261752941|ref|ZP_05996650.1| flagellar hook capping protein [Brucella suis bv. 3 str. 686]
 gi|261756168|ref|ZP_05999877.1| flagellar hook capping protein [Brucella sp. F5/99]
 gi|265987188|ref|ZP_06099745.1| flagellar hook capping protein [Brucella pinnipedialis M292/94/1]
 gi|265989296|ref|ZP_06101853.1| flagellar hook capping protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993608|ref|ZP_06106165.1| flagellar hook capping protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265996851|ref|ZP_06109408.1| flagellar hook capping protein [Brucella ceti M490/95/1]
 gi|297250156|ref|ZP_06933857.1| flagellar hook capping protein [Brucella abortus bv. 5 str. B3196]
 gi|17984300|gb|AAL53405.1| basal-body rod modification protein flgd [Brucella melitensis bv. 1
           str. 16M]
 gi|23464513|gb|AAN34294.1| basal-body rod modification protein FlgD, putative [Brucella suis
           1330]
 gi|62198145|gb|AAX76444.1| hypothetical FlgD basal-body rod modification protein [Brucella
           abortus bv. 1 str. 9-941]
 gi|82940203|emb|CAJ13259.1| ATP/GTP-binding site motif A (P-loop):Flagellar hook capping
           protein [Brucella melitensis biovar Abortus 2308]
 gi|148369200|gb|ABQ62072.1| putative basal-body rod modification protein FlgD [Brucella ovis
           ATCC 25840]
 gi|161337988|gb|ABX64292.1| flagellar hook capping protein [Brucella canis ATCC 23365]
 gi|163676175|gb|ABY40285.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189021777|gb|ACD74498.1| Flagellar hook capping protein [Brucella abortus S19]
 gi|225616270|gb|EEH13318.1| flagellar basal body rod modification protein [Brucella ceti str.
           Cudo]
 gi|225642985|gb|ACO02898.1| flagellar hook capping protein [Brucella melitensis ATCC 23457]
 gi|255998553|gb|ACU50240.1| flagellar basal body rod modification protein [Brucella microti CCM
           4915]
 gi|260097408|gb|EEW81282.1| flagellar hook capping protein [Brucella abortus NCTC 8038]
 gi|260151741|gb|EEW86834.1| flagellar hook capping protein [Brucella melitensis bv. 1 str. 16M]
 gi|260155384|gb|EEW90465.1| flagellar hook capping protein [Brucella suis bv. 4 str. 40]
 gi|260669706|gb|EEX56646.1| flagellar hook capping protein [Brucella abortus bv. 4 str. 292]
 gi|260673052|gb|EEX59873.1| flagellar hook capping protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260677355|gb|EEX64176.1| flagellar hook capping protein [Brucella abortus bv. 6 str. 870]
 gi|260872579|gb|EEX79648.1| flagellar hook capping protein [Brucella abortus bv. 9 str. C68]
 gi|260917046|gb|EEX83907.1| flagellar hook capping protein [Brucella abortus bv. 3 str. Tulya]
 gi|260918392|gb|EEX85045.1| flagellar hook capping protein [Brucella ceti B1/94]
 gi|260921661|gb|EEX88229.1| flagellar hook capping protein [Brucella ceti M13/05/1]
 gi|261292132|gb|EEX95628.1| flagellar hook capping protein [Brucella ceti M644/93/1]
 gi|261298028|gb|EEY01525.1| flagellar hook capping protein [Brucella pinnipedialis B2/94]
 gi|261299769|gb|EEY03266.1| flagellar hook capping protein [Brucella neotomae 5K33]
 gi|261302981|gb|EEY06478.1| flagellar hook capping protein [Brucella pinnipedialis M163/99/10]
 gi|261736152|gb|EEY24148.1| flagellar hook capping protein [Brucella sp. F5/99]
 gi|261739450|gb|EEY27376.1| flagellar hook capping protein [Brucella suis bv. 5 str. 513]
 gi|261742694|gb|EEY30620.1| flagellar hook capping protein [Brucella suis bv. 3 str. 686]
 gi|262551148|gb|EEZ07309.1| flagellar hook capping protein [Brucella ceti M490/95/1]
 gi|262764478|gb|EEZ10510.1| flagellar hook capping protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262999965|gb|EEZ12655.1| flagellar hook capping protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263091467|gb|EEZ16003.1| flagellar hook capping protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264659385|gb|EEZ29646.1| flagellar hook capping protein [Brucella pinnipedialis M292/94/1]
 gi|297174025|gb|EFH33389.1| flagellar hook capping protein [Brucella abortus bv. 5 str. B3196]
 gi|326411298|gb|ADZ68362.1| flagellar basal body rod modification protein [Brucella melitensis
           M28]
 gi|326554587|gb|ADZ89226.1| flagellar basal body rod modification protein [Brucella melitensis
           M5-90]
          Length = 137

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 56/111 (50%), Positives = 82/111 (73%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K ++  D+FLKLL+TQ+++QDPT+PM  ++ V+QLA FS +EQSVQMNS L+ L+ + +L
Sbjct: 27  KASVDYDSFLKLLVTQMQNQDPTQPMDPTQYVSQLATFSNVEQSVQMNSKLETLIANTSL 86

Query: 80  AQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            QA  +IG+ +TNADGSISGVV ++ + S+G+ A   D   + I  G+RIS
Sbjct: 87  TQAEGWIGRTLTNADGSISGVVKSVTIQSSGMLAELEDGKTLTIGEGVRIS 137


>gi|150395508|ref|YP_001325975.1| flagellar basal body rod modification protein [Sinorhizobium
           medicae WSM419]
 gi|150027023|gb|ABR59140.1| flagellar hook capping protein [Sinorhizobium medicae WSM419]
          Length = 138

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 49/120 (40%), Positives = 83/120 (69%)

Query: 10  TQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST 69
           +  E +   S  TL  ++FLKLL+ Q+K+QDPT+PM A++Q+AQLA FSQ+EQ+++ N  
Sbjct: 18  SGTESAGDASAATLNYESFLKLLVAQMKNQDPTQPMDATQQIAQLATFSQVEQTIKTNKN 77

Query: 70  LQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
           L+ LL+  +L++A + IG+ +T+ADG  +GVV  +++ S G+ A+     E+ I  G+++
Sbjct: 78  LESLLQRTSLSEADAVIGRTVTSADGKTTGVVKEVKLYSDGIIAVLDTGKELVIGPGVKV 137


>gi|306841281|ref|ZP_07473992.1| flagellar basal body rod modification protein [Brucella sp. BO2]
 gi|306288683|gb|EFM60014.1| flagellar basal body rod modification protein [Brucella sp. BO2]
          Length = 137

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 56/127 (44%), Positives = 87/127 (68%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
            T    T    + + +K ++  D+FLKLL+TQ+++QDPT+PM  ++ V+QLA FS +EQS
Sbjct: 11  TTNSASTAGNSTSAANKASVDYDSFLKLLVTQMQNQDPTQPMDPTQYVSQLATFSNVEQS 70

Query: 64  VQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPI 123
           VQMNS L+ L+ + +L QA  +IG+ +T+ADGSI+GVV ++ + S+G+ A   D   + I
Sbjct: 71  VQMNSKLETLIANTSLTQAEGWIGRTLTSADGSITGVVKSVTIQSSGMLAELEDGKTLTI 130

Query: 124 TTGIRIS 130
             G+RIS
Sbjct: 131 GEGVRIS 137


>gi|254720778|ref|ZP_05182589.1| flagellar basal body rod modification protein [Brucella sp. 83/13]
 gi|265985836|ref|ZP_06098571.1| flagellar hook capping protein [Brucella sp. 83/13]
 gi|306840131|ref|ZP_07472916.1| flagellar basal body rod modification protein [Brucella sp. NF
           2653]
 gi|306845414|ref|ZP_07477988.1| flagellar basal body rod modification protein [Brucella sp. BO1]
 gi|264664428|gb|EEZ34689.1| flagellar hook capping protein [Brucella sp. 83/13]
 gi|306274157|gb|EFM55973.1| flagellar basal body rod modification protein [Brucella sp. BO1]
 gi|306404776|gb|EFM61070.1| flagellar basal body rod modification protein [Brucella sp. NF
           2653]
          Length = 137

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 55/111 (49%), Positives = 82/111 (73%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K ++  D+FLKLL+TQ+++QDPT+PM  ++ V+QLA FS +EQSVQMNS L+ L+ + +L
Sbjct: 27  KASVDYDSFLKLLVTQMQNQDPTQPMDPTQYVSQLATFSNVEQSVQMNSKLETLIANTSL 86

Query: 80  AQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            QA  +IG+ +T+ADGSISGVV ++ + S+G+ A   D   + I  G+RIS
Sbjct: 87  TQAEGWIGRTLTSADGSISGVVKSVTIQSSGMLAELEDGKTLTIGEGVRIS 137


>gi|239834422|ref|ZP_04682750.1| flagellar basal body rod modification protein [Ochrobactrum
           intermedium LMG 3301]
 gi|239822485|gb|EEQ94054.1| flagellar basal body rod modification protein [Ochrobactrum
           intermedium LMG 3301]
          Length = 136

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 54/114 (47%), Positives = 84/114 (73%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           + +K ++  ++FLKLL+TQ+++QDPT+PM A++ V+QLA FS +EQ+VQMNS L+ L+ +
Sbjct: 23  AANKASVDYNSFLKLLVTQMQNQDPTQPMDATQYVSQLATFSNVEQAVQMNSKLETLIAN 82

Query: 77  NNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            +L QA  +IG+ +TNADGSISGVV ++ + S G+ A   D   + I  G++IS
Sbjct: 83  TSLTQAEGWIGRTLTNADGSISGVVKSVTIQSNGMLAELEDGKTLMIGAGVKIS 136


>gi|153011503|ref|YP_001372717.1| flagellar basal body rod modification protein [Ochrobactrum
           anthropi ATCC 49188]
 gi|151563391|gb|ABS16888.1| flagellar hook capping protein [Ochrobactrum anthropi ATCC 49188]
          Length = 136

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 54/111 (48%), Positives = 82/111 (73%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K ++  ++FLKLL+TQ+++QDPT+PM A++ V+QLA FS +EQ+VQMNS L+ L+ + +L
Sbjct: 26  KASVDYNSFLKLLVTQMQNQDPTQPMDATQYVSQLATFSNVEQAVQMNSKLETLIANTSL 85

Query: 80  AQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            QA  +IG+ +TNADGSISGVV ++ + S G+ A   D   + I  G++IS
Sbjct: 86  TQAEGWIGRTLTNADGSISGVVKSVTIQSNGMLAELEDGKTLMIGAGVKIS 136


>gi|319781660|ref|YP_004141136.1| flagellar hook capping protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167548|gb|ADV11086.1| flagellar hook capping protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 135

 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 52/129 (40%), Positives = 91/129 (70%)

Query: 1   MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
           +++ T +     + + S SK  +   +FLKLLI ++K+QDPT+PM +++ VAQLA FSQ+
Sbjct: 3   VDMTTTIPTGANQATASTSKTAVDYQSFLKLLIAEMKNQDPTKPMDSTQYVAQLATFSQV 62

Query: 61  EQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE 120
           EQSVQ N+ L ++++S+ L+QA + IG++IT+ADG  +G V +++++S GL A+  + TE
Sbjct: 63  EQSVQTNTKLNQIMQSSALSQADALIGRSITSADGLTTGTVASVRLASNGLIAVLQNGTE 122

Query: 121 IPITTGIRI 129
           + +  G+ +
Sbjct: 123 VAVGPGVSV 131


>gi|86356335|ref|YP_468227.1| flagellar basal body rod modification protein [Rhizobium etli CFN
           42]
 gi|86280437|gb|ABC89500.1| flagellar basal-body rod protein [Rhizobium etli CFN 42]
          Length = 142

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 60/115 (52%), Positives = 88/115 (76%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           ++SK TL  D FL+LLI Q+K+QDPT+PM ASEQVAQLA FSQ+EQ++Q N+ L  LL S
Sbjct: 21  AQSKATLNYDNFLQLLIAQMKNQDPTDPMDASEQVAQLATFSQVEQTIQTNTKLDTLLAS 80

Query: 77  NNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           ++L QASSY+GK + +ADG++ GV+++++V S G+ A T D  +I +  GI +++
Sbjct: 81  SSLTQASSYVGKYMESADGTVKGVIDSVKVYSDGIIATTTDGDKILVQAGITVAD 135


>gi|190890387|ref|YP_001976929.1| flagellar basal-body rod protein [Rhizobium etli CIAT 652]
 gi|190695666|gb|ACE89751.1| flagellar basal-body rod protein [Rhizobium etli CIAT 652]
 gi|327193064|gb|EGE59976.1| flagellar basal-body rod protein [Rhizobium etli CNPAF512]
          Length = 141

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 59/112 (52%), Positives = 85/112 (75%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K TL  D FL+LLI Q+K+QDPT+PM ASEQVAQLA FSQ+EQ++Q N+ L  LL S++L
Sbjct: 23  KATLNYDNFLQLLIAQMKNQDPTDPMDASEQVAQLATFSQVEQTIQTNTKLDTLLASSSL 82

Query: 80  AQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
            QASSY+GK + +ADG++ GV+++++V S G+ A T D  +I +  GI +++
Sbjct: 83  TQASSYVGKYMESADGTVKGVIDSVKVYSDGIIATTTDGGKILVQAGITVAD 134


>gi|260466598|ref|ZP_05812786.1| flagellar hook capping protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259029604|gb|EEW30892.1| flagellar hook capping protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 135

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 54/129 (41%), Positives = 90/129 (69%)

Query: 1   MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
           +++ T +       + S SK  +   +FLKLLI ++K+QDPT+PM +++ VAQLA FSQ+
Sbjct: 3   VDMTTTIPVGSNSTTTSTSKTAVDYQSFLKLLIAEMKNQDPTKPMDSTQYVAQLATFSQV 62

Query: 61  EQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE 120
           EQSVQ N+ L+++++S+ L+QA + IG+ IT+ADG  +G V ++ ++S GL A+  D T+
Sbjct: 63  EQSVQTNTKLEQIMQSSALSQADAIIGRTITSADGKTTGTVASVTLASNGLIAVLQDGTQ 122

Query: 121 IPITTGIRI 129
           +P+  G+ I
Sbjct: 123 VPVGAGVSI 131


>gi|218506521|ref|ZP_03504399.1| flagellar basal body rod modification protein [Rhizobium etli
           Brasil 5]
          Length = 118

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 58/111 (52%), Positives = 84/111 (75%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA 80
            TL  D FL+LLI Q+K+QDPT+PM ASEQVAQLA FSQ+EQ++Q N+ L  LL S++L 
Sbjct: 1   ATLNYDNFLQLLIAQMKNQDPTDPMDASEQVAQLATFSQVEQTIQTNTKLDTLLASSSLT 60

Query: 81  QASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           QASSY+GK + +ADG++ GV+++++V S G+ A T D  +I +  GI +++
Sbjct: 61  QASSYVGKYMESADGTVKGVIDSVKVYSDGIIATTTDGGKILVQAGITVAD 111


>gi|15964437|ref|NP_384790.1| flagellar basal body rod modification protein [Sinorhizobium
           meliloti 1021]
 gi|307311579|ref|ZP_07591220.1| flagellar hook capping protein [Sinorhizobium meliloti BL225C]
 gi|307318934|ref|ZP_07598365.1| flagellar hook capping protein [Sinorhizobium meliloti AK83]
 gi|10998533|gb|AAG25963.1|AF300968_5 FlgD [Sinorhizobium meliloti]
 gi|15073614|emb|CAC45256.1| Putative basal-body rod modification protein [Sinorhizobium
           meliloti 1021]
 gi|306895348|gb|EFN26103.1| flagellar hook capping protein [Sinorhizobium meliloti AK83]
 gi|306899596|gb|EFN30225.1| flagellar hook capping protein [Sinorhizobium meliloti BL225C]
          Length = 138

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 50/128 (39%), Positives = 81/128 (63%), Gaps = 2/128 (1%)

Query: 2   EINTEVNPTQQEFSKSK--SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
             +    PT      +   S  TL  ++FLKLL+ Q+K+QDPT+PM A++Q+AQLA FSQ
Sbjct: 8   NTSNSYTPTVSATDSAGDASAATLNYESFLKLLVAQMKNQDPTQPMDATQQIAQLATFSQ 67

Query: 60  MEQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNT 119
           +EQ+++ N  L+ LL+   L++A + IG+ +T+ADG  +GVV  +++ S G+ A+     
Sbjct: 68  VEQTIKTNKNLESLLQRTALSEADAVIGRTVTSADGKTTGVVKEVKLYSDGIIAVLDTGK 127

Query: 120 EIPITTGI 127
           E+ I  G+
Sbjct: 128 ELVIGPGV 135


>gi|15887924|ref|NP_353605.1| flagellar basal body rod modification protein [Agrobacterium
           tumefaciens str. C58]
 gi|15155520|gb|AAK86390.1| hook formation protein [Agrobacterium tumefaciens str. C58]
          Length = 157

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 50/121 (41%), Positives = 80/121 (66%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
               S  K+  +L  D+FLKLLI Q+K+QDPT PM A +Q++QLA FSQ+EQ+++ N+ L
Sbjct: 17  AGASSSDKNAASLNYDSFLKLLIAQMKNQDPTSPMDAGQQMSQLASFSQVEQTIKTNTHL 76

Query: 71  QELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           + +L++  L +AS  +GK + +AD  ++GVV  +QV S G+ A+T    ++ +  G+  S
Sbjct: 77  KSMLQAEALTRASDLVGKTVMSADDKVTGVVKEVQVFSDGIVAVTEAGDKVLLQAGVVFS 136

Query: 131 N 131
           N
Sbjct: 137 N 137


>gi|319409164|emb|CBI82808.1| Flagellar hook capping protein [Bartonella schoenbuchensis R1]
          Length = 160

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 45/115 (39%), Positives = 72/115 (62%), Gaps = 3/115 (2%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           ++KK    D F+KLL+ Q+ +QDPT PM ++E VAQLA FS +EQ+++ N  L ++L + 
Sbjct: 26  EAKKDTDFDTFIKLLVAQMNNQDPTNPMDSTEFVAQLASFSVVEQTIKTNDKLDQILSNG 85

Query: 78  NLAQASSYIGKNI--TNADGS-ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
           ++  A  Y+GK I   +ADG  I G V +I + + G+ A   +N ++ I  GI +
Sbjct: 86  SINGAEGYVGKYIQFEDADGKIIEGYVESIDIYTDGMVATLDNNEKVLIGPGITV 140


>gi|260893869|ref|YP_003239966.1| flagellar hook capping protein [Ammonifex degensii KC4]
 gi|260866010|gb|ACX53116.1| flagellar hook capping protein [Ammonifex degensii KC4]
          Length = 136

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 36/136 (26%), Positives = 71/136 (52%), Gaps = 8/136 (5%)

Query: 1   MEINTEVNPTQQEFSKSKSKKT-----LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLA 55
           M+++T + PT    + S ++         +D FLK+L+ Q+ H DP  P K    +++++
Sbjct: 1   MDVSTLMAPTAGTSAASTTEAASSLFRWSKDTFLKILVAQLSHPDPFSPPKPETIISEMS 60

Query: 56  VFSQMEQSVQMNSTLQELLKSNNLAQASSYIGKNIT-NADGS-ISGVVNAIQVSSTGLTA 113
             + +EQ +++ S+L    +   L Q +S +GK +T  ADGS ++G V  +++   G   
Sbjct: 61  NLALLEQMMRLTSSLDSFSRWLELGQGASLVGKRVTVEADGSAVTGTVEKVRL-EDGKIR 119

Query: 114 ITVDNTEIPITTGIRI 129
           + +D  E P+     +
Sbjct: 120 LVIDGREYPLAAVKEV 135


>gi|170748120|ref|YP_001754380.1| flagellar basal body rod modification protein [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654642|gb|ACB23697.1| flagellar hook capping protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 139

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 48/107 (44%), Positives = 75/107 (70%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           L  D FLKLL+ Q+K+Q+PT+PMK+++ +AQLA FSQ+EQSV MNS L  LL S+ L+QA
Sbjct: 32  LNYDNFLKLLLAQMKNQNPTDPMKSTDYMAQLATFSQVEQSVNMNSKLDALLTSSTLSQA 91

Query: 83  SSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
              +G  +T+AD +++G V +++V+S GL A   +  ++    G+ +
Sbjct: 92  GGLVGHTVTSADKTLTGTVVSVEVASNGLLAHLDNGKDVRYEPGMTV 138


>gi|170744548|ref|YP_001773203.1| flagellar basal body rod modification protein [Methylobacterium sp.
           4-46]
 gi|168198822|gb|ACA20769.1| flagellar hook capping protein [Methylobacterium sp. 4-46]
          Length = 142

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 50/116 (43%), Positives = 81/116 (69%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           + SK+  +L  DAFL+LL+TQ+K+QDPT+PM ++  + +LA FS++EQS +MN+ L  LL
Sbjct: 27  TTSKTATSLNTDAFLQLLLTQLKNQDPTKPMDSTAYMGELATFSEVEQSTKMNNKLDALL 86

Query: 75  KSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            SN L+QA S IG+  T+ DG I+GVV ++++++ G  A   D  ++ +  G+ +S
Sbjct: 87  SSNYLSQAESAIGRTATSDDGKITGVVASVKITTDGPLATLKDGRQLLLGNGVSLS 142


>gi|220932519|ref|YP_002509427.1| flagellar hook capping protein [Halothermothrix orenii H 168]
 gi|219993829|gb|ACL70432.1| flagellar hook capping protein [Halothermothrix orenii H 168]
          Length = 142

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 44/114 (38%), Positives = 66/114 (57%), Gaps = 4/114 (3%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA 80
             L +DAF KLLITQ++HQDP +PM+  E +AQ+A FS +EQ   MN  L   ++  +L+
Sbjct: 29  NNLDKDAFFKLLITQLRHQDPLKPMEDREFIAQMAEFSSLEQMANMNENLSTFMRMESLS 88

Query: 81  QASSYIGKNITNADGS----ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           Q ++ IG+N+   D      +SG V  +   S  L A   ++ +IP+ T   IS
Sbjct: 89  QGAALIGRNVEYVDSQSGRILSGKVTKVVYESGTLYAHLDNDVKIPVDTITSIS 142


>gi|116250505|ref|YP_766343.1| flagellar basal body rod modification protein [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115255153|emb|CAK06227.1| putative hook formation protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 142

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 85/115 (73%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           ++SK TL  D FL+LLI Q+K+QDPT+P+ ASEQ++QLA FSQ+EQ++Q N+ L  LL S
Sbjct: 21  AQSKATLNYDNFLQLLIAQMKNQDPTDPVDASEQMSQLASFSQVEQTIQTNTKLDTLLAS 80

Query: 77  NNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           ++L QASSY+GK + +ADG++ G + +++V S G+ A T D   I +  GI I++
Sbjct: 81  SSLTQASSYVGKYMESADGTVKGTIESVKVYSDGIIATTTDGGNILVQAGITIAD 135


>gi|300024583|ref|YP_003757194.1| flagellar hook capping protein [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526404|gb|ADJ24873.1| flagellar hook capping protein [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 136

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 44/123 (35%), Positives = 80/123 (65%)

Query: 5   TEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSV 64
                +  + +      TL  + FLKL++ Q+++QDP  P  +++ ++Q+A FS +EQ +
Sbjct: 9   NTSGTSNADANDKTKNSTLNYNDFLKLMVAQLRNQDPLNPTDSTQYMSQIAQFSSVEQGI 68

Query: 65  QMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPIT 124
             N+ L +LL ++N++QAS+ IG ++T+ADGS+SG+V ++++ STG TAI  +  E+ I 
Sbjct: 69  NTNAKLDQLLVNSNISQASTMIGLSLTSADGSVSGIVTSVRIDSTGSTAILNNGKEVRID 128

Query: 125 TGI 127
            G+
Sbjct: 129 QGV 131


>gi|323703175|ref|ZP_08114828.1| flagellar hook capping protein [Desulfotomaculum nigrificans DSM
           574]
 gi|323531834|gb|EGB21720.1| flagellar hook capping protein [Desulfotomaculum nigrificans DSM
           574]
          Length = 138

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 43/134 (32%), Positives = 69/134 (51%), Gaps = 5/134 (3%)

Query: 1   MEINTEVN--PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFS 58
           M +N+  N        S  K  KTL +DAFL++++ Q+K+QDPT PM   + + Q+A F+
Sbjct: 1   MAVNSVNNDLFYDNNKSPRKPVKTLDKDAFLQIMVAQLKYQDPTSPMDNDKMIEQIAQFT 60

Query: 59  QMEQSVQMNSTLQELLKSNNLAQASSYIGKNIT--NADGSISGVVNAIQVSSTGLTAITV 116
            +EQ   +NS  ++L     L   SS IG  +T  N D +ISG V  + + +TG+     
Sbjct: 61  TLEQITNLNSNFEKLYSLQQLGYGSSLIGYGVTLQNGDENISGTVQKVTMDATGVKIWVA 120

Query: 117 DNTEIPITTGIRIS 130
           D     ++    + 
Sbjct: 121 D-KPYDLSQITSVE 133


>gi|256750747|ref|ZP_05491632.1| flagellar hook capping protein [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|256750330|gb|EEU63349.1| flagellar hook capping protein [Thermoanaerobacter ethanolicus
           CCSD1]
          Length = 131

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 50/137 (36%), Positives = 75/137 (54%), Gaps = 16/137 (11%)

Query: 1   MEINTEVNPTQQEFSK-SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           M+INT  N T    ++ + SK  LG+D FLKLL+TQ+K+QDP  PM   E +AQLA FS 
Sbjct: 1   MDINTNYNITTVYTNRVTTSKDQLGKDDFLKLLVTQLKNQDPLNPMDDREFIAQLAQFST 60

Query: 60  MEQSVQMNSTLQELLKSNNLAQASSYIGK----NITNADG---SISGVVNAIQVSSTGLT 112
           +EQ   MNS++       N  +A + IGK     IT+ +G   ++ G V+ +     G  
Sbjct: 61  LEQMQNMNSSI-------NAIRAINLIGKNIYATITDNNGNSRTVIGKVD-VVYKQNGEY 112

Query: 113 AITVDNTEIPITTGIRI 129
            + V+  +IP+     +
Sbjct: 113 FLEVNGIDIPLDAVTAV 129


>gi|307264874|ref|ZP_07546436.1| flagellar hook capping protein [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306920132|gb|EFN50344.1| flagellar hook capping protein [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 131

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 50/138 (36%), Positives = 77/138 (55%), Gaps = 16/138 (11%)

Query: 1   MEINTEVNPTQQEFSK-SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           M+INT  N T    ++ + SK  LG+D FLKLL+TQ+K+QDP +PM   E +AQLA FS 
Sbjct: 1   MDINTNYNITTVYTNRVTTSKDQLGKDDFLKLLVTQLKNQDPLKPMDDREFIAQLAQFST 60

Query: 60  MEQSVQMNSTLQELLKSNNLAQASSYIGK----NITNADG---SISGVVNAIQVSSTGLT 112
           +EQ   MNS+        N  +A + IGK     IT+ +G   +++G V+ +     G  
Sbjct: 61  LEQMQNMNSSF-------NAVRAINLIGKNIYATITDNNGNSRTVTGKVD-VVYKQNGEY 112

Query: 113 AITVDNTEIPITTGIRIS 130
            + V+  ++P+     +S
Sbjct: 113 FLQVNGIDVPVDAVTAVS 130


>gi|269836574|ref|YP_003318802.1| flagellar hook capping protein [Sphaerobacter thermophilus DSM
           20745]
 gi|269785837|gb|ACZ37980.1| flagellar hook capping protein [Sphaerobacter thermophilus DSM
           20745]
          Length = 150

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 46/134 (34%), Positives = 72/134 (53%), Gaps = 7/134 (5%)

Query: 3   INTEVNPTQQEFSKSK--SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
           +  + NP     S +       LG+  FL LL  Q+++QDP  PM+ +E +AQLA  + +
Sbjct: 6   VTNQTNPGTDAASSTTFSPADRLGKQEFLMLLTAQLRNQDPLRPMEDTEFIAQLAQLNSL 65

Query: 61  EQSVQMNSTLQELLKSNNLAQASSYIGKNITNAD----GSISGVVNAIQVSSTGLTAITV 116
           EQ  QMN TL  L++ + LAQ +S IG+++T  D    G I GVV+ + +   G   + V
Sbjct: 66  EQMQQMNETLSTLVEMSVLAQTASLIGRHVTALDPSGGGVIKGVVSDVTIHE-GTPVLNV 124

Query: 117 DNTEIPITTGIRIS 130
             T +P+   + I 
Sbjct: 125 GGTAVPLAHVVSIG 138


>gi|125972993|ref|YP_001036903.1| flagellar hook capping protein [Clostridium thermocellum ATCC
           27405]
 gi|281417204|ref|ZP_06248224.1| flagellar hook capping protein [Clostridium thermocellum JW20]
 gi|125713218|gb|ABN51710.1| flagellar hook capping protein [Clostridium thermocellum ATCC
           27405]
 gi|281408606|gb|EFB38864.1| flagellar hook capping protein [Clostridium thermocellum JW20]
          Length = 323

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 36/129 (27%), Positives = 65/129 (50%), Gaps = 16/129 (12%)

Query: 10  TQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST 69
           +    S  ++   LG+D FL LLITQ+++QDP  P+   E ++Q+A FS +EQ   +N +
Sbjct: 18  STTNKSTQRNTGELGKDEFLNLLITQLQYQDPLNPVDDKEFISQMAQFSALEQMQNLNKS 77

Query: 70  LQELLKSNNLAQASSYIGKNITNAD--------GSISGVVNAIQVSSTGLTAITVDNTEI 121
                   +  +A   IGK IT           G + G+V ++++   G   + V+  ++
Sbjct: 78  F-------SATKAFGMIGKYITGTTSNGSDSGAGFVEGIVRSVKM-ENGKILLEVNGLDV 129

Query: 122 PITTGIRIS 130
           P+   + +S
Sbjct: 130 PVDNVLSVS 138


>gi|256004790|ref|ZP_05429765.1| flagellar hook capping protein [Clostridium thermocellum DSM 2360]
 gi|255991240|gb|EEU01347.1| flagellar hook capping protein [Clostridium thermocellum DSM 2360]
 gi|316940771|gb|ADU74805.1| flagellar hook capping protein [Clostridium thermocellum DSM 1313]
          Length = 323

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 64/128 (50%), Gaps = 16/128 (12%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
               S  ++   LG+D FL LLITQ+++QDP  P+   E ++Q+A FS +EQ   +N + 
Sbjct: 19  TTNKSTQRNTGELGKDEFLNLLITQLQYQDPLNPVDDKEFISQMAQFSALEQMQNLNKSF 78

Query: 71  QELLKSNNLAQASSYIGKNITNAD--------GSISGVVNAIQVSSTGLTAITVDNTEIP 122
                  +  +A   IGK IT           G + G+V ++++   G   + V+  ++P
Sbjct: 79  -------SATKAFGMIGKYITGTTSNGSDSGAGFVEGIVRSVKM-ENGKILLEVNGLDVP 130

Query: 123 ITTGIRIS 130
           +   + +S
Sbjct: 131 VDNVLSVS 138


>gi|222084890|ref|YP_002543419.1| flagellar basal-body rod protein [Agrobacterium radiobacter K84]
 gi|221722338|gb|ACM25494.1| flagellar basal-body rod protein [Agrobacterium radiobacter K84]
          Length = 158

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 49/108 (45%), Positives = 75/108 (69%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           L  + FLKLLI Q+K QDPT+PM A++Q++QLA FSQ+EQ +Q NS L+ +L++  ++QA
Sbjct: 28  LNYNDFLKLLIAQMKTQDPTDPMDATQQISQLASFSQVEQQIQTNSHLETVLQNQWISQA 87

Query: 83  SSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           S YIGK I +ADG+ +G +  + V S G+ A T    +I +  G+ ++
Sbjct: 88  SDYIGKEIMSADGTTTGTIKEVTVYSDGIIAQTEAGDKILLQAGVTVA 135


>gi|222530132|ref|YP_002574014.1| flagellar hook capping protein [Caldicellulosiruptor bescii DSM
           6725]
 gi|222456979|gb|ACM61241.1| flagellar hook capping protein [Caldicellulosiruptor bescii DSM
           6725]
          Length = 164

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/131 (30%), Positives = 69/131 (52%), Gaps = 13/131 (9%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           NT ++ + Q  + S  K  LG+  FL LL+TQ+++QDP +PM+  E VAQLA FS +EQ 
Sbjct: 9   NTNISNSTQGSATSLGKNVLGKQEFLNLLVTQLRYQDPLKPMEDKEFVAQLAQFSALEQM 68

Query: 64  VQMNSTLQELLKSNNLAQASSYIGKNIT-----NADGSISGVVNAIQVSSTGLTAITVDN 118
             +N + +         +A S IG+ +      +   +I G +++I+V  +    + V+ 
Sbjct: 69  QNLNESFE-------FLKAQSMIGRYVVATNPADTSKTIEGRIDSIRVDGS-KVYLKVNG 120

Query: 119 TEIPITTGIRI 129
           TE+       +
Sbjct: 121 TEVLFDNVKEV 131


>gi|289578427|ref|YP_003477054.1| flagellar hook capping protein [Thermoanaerobacter italicus Ab9]
 gi|289528140|gb|ADD02492.1| flagellar hook capping protein [Thermoanaerobacter italicus Ab9]
          Length = 131

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 43/138 (31%), Positives = 73/138 (52%), Gaps = 16/138 (11%)

Query: 1   MEINTEVNPTQ-QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           ME+NT  + +     S+  SKK LG+D FLKLL+ Q+K+Q+P  PM   E +AQLA FS 
Sbjct: 1   MEVNTNYSFSNVYNNSEITSKKQLGKDDFLKLLVAQLKNQNPLNPMDDKEFIAQLAQFST 60

Query: 60  MEQSVQMNSTLQELLKSNNLAQASSYIGK----NITNADGS---ISGVVNAIQVSSTGLT 112
           +EQ   +N++        +  +A + +GK     +T+ +G    + G V+A+        
Sbjct: 61  LEQMQNLNTSF-------SAVRAINLLGKNIYATVTDNNGESKAVEGKVDAV-YKQNEEY 112

Query: 113 AITVDNTEIPITTGIRIS 130
            + V+  ++P+     +S
Sbjct: 113 FLEVNGIDVPLDAVTAVS 130


>gi|227820880|ref|YP_002824850.1| flagellar basal body rod modification protein [Sinorhizobium fredii
           NGR234]
 gi|227339879|gb|ACP24097.1| predicted flagellar hook capping protein FlgD [Sinorhizobium fredii
           NGR234]
          Length = 148

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 63/108 (58%), Positives = 84/108 (77%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           L   +FLKLLI Q+++QDPT+PM A+EQ++QLA FSQ+EQS++ NS L+ LL S +L QA
Sbjct: 33  LNYQSFLKLLIAQMQNQDPTDPMDATEQISQLATFSQVEQSIKTNSNLESLLASESLTQA 92

Query: 83  SSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           S+YIGK IT++DG  SGVV  ++V+S G+TAIT D  EI I TGI +S
Sbjct: 93  STYIGKTITSSDGKTSGVVAEVEVTSDGVTAITTDGKEIAIETGISVS 140


>gi|325289232|ref|YP_004265413.1| flagellar hook capping protein [Syntrophobotulus glycolicus DSM
           8271]
 gi|324964633|gb|ADY55412.1| flagellar hook capping protein [Syntrophobotulus glycolicus DSM
           8271]
          Length = 263

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 70/132 (53%), Gaps = 7/132 (5%)

Query: 3   INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           +N+    T    S   +  +L ++ FL LL+TQ+K+QDP  P  ++E V+QLA FS +EQ
Sbjct: 6   VNSTSYTTAGTASSRDTSTSLDKEDFLNLLVTQLKYQDPLNPSDSTEYVSQLAQFSLLEQ 65

Query: 63  SVQMNSTLQELLKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLTAITVDNT 119
              MN++L+ L     L     YI  ++T + G   ++ G V+++ + S G  A+ V   
Sbjct: 66  MTNMNTSLEAL---EALTMTGKYITASVTGSSGETTTVEGTVDSVTM-SNGEAALVVGGK 121

Query: 120 EIPITTGIRISN 131
            I ++    + +
Sbjct: 122 SIELSDVCAVYD 133


>gi|167037662|ref|YP_001665240.1| flagellar hook capping protein [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|167040323|ref|YP_001663308.1| flagellar hook capping protein [Thermoanaerobacter sp. X514]
 gi|300914407|ref|ZP_07131723.1| flagellar hook capping protein [Thermoanaerobacter sp. X561]
 gi|307724357|ref|YP_003904108.1| flagellar hook capping protein [Thermoanaerobacter sp. X513]
 gi|320116077|ref|YP_004186236.1| flagellar hook capping protein [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|166854563|gb|ABY92972.1| flagellar hook capping protein [Thermoanaerobacter sp. X514]
 gi|166856496|gb|ABY94904.1| flagellar hook capping protein [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|300889342|gb|EFK84488.1| flagellar hook capping protein [Thermoanaerobacter sp. X561]
 gi|307581418|gb|ADN54817.1| flagellar hook capping protein [Thermoanaerobacter sp. X513]
 gi|319929168|gb|ADV79853.1| flagellar hook capping protein [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
          Length = 131

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 71/137 (51%), Gaps = 16/137 (11%)

Query: 1   MEINTEVNPTQ-QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           M+INT  N T       S     LG+D FLKLL+TQ+K+QDP  PM   E +AQLA FS 
Sbjct: 1   MDINTNYNVTSIYNNRVSTLNSQLGKDDFLKLLVTQLKNQDPLNPMDDREFIAQLAQFST 60

Query: 60  MEQSVQMNSTLQELLKSNNLAQASSYIGK----NITNADG---SISGVVNAIQVSSTGLT 112
           +EQ   MNS++       N  +A + IGK     IT+ +G   ++ G V+ +     G  
Sbjct: 61  LEQMQNMNSSI-------NAIRAINLIGKNIYATITDNNGNSRTVIGKVD-VVYKQNGEY 112

Query: 113 AITVDNTEIPITTGIRI 129
            + V+  +IP+     +
Sbjct: 113 FLEVNGIDIPLDAVTAV 129


>gi|326389476|ref|ZP_08211043.1| flagellar hook capping protein [Thermoanaerobacter ethanolicus JW
           200]
 gi|325994481|gb|EGD52906.1| flagellar hook capping protein [Thermoanaerobacter ethanolicus JW
           200]
          Length = 131

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 50/138 (36%), Positives = 76/138 (55%), Gaps = 16/138 (11%)

Query: 1   MEINTEVNPTQQEFSK-SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           M+INT  N T    ++ + SK  LG+D FLKLL+TQ+K+QDP  PM   E +AQLA FS 
Sbjct: 1   MDINTNYNITTVYTNRVTTSKDQLGKDDFLKLLVTQLKNQDPLNPMDDREFIAQLAQFST 60

Query: 60  MEQSVQMNSTLQELLKSNNLAQASSYIGK----NITNADG---SISGVVNAIQVSSTGLT 112
           +EQ   MNS+        N  +A + IGK     IT+ +G   +++G V+ +     G  
Sbjct: 61  LEQMQNMNSSF-------NAVRAINLIGKNIYATITDNNGNSQTVTGKVD-VVYKQNGEY 112

Query: 113 AITVDNTEIPITTGIRIS 130
            + V+  ++P+     +S
Sbjct: 113 FLQVNGIDVPVDAVTAVS 130


>gi|163850128|ref|YP_001638171.1| flagellar basal body rod modification protein [Methylobacterium
           extorquens PA1]
 gi|218528732|ref|YP_002419548.1| flagellar basal body rod modification protein [Methylobacterium
           chloromethanicum CM4]
 gi|163661733|gb|ABY29100.1| flagellar hook capping protein [Methylobacterium extorquens PA1]
 gi|218521035|gb|ACK81620.1| flagellar hook capping protein [Methylobacterium chloromethanicum
           CM4]
          Length = 138

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/109 (44%), Positives = 74/109 (67%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
            +  D FL LL+ Q+++QDPT+PM ++E V QLA FSQ+EQ+ + N  L  LL S+ L Q
Sbjct: 30  KMNADTFLTLLMAQLQNQDPTKPMDSTEYVGQLATFSQVEQATKTNQKLDSLLTSSFLNQ 89

Query: 82  ASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           A + IG+++T+ADG ISG V +++V+  G+ A   D  E+ + +GI IS
Sbjct: 90  ADAIIGRSLTSADGLISGTVQSVRVTGDGVMAKLTDGREMLLASGISIS 138


>gi|20807882|ref|NP_623053.1| flagellar hook capping protein [Thermoanaerobacter tengcongensis
           MB4]
 gi|20516447|gb|AAM24657.1| Flagellar hook capping protein [Thermoanaerobacter tengcongensis
           MB4]
          Length = 131

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 47/140 (33%), Positives = 72/140 (51%), Gaps = 20/140 (14%)

Query: 1   MEINTEVN---PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVF 57
           M +NT  +   P+ Q    +KSK  LG+D FL LL+TQ+K+QDP  P+   E +AQLA F
Sbjct: 1   MNVNTNYSVLPPSNQNKVTTKSK--LGKDDFLMLLVTQLKNQDPLNPVDDKEFLAQLAQF 58

Query: 58  SQMEQSVQMNSTLQELLKSNNLAQASSYIGKNI--TNADG-----SISGVVNAIQVSSTG 110
           S +EQ   +N +   +       +A + IGKN+  T  DG      + G V+A+     G
Sbjct: 59  SALEQMQNLNESFNSV-------KAIALIGKNVYATINDGNGNYKEVFGKVDAV-YRENG 110

Query: 111 LTAITVDNTEIPITTGIRIS 130
              + V   +IP+     ++
Sbjct: 111 QYFLKVKGLDIPLDAVRAVT 130


>gi|241203129|ref|YP_002974225.1| flagellar basal body rod modification protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240857019|gb|ACS54686.1| flagellar hook capping protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 144

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 55/114 (48%), Positives = 83/114 (72%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           + K TL  D FL+LLI Q+K+QDPT+P+ ASEQ++QLA FSQ+EQ++Q N+ L  LL S+
Sbjct: 22  QQKATLNYDNFLQLLIAQMKNQDPTDPVDASEQMSQLASFSQVEQTIQTNTKLDTLLASS 81

Query: 78  NLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           +L QASSY+GK + +ADG++ G + +++V S G+ A T D   I +  GI +++
Sbjct: 82  SLTQASSYVGKYMESADGTVKGTIESVKVYSDGIIATTTDGGNILVQAGITVAD 135


>gi|118589961|ref|ZP_01547365.1| flagellar basal-body rod modification protein D [Stappia aggregata
           IAM 12614]
 gi|118437458|gb|EAV44095.1| flagellar basal-body rod modification protein D [Stappia aggregata
           IAM 12614]
          Length = 131

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 51/126 (40%), Positives = 79/126 (62%), Gaps = 3/126 (2%)

Query: 7   VNPTQQEFSKSKSKKTL--GQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSV 64
           V+ T+   S + ++K L    D FL L++ Q+++QDPT PM ASEQ+AQLA FSQ+EQS+
Sbjct: 7   VSATEGAASPATAQKQLTVDYDTFLHLMMAQMQNQDPTNPMDASEQLAQLASFSQVEQSI 66

Query: 65  QMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPIT 124
           Q N+ L+ LL + +  Q    IG+ +T+A+G+ +GVV  ++V S G      +   I + 
Sbjct: 67  QTNAKLETLLTNLSFGQVDDLIGRTVTDANGT-TGVVEKVEVYSDGTVLALDNGKGILLG 125

Query: 125 TGIRIS 130
            G+ IS
Sbjct: 126 PGVTIS 131


>gi|114706623|ref|ZP_01439524.1| flagellar basal-body rod modification protein D [Fulvimarina pelagi
           HTCC2506]
 gi|114538015|gb|EAU41138.1| flagellar basal-body rod modification protein D [Fulvimarina pelagi
           HTCC2506]
          Length = 136

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 39/128 (30%), Positives = 69/128 (53%)

Query: 3   INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           +        Q          +  DAFL+LL+ Q+K+QDP  P +++E +AQ A F+ +EQ
Sbjct: 9   VTQAQGAAAQNGITKGGAPEMDYDAFLQLLVAQMKNQDPLNPAESTEYIAQFATFANVEQ 68

Query: 63  SVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIP 122
           S+Q N+ L+ ++  + L QA + IG+ +T+ DG+  G V +I+    G+ A       I 
Sbjct: 69  SIQTNTRLESMMTVSALTQADALIGRTLTSLDGATRGTVTSIRAVDGGIQATIEGGETIM 128

Query: 123 ITTGIRIS 130
           +  G+ ++
Sbjct: 129 LGDGVSVA 136


>gi|90418360|ref|ZP_01226272.1| flagellar hook capping protein FlgD [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90338032|gb|EAS51683.1| flagellar hook capping protein FlgD [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 134

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 45/126 (35%), Positives = 72/126 (57%)

Query: 5   TEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSV 64
           T     Q   S +  K  +  DAFLKLL+ ++ +QDP  P  ++E VAQ A FS +EQ++
Sbjct: 9   TSATAAQTGISAATQKTGMDYDAFLKLLVAEMSNQDPLNPTDSTEYVAQFASFSSVEQAI 68

Query: 65  QMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPIT 124
           Q N  L  ++  + L QA+S IG+  T+ADG++SG V A++  +  + AI      +P+ 
Sbjct: 69  QTNKKLDSMMTVSALTQANSLIGQTATSADGTLSGKVAAVRAVNGVVEAILESGDSLPLI 128

Query: 125 TGIRIS 130
           +G  + 
Sbjct: 129 SGTTVG 134


>gi|312621575|ref|YP_004023188.1| flagellar hook capping protein [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202042|gb|ADQ45369.1| flagellar hook capping protein [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 164

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 40/131 (30%), Positives = 69/131 (52%), Gaps = 13/131 (9%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           NT ++ + Q  + S  K  LG+  FL LL+TQ+++QDP +PM+  E VAQLA FS +EQ 
Sbjct: 9   NTNISNSTQGSATSLGKNVLGKQEFLNLLVTQLRYQDPLKPMEDKEFVAQLAQFSALEQM 68

Query: 64  VQMNSTLQELLKSNNLAQASSYIGKNIT-----NADGSISGVVNAIQVSSTGLTAITVDN 118
             +N + +         +A S IG+ +      +   +I G +++I+V  +    + V+ 
Sbjct: 69  QNLNESFE-------FLKAQSMIGRYVVATNPADTSKTIEGRIDSIRVDGS-KVYLKVNG 120

Query: 119 TEIPITTGIRI 129
           TE+       +
Sbjct: 121 TEVLSDNVKEV 131


>gi|304392488|ref|ZP_07374428.1| flagellar hook capping protein [Ahrensia sp. R2A130]
 gi|303295118|gb|EFL89478.1| flagellar hook capping protein [Ahrensia sp. R2A130]
          Length = 131

 Score =  106 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 43/115 (37%), Positives = 74/115 (64%), Gaps = 2/115 (1%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK 75
           ++  K  +  D+FLKLL+ ++++QDPT+PM++SE VAQLA FS +EQS+Q N+ L  LL 
Sbjct: 19  QAAQKAQVDYDSFLKLLVAELENQDPTKPMESSEFVAQLATFSGVEQSIQTNTKLDALLA 78

Query: 76  SNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            N L QA + IG+ +T  D  ++G+V+++ + S   + +  D   + ++    +S
Sbjct: 79  GNVLGQAGTMIGRTVTAGD--VTGLVDSVAIESGSASLVLDDGRRVALSAVSGVS 131


>gi|320538207|ref|ZP_08038102.1| flagellar hook capping protein [Treponema phagedenis F0421]
 gi|2196891|gb|AAB61250.1| FlgD [Treponema phagedenis]
 gi|320145024|gb|EFW36745.1| flagellar hook capping protein [Treponema phagedenis F0421]
          Length = 163

 Score =  106 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 42/131 (32%), Positives = 73/131 (55%), Gaps = 4/131 (3%)

Query: 1   MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
           +E++      Q E    K K+ LG++ FL+LLI Q+ HQDPT PM+ ++ VAQ+A F+ +
Sbjct: 26  LELDVNAFNKQIEIDGRKPKQELGKNDFLQLLIAQLSHQDPTAPMEDTQFVAQMAQFTSL 85

Query: 61  EQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSI--SGVVNAIQVSSTGLTAITVDN 118
           EQ   ++ + ++L    + ++A + +GK +   DGSI  SGV+ A   +   +  + VD 
Sbjct: 86  EQMTNVSQSFEKLNNLLSGSEAVNAVGKQVNIEDGSIKVSGVITA--ATRGEIPQVQVDG 143

Query: 119 TEIPITTGIRI 129
                +T   +
Sbjct: 144 KWYDWSTVKTV 154


>gi|254559273|ref|YP_003066368.1| Basal body rod modification protein FlgD [Methylobacterium
           extorquens DM4]
 gi|254266551|emb|CAX22315.1| FlgD ( BASAL-BODY ROD MODIFICATION PROTEIN)/hook formation protein
           [Methylobacterium extorquens DM4]
          Length = 138

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 48/109 (44%), Positives = 73/109 (66%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
            +  D FL LL+ Q+++QDPT+PM ++E V QLA FSQ+EQ+ + N  L  LL S+ L Q
Sbjct: 30  KMNADTFLTLLMAQLQNQDPTKPMDSTEYVGQLATFSQVEQATKTNQKLDSLLTSSFLNQ 89

Query: 82  ASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           A + IG+++T+ADG  SG V +++V+  G+ A   D  E+ + +GI IS
Sbjct: 90  ADAIIGRSLTSADGLTSGTVQSVRVTGDGVMAKLTDGREMLLASGISIS 138


>gi|315186382|gb|EFU20142.1| flagellar hook capping protein [Spirochaeta thermophila DSM 6578]
          Length = 145

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 39/112 (34%), Positives = 60/112 (53%), Gaps = 4/112 (3%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K+ LG+D FLKLL+ Q+ HQDPT+P++  E +AQ+A FS +EQ   M+    +L      
Sbjct: 33  KQELGKDDFLKLLVAQLTHQDPTQPLEDKEFIAQMAQFSTLEQMTNMSQEFSKLALRLQS 92

Query: 80  AQASSYIGKNI--TNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
           +QA S +GK +   N D  ISGVV  ++        + V+     +     +
Sbjct: 93  SQAFSLLGKTVVIKNGDEEISGVVEEVR--GREFPQLLVNGRYFDMNQIESV 142


>gi|240137262|ref|YP_002961731.1| FlgD (basal-body rod modification protein)/hook formation protein
           [Methylobacterium extorquens AM1]
 gi|240007228|gb|ACS38454.1| FlgD (basal-body rod modification protein)/hook formation protein
           [Methylobacterium extorquens AM1]
          Length = 135

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 48/109 (44%), Positives = 73/109 (66%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
            +  D FL LL+ Q+++QDPT+PM ++E V QLA FSQ+EQ+ + N  L  LL S+ L Q
Sbjct: 27  KMNADTFLTLLMAQLQNQDPTKPMDSTEYVGQLATFSQVEQATKTNQKLDSLLTSSFLNQ 86

Query: 82  ASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           A + IG+++T+ADG  SG V +++V+  G+ A   D  E+ + +GI IS
Sbjct: 87  ADAIIGRSLTSADGLTSGTVQSVRVTGDGVMAKLTDGREMLLASGISIS 135


>gi|188579930|ref|YP_001923375.1| flagellar basal body rod modification protein [Methylobacterium
           populi BJ001]
 gi|179343428|gb|ACB78840.1| flagellar hook capping protein [Methylobacterium populi BJ001]
          Length = 138

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 48/110 (43%), Positives = 74/110 (67%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA 80
             +  D FL+LL+ Q+++QDPT+PM ++E V QLA FSQ+EQ+ + N  L  LL S+ L 
Sbjct: 29  SKMNADTFLQLLMAQLQNQDPTKPMDSTEYVGQLASFSQVEQATKTNQKLDSLLASSFLN 88

Query: 81  QASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           QA + IG++IT+ADG  +G V +++V+  G+ A   D  E+ + +GI IS
Sbjct: 89  QADAIIGRSITSADGLTTGTVQSVRVTGDGVMAKLTDGREMLLASGISIS 138


>gi|15639715|ref|NP_219165.1| flagellar basal body rod modification protein [Treponema pallidum
           subsp. pallidum str. Nichols]
 gi|189025953|ref|YP_001933725.1| flagellar basal body rod modification protein [Treponema pallidum
           subsp. pallidum SS14]
 gi|2196902|gb|AAB61259.1| FlgD [Treponema pallidum]
 gi|3323034|gb|AAC65697.1| flagellar hook assembly scaffolding protein (flgD) [Treponema
           pallidum subsp. pallidum str. Nichols]
 gi|189018528|gb|ACD71146.1| flagellar hook assembly scaffolding protein [Treponema pallidum
           subsp. pallidum SS14]
 gi|291060092|gb|ADD72827.1| flagellar hook capping protein [Treponema pallidum subsp. pallidum
           str. Chicago]
          Length = 153

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/133 (30%), Positives = 72/133 (54%), Gaps = 4/133 (3%)

Query: 1   MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
           +E++  V   Q E     +K+ LG+D FL LLI Q+ HQDPT PM+ ++ +AQ+A FS +
Sbjct: 19  LEMDVRVINKQLEAGARSAKRELGKDDFLHLLIAQLTHQDPTAPMQDTQFIAQMAQFSSL 78

Query: 61  EQSVQMNSTLQELLKSNNLAQASSYIGK--NITNADGSISGVVNAIQVSSTGLTAITVDN 118
           EQ   M++ +++L       +A   +GK   +T AD ++ G+++A+  +      + V +
Sbjct: 79  EQMANMSAQVEKLGTLFGNTEALQAVGKMVEVTEADNTVRGLISAVTRAD--KPQVRVGS 136

Query: 119 TEIPITTGIRISN 131
                     I++
Sbjct: 137 HWYEWEHVKVIAD 149


>gi|218671388|ref|ZP_03521058.1| flagellar basal body rod modification protein [Rhizobium etli GR56]
          Length = 159

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 85/115 (73%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           ++ K TL  D FL+LLI Q+K+QDPT+PM ASEQ++QLA FSQ+EQ++Q N+ L  LL S
Sbjct: 35  AQKKATLNYDNFLQLLIAQMKNQDPTDPMDASEQMSQLASFSQVEQTIQTNTKLDTLLSS 94

Query: 77  NNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           ++L QASSY+GK + +ADG++ G V +++V S G+ A T D  +I +  GI +++
Sbjct: 95  SSLTQASSYVGKYMESADGTVKGTVESVKVYSDGIIATTTDGGKILVQAGITVAD 149


>gi|78043304|ref|YP_359846.1| flagellar hook assembly protein [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77995419|gb|ABB14318.1| flagellar hook assembly protein [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 135

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/123 (31%), Positives = 68/123 (55%), Gaps = 4/123 (3%)

Query: 10  TQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST 69
           +    + S++K  L +DAFLK+ + Q+++QDP  P   +E +A+LA F  +EQ   +   
Sbjct: 13  STSANAASQTKLNLDKDAFLKIFLAQLQYQDPLNPADGTEFIAELAQFGMLEQLTNLTDA 72

Query: 70  LQELLKSNNLAQASSYIGKNI---TNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTG 126
           L +LL+    AQA++ IGK +   T A+  + GVV+A++ S     ++ V+  E      
Sbjct: 73  LTKLLQFEQKAQAAALIGKTVKIATAAETLVEGVVSAVRWSGD-QISLVVNGQEYSPDKV 131

Query: 127 IRI 129
           I +
Sbjct: 132 IEV 134


>gi|134300241|ref|YP_001113737.1| flagellar hook capping protein [Desulfotomaculum reducens MI-1]
 gi|134052941|gb|ABO50912.1| flagellar hook capping protein [Desulfotomaculum reducens MI-1]
          Length = 185

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 68/134 (50%), Gaps = 5/134 (3%)

Query: 1   MEIN--TEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFS 58
           ME+N     +   +     +S KTL +DAFL+++I Q+++QDP+ PM +S+ + Q+A+F+
Sbjct: 1   MEVNQTNNSDLYYENRKTKESVKTLDKDAFLQIMIAQLRYQDPSSPMDSSKFIEQMAMFT 60

Query: 59  QMEQSVQMNSTLQELLKSNNLAQASSYIGKNI--TNADGSISGVVNAIQVSSTGLTAITV 116
            +EQ   +N+ ++ L     L  ASS IGK +     +  + G V  + +       I V
Sbjct: 61  TLEQMTNLNTNMERLYHLQELNHASSLIGKRVNLIAEEEQVIGEVERVTLGEN-SVNIWV 119

Query: 117 DNTEIPITTGIRIS 130
                 +   I + 
Sbjct: 120 AGHPYSLDQVISVE 133


>gi|312126826|ref|YP_003991700.1| flagellar hook capping protein [Caldicellulosiruptor hydrothermalis
           108]
 gi|311776845|gb|ADQ06331.1| flagellar hook capping protein [Caldicellulosiruptor hydrothermalis
           108]
          Length = 164

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/131 (32%), Positives = 72/131 (54%), Gaps = 13/131 (9%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           NT V+ + Q  + S +K  LG+  FL LL+TQ+++QDP +PM+  E VAQLA FS +EQ 
Sbjct: 9   NTNVSNSTQSLAASSAKNVLGKQEFLNLLVTQLRYQDPLKPMEDKEFVAQLAQFSALEQM 68

Query: 64  VQMNSTLQELLKSNNLAQASSYIGKNIT-----NADGSISGVVNAIQVSSTGLTAITVDN 118
             +N +++       L +A S IG+ +      +A   I G V++I++  +    + V+ 
Sbjct: 69  QNLNESVE-------LLKAQSMIGRYVVATSPQDASKLIEGRVDSIKIDGS-KVYLKVNG 120

Query: 119 TEIPITTGIRI 129
           TE+       +
Sbjct: 121 TEVLSDNVKEV 131


>gi|167464162|ref|ZP_02329251.1| Flagellar hook capping protein [Paenibacillus larvae subsp. larvae
           BRL-230010]
          Length = 197

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/130 (31%), Positives = 71/130 (54%), Gaps = 10/130 (7%)

Query: 9   PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
            ++ +  +S    +LG+D FLK+LI Q+ +Q+P +PM   E +AQ+A F+ +EQ   M  
Sbjct: 27  KSETKTMRSGGNSSLGKDDFLKILIAQLVNQNPMDPMNDKEFIAQMAQFTAVEQMTFMAE 86

Query: 69  TLQELLKSNNLAQASSYIGKNITNADG-------SISGVVNAIQVSSTGLTAITVDNTEI 121
            + +L +S  L  AS+ IGK+++           +  GVV+AI +   G+  + +   EI
Sbjct: 87  QMYDLRQS--LGGASTLIGKHVSYLTVNEKQEVITKQGVVDAI-IMKNGMAHVVIGKEEI 143

Query: 122 PITTGIRISN 131
           PI    R+ +
Sbjct: 144 PIDLITRVGD 153


>gi|302392389|ref|YP_003828209.1| flagellar hook capping protein [Acetohalobium arabaticum DSM 5501]
 gi|302204466|gb|ADL13144.1| flagellar hook capping protein [Acetohalobium arabaticum DSM 5501]
          Length = 138

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/125 (31%), Positives = 66/125 (52%), Gaps = 5/125 (4%)

Query: 9   PTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNS 68
             +    +++    +G+D FL+L +TQ+K+Q+P EPM   E +AQ A F+ MEQ   MN 
Sbjct: 13  NVEGTGKQTEDSNKMGKDEFLELFVTQLKNQNPLEPMDNKEFIAQTAQFTSMEQMKNMNQ 72

Query: 69  TLQELLKSNNLAQASSYIGKNITNAD----GSISGVVNAIQVSSTGLTAITVDNTEIPIT 124
            L++ L    L Q SS IGK +   D      I+G V  ++++ +G   + ++  E  + 
Sbjct: 73  NLEKFLGMQKLTQVSSLIGKEVKALDSDSGEEITGEVEKVKMADSG-PKLIINGNEYEMG 131

Query: 125 TGIRI 129
           +   I
Sbjct: 132 SVNEI 136


>gi|261407977|ref|YP_003244218.1| flagellar hook capping protein [Paenibacillus sp. Y412MC10]
 gi|261284440|gb|ACX66411.1| flagellar hook capping protein [Paenibacillus sp. Y412MC10]
          Length = 186

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 46/126 (36%), Positives = 75/126 (59%), Gaps = 11/126 (8%)

Query: 14  FSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL 73
            +K+ + + LG+D FL +LITQ++HQDP +PM+  E +AQ+A F+ +EQ + +N+ L  +
Sbjct: 21  STKNGNGQELGKDQFLSILITQLRHQDPLQPMQDREFIAQMAQFTSLEQLMNINTQLTAM 80

Query: 74  LKSNNLAQASSYIGKNITN----ADGS----ISGVVNAIQVSSTGLTAITVDNTEIPITT 125
             S +L  ASS IGK I+      DGS     SG+V++I +   G+    V   E+ +  
Sbjct: 81  --SQSLGAASSLIGKQISWMFKPEDGSDSVMKSGLVDSI-IVRDGVHYAKVGENEVSLDQ 137

Query: 126 GIRISN 131
            ++I N
Sbjct: 138 IVKIEN 143


>gi|182680452|ref|YP_001834598.1| flagellar basal body rod modification protein [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182636335|gb|ACB97109.1| flagellar hook capping protein [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 141

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 73/113 (64%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
              T+   +FL+LL+ ++K+QDPT P   ++ ++QLA FS +EQ VQ NS L  LL +++
Sbjct: 29  PPATVDYSSFLQLLVAELKNQDPTSPTDPTQYMSQLASFSSVEQQVQTNSKLDSLLTASS 88

Query: 79  LAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           L QA + IGK IT+ADGSISG V ++ VSS   TA   +  ++ +  GI I +
Sbjct: 89  LGQAETVIGKTITSADGSISGKVQSVTVSSGTATATLDNGGQVKLADGISIGS 141


>gi|307718605|ref|YP_003874137.1| flagellar hook assembly protein [Spirochaeta thermophila DSM 6192]
 gi|306532330|gb|ADN01864.1| flagellar hook assembly protein [Spirochaeta thermophila DSM 6192]
          Length = 145

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 39/112 (34%), Positives = 61/112 (54%), Gaps = 4/112 (3%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
           K+ LG+D FLKLL+ Q+ HQDPT+P++  E +AQ+A FS +EQ   M+    +L      
Sbjct: 33  KQELGKDDFLKLLVAQLTHQDPTQPLEDKEFIAQMAQFSTLEQMTNMSQEFSKLALRLQS 92

Query: 80  AQASSYIGKNITNADG--SISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
           +QA S +GK +   +G   ISGVV  ++   T    + V+     +     +
Sbjct: 93  SQAFSLLGKTVVIKNGGQEISGVVEEVR--GTEFPQLLVNGRYFDMNQIESV 142


>gi|315648131|ref|ZP_07901232.1| flagellar hook capping protein [Paenibacillus vortex V453]
 gi|315276777|gb|EFU40120.1| flagellar hook capping protein [Paenibacillus vortex V453]
          Length = 188

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 46/129 (35%), Positives = 76/129 (58%), Gaps = 12/129 (9%)

Query: 12  QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
              +K+ + + LG+D FL +LITQ++HQDP +PM+  E +AQ+A F+ +EQ + +N+ L 
Sbjct: 19  NVSNKNGNGQELGKDQFLSILITQLRHQDPLQPMQDREFIAQMAQFTSLEQLMNINTQLT 78

Query: 72  ELLKSNNLAQASSYIGKNITN----ADGS-----ISGVVNAIQVSSTGLTAITVDNTEIP 122
            +  S +L  ASS IGK I+      DGS      SG+V++I V   G+    +  +E+ 
Sbjct: 79  AM--SQSLGAASSLIGKQISWMFKPEDGSENTVMKSGIVDSIIVR-DGIHYAKIGESEVA 135

Query: 123 ITTGIRISN 131
           +   ++I N
Sbjct: 136 LDQILKIEN 144


>gi|329929292|ref|ZP_08283045.1| flagellar hook capping protein [Paenibacillus sp. HGF5]
 gi|328936661|gb|EGG33104.1| flagellar hook capping protein [Paenibacillus sp. HGF5]
          Length = 186

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 47/128 (36%), Positives = 76/128 (59%), Gaps = 11/128 (8%)

Query: 12  QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
              +K+ + + LG+D FL +LITQ++HQDP +PM+  E +AQ+A F+ +EQ + +N+ L 
Sbjct: 19  NVSTKNGNGQELGKDQFLSILITQLRHQDPLQPMQDREFIAQMAQFTSLEQLMNINTQLT 78

Query: 72  ELLKSNNLAQASSYIGKNITN----ADGS----ISGVVNAIQVSSTGLTAITVDNTEIPI 123
            +  S +L  ASS IGK I+      DGS     SG+V++I V   G+    V  +E+ +
Sbjct: 79  AM--SQSLGAASSLIGKQISWMFKPEDGSDSVMKSGLVDSIIVRE-GVHYAKVGESEVSL 135

Query: 124 TTGIRISN 131
              ++I N
Sbjct: 136 DQIVKIEN 143


>gi|147678417|ref|YP_001212632.1| flagellar hook capping protein [Pelotomaculum thermopropionicum SI]
 gi|146274514|dbj|BAF60263.1| flagellar hook capping protein [Pelotomaculum thermopropionicum SI]
          Length = 132

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 66/132 (50%), Gaps = 4/132 (3%)

Query: 1   MEINTEVNPTQQEFSKSKSK-KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           M++N+  +   +    S+   K L ++AFL+L + Q+K+QDP  P  ++  + QL+ FS 
Sbjct: 1   MQVNSVTSEYYRPPDNSREPLKALDKNAFLQLFVAQLKNQDPLSPQDSNTFITQLSQFSM 60

Query: 60  MEQSVQMNSTLQELLKSNNLAQASSYIGKNIT--NADGSISGVVNAIQVSSTGLTAITVD 117
           +EQ   +N  +    +   L +A++ +G+ +     DG +SG V  + V   G   + V+
Sbjct: 61  LEQLASLNEEVTLARRFQELGEAAALLGRQVKVQTGDGDVSGQVEKVAVVE-GEVRLFVN 119

Query: 118 NTEIPITTGIRI 129
            T   +     +
Sbjct: 120 GTGYGLDKVTEV 131


>gi|169827127|ref|YP_001697285.1| hypothetical protein Bsph_1557 [Lysinibacillus sphaericus C3-41]
 gi|168991615|gb|ACA39155.1| Hypothetical ylxG protein [Lysinibacillus sphaericus C3-41]
          Length = 228

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 41/134 (30%), Positives = 63/134 (47%), Gaps = 16/134 (11%)

Query: 12  QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
           ++ +K      LG+DAFL+LLITQ++HQDPT PM   E ++Q+A FS +EQ   M   ++
Sbjct: 23  KKPTKQTGNSELGKDAFLQLLITQLQHQDPTNPMNDREFISQMAQFSSLEQMQNMTKAVE 82

Query: 72  ELLKSNNLAQASSY---IGKNITNAD-------------GSISGVVNAIQVSSTGLTAIT 115
            LL S    Q  +Y   +GK +   +                SGV+ +++     +    
Sbjct: 83  SLLASQQQTQMMNYATFVGKEVKWHEISDKTDEKGEPIVNEGSGVIESLKFVDGSVVFKL 142

Query: 116 VDNTEIPITTGIRI 129
            D  EI       I
Sbjct: 143 ADGKEITPGNISGI 156


>gi|297584042|ref|YP_003699822.1| flagellar hook capping protein [Bacillus selenitireducens MLS10]
 gi|297142499|gb|ADH99256.1| flagellar hook capping protein [Bacillus selenitireducens MLS10]
          Length = 161

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 42/137 (30%), Positives = 74/137 (54%), Gaps = 14/137 (10%)

Query: 8   NPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN 67
           +  +++ +K      +G+DAFLKLLITQ+++QDP +PM+  E ++Q+A FS +EQ   MN
Sbjct: 16  DYVREQRAKGTGDSEMGKDAFLKLLITQLQNQDPLDPMEDKEFISQMANFSSLEQMTNMN 75

Query: 68  STLQELLKSNNLAQ---ASSYIGK------NITNADG-----SISGVVNAIQVSSTGLTA 113
             + + L+S   +Q    S  IGK       + N +G     ++S +V A++      T 
Sbjct: 76  ENMNKFLESQQQSQFFSHSDMIGKQIEWQEEVKNENGDKRMETMSAIVQAVKFKDGIATI 135

Query: 114 ITVDNTEIPITTGIRIS 130
           +T    E+ +    +I+
Sbjct: 136 LTESGKELSVDDIQKIA 152


>gi|312876504|ref|ZP_07736487.1| flagellar hook capping protein [Caldicellulosiruptor lactoaceticus
           6A]
 gi|311796715|gb|EFR13061.1| flagellar hook capping protein [Caldicellulosiruptor lactoaceticus
           6A]
          Length = 164

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/131 (33%), Positives = 70/131 (53%), Gaps = 13/131 (9%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           +T V  + Q  + S +K  LG+  FL LL+TQ+++QDP +PM+  E VAQLA FS +EQ 
Sbjct: 9   STNVPSSTQGLATSSTKNVLGKQEFLNLLVTQLRYQDPLKPMEDKEFVAQLAQFSALEQM 68

Query: 64  VQMNSTLQELLKSNNLAQASSYIGKNIT-----NADGSISGVVNAIQVSSTGLTAITVDN 118
             +N + +       L +A + IG+ I      ++   I G V +++V  +    + V+N
Sbjct: 69  QNLNESFE-------LLKAQNMIGRYIVATNPQDSSKQIEGRVESVKVDGS-KVYLKVNN 120

Query: 119 TEIPITTGIRI 129
           TEI       I
Sbjct: 121 TEISSENVKEI 131


>gi|291484180|dbj|BAI85255.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. natto BEST195]
          Length = 140

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/133 (26%), Positives = 74/133 (55%), Gaps = 5/133 (3%)

Query: 3   INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           I++E    ++  + S +  +LG+D FLK+L+TQ+++QDP  P+   E ++Q+A FS +EQ
Sbjct: 4   ISSEYKLPEKTNTVSTNNSSLGKDEFLKILMTQVQNQDPLNPVDDKEFISQMATFSSLEQ 63

Query: 63  SVQMNSTLQELLKSNN-LAQASSYIGKNITNADGSI----SGVVNAIQVSSTGLTAITVD 117
            + +N+T+ + +++ +       ++GK ++  DG      +G V++++        +  D
Sbjct: 64  MMNLNTTMTQFVENQDPFTTYVDWMGKEVSWTDGKSATDKTGTVSSVKHFKGNYYLVLDD 123

Query: 118 NTEIPITTGIRIS 130
            TEI     + + 
Sbjct: 124 GTEISPANVMSVG 136


>gi|16078691|ref|NP_389510.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221309505|ref|ZP_03591352.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221313829|ref|ZP_03595634.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. subtilis str. NCIB 3610]
 gi|221318752|ref|ZP_03600046.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. subtilis str. JH642]
 gi|221323024|ref|ZP_03604318.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. subtilis str. SMY]
 gi|321315394|ref|YP_004207681.1| flagellar basal body rod modification protein [Bacillus subtilis
           BSn5]
 gi|140659|sp|P23455|YLXG_BACSU RecName: Full=FlaA locus uncharacterized protein ylxG; AltName:
           Full=ORF 8
 gi|39911|emb|CAA39527.1| unnamed protein product [Bacillus subtilis subsp. subtilis str.
           168]
 gi|2634000|emb|CAB13501.1| flagellar hook assembly protein [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|320021668|gb|ADV96654.1| flagellar basal body rod modification protein [Bacillus subtilis
           BSn5]
          Length = 140

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/133 (26%), Positives = 74/133 (55%), Gaps = 5/133 (3%)

Query: 3   INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           I++E    ++  + S +  +LG+D FLK+L+TQ+++QDP  P+   E ++Q+A FS +EQ
Sbjct: 4   ISSEYKLPEKTNTVSTNNSSLGKDEFLKILMTQVQNQDPLNPIDDKEFISQMATFSSLEQ 63

Query: 63  SVQMNSTLQELLKSNN-LAQASSYIGKNITNADGSI----SGVVNAIQVSSTGLTAITVD 117
            + +N+T+ + +++ +       ++GK ++  DG      +G V++++        +  D
Sbjct: 64  MMNLNTTMTQFVENQDPFTTYVDWMGKEVSWTDGKSATDKTGTVSSVKHFKGNYYLVLDD 123

Query: 118 NTEIPITTGIRIS 130
            TEI     + + 
Sbjct: 124 GTEISPANVMSVG 136


>gi|15615014|ref|NP_243317.1| flagellar basal body rod modification protein [Bacillus halodurans
           C-125]
 gi|10175071|dbj|BAB06170.1| flagellar hook assembly protein [Bacillus halodurans C-125]
          Length = 171

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/135 (29%), Positives = 68/135 (50%), Gaps = 15/135 (11%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           +    +  +   LG+D FL++LI Q+++QDP  PM   E +AQ+A FS +EQ   MNS +
Sbjct: 14  ENRPKEQSNSGILGKDDFLRILIAQLQYQDPLNPMDDREFIAQMAQFSSLEQMTNMNSAI 73

Query: 71  QELLK---SNNLAQASSYIGKNITN-----------ADGSISGVVNAIQVSSTGLTAITV 116
           Q+ +K   S  L Q S  IGK +T             +  +   V ++++ + G  +I +
Sbjct: 74  QQFVKQQTSQTLVQHSELIGKRVTWKRIIDIDEYRQKEELVENTVTSVRLETNGNVSIQL 133

Query: 117 D-NTEIPITTGIRIS 130
           D    I     +++S
Sbjct: 134 DSGRWISADQLVQVS 148


>gi|242280468|ref|YP_002992597.1| flagellar hook capping protein [Desulfovibrio salexigens DSM 2638]
 gi|242123362|gb|ACS81058.1| flagellar hook capping protein [Desulfovibrio salexigens DSM 2638]
          Length = 242

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/98 (38%), Positives = 60/98 (61%), Gaps = 6/98 (6%)

Query: 13  EFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE 72
             ++ K K  LGQD FLKLL+TQ+++QDP  PM+  E +AQ+A FS +EQ  Q+NS ++ 
Sbjct: 19  ASNQPKHKNQLGQDDFLKLLLTQMQNQDPANPMEDKEYMAQMAQFSSLEQLTQVNSNIKT 78

Query: 73  LLKSN---NLAQASSYIGKNITNADGSIS---GVVNAI 104
           ++ +N    +  A  +IGK +     SIS   G ++ +
Sbjct: 79  MIDNNAQDQMVSAVGFIGKEVKAEGYSISRDNGKISKV 116


>gi|229017041|ref|ZP_04173961.1| Flagellar hook assembly protein [Bacillus cereus AH1273]
 gi|229023222|ref|ZP_04179733.1| Flagellar hook assembly protein [Bacillus cereus AH1272]
 gi|228738147|gb|EEL88632.1| Flagellar hook assembly protein [Bacillus cereus AH1272]
 gi|228744312|gb|EEL94394.1| Flagellar hook assembly protein [Bacillus cereus AH1273]
          Length = 192

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/139 (26%), Positives = 63/139 (45%), Gaps = 10/139 (7%)

Query: 3   INTEVNPTQQ----EFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFS 58
           +N   +P QQ      S  K+   + +D FLKL +   +HQDP   M  ++ + Q A  S
Sbjct: 27  VNGVHSPVQQTNGVSASTQKTPGVMEKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLS 86

Query: 59  QMEQSVQMNSTLQEL---LKSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLT 112
            MEQ   M   +  L   + S  L     ++GK +   DG    ++G V  ++++     
Sbjct: 87  LMEQVQNMTKAVDSLRTTMYSTALDGGMKFLGKYVRGIDGEGNKVTGQVETVRLAENNDV 146

Query: 113 AITVDNTEIPITTGIRISN 131
            + +DN  + +    RIS+
Sbjct: 147 QLVIDNKVVSLRFVERISD 165


>gi|257457612|ref|ZP_05622779.1| flagellar hook capping protein [Treponema vincentii ATCC 35580]
 gi|257444998|gb|EEV20074.1| flagellar hook capping protein [Treponema vincentii ATCC 35580]
          Length = 159

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/131 (29%), Positives = 66/131 (50%), Gaps = 6/131 (4%)

Query: 1   MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
           ME++T     Q      K K+ LG+D FL+LL+ Q+ HQDPT PM+ ++ VAQ+A F+ +
Sbjct: 29  MEVDTI--NKQNFPEGRKPKQELGKDDFLQLLVAQLTHQDPTSPMEDTQFVAQMAQFTSL 86

Query: 61  EQSVQMNSTLQELLKSNNLAQASSYIGKNI--TNADGSISGVVNAIQVSSTGLTAITVDN 118
           EQ   MN +   L +    + A + +GK +    + G++SG + A          + V+ 
Sbjct: 87  EQLTNMNQSFGTLNRLIGDSSAVNVVGKQVDIEQSGGTVSGTITAATRGEN--PQVQVNG 144

Query: 119 TEIPITTGIRI 129
                +    +
Sbjct: 145 KWYAWSDVQTV 155


>gi|296133042|ref|YP_003640289.1| flagellar hook capping protein [Thermincola sp. JR]
 gi|296031620|gb|ADG82388.1| flagellar hook capping protein [Thermincola potens JR]
          Length = 146

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/139 (28%), Positives = 69/139 (49%), Gaps = 12/139 (8%)

Query: 2   EINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME 61
            ++   +   QE      K  LG+D FLKLL+TQ+K+QDP EP    + +AQ+A FS +E
Sbjct: 6   NVSDAGSTQSQEAVSRTVKNVLGKDDFLKLLLTQLKYQDPLEPTDNKDFIAQMAQFSALE 65

Query: 62  QSVQMNSTLQELLKSN-------NLAQASSYIGKNIT----NADGSISGVVNAIQVSSTG 110
           Q   M+    +L++          ++QA   IGK +     + +  ++G V A+++   G
Sbjct: 66  QMTNMSDGFTKLVQMQETLFRESTVSQAVGLIGKKVEATLPDQNEPLTGFVTAMKIV-DG 124

Query: 111 LTAITVDNTEIPITTGIRI 129
              + V+  EI +     +
Sbjct: 125 EPRVVVNGKEIGLGYISMV 143


>gi|297544703|ref|YP_003677005.1| flagellar hook capping protein [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296842478|gb|ADH60994.1| flagellar hook capping protein [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 131

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 43/137 (31%), Positives = 73/137 (53%), Gaps = 14/137 (10%)

Query: 1   MEINTEVNPTQ-QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQ 59
           ME+NT  + +     S++ S   LG+D FL+LL+ Q+++QDP +PM   E +AQLA FS 
Sbjct: 1   MEVNTNYSFSNVYNTSETTSNDQLGKDDFLQLLVVQLENQDPLDPMDDKELIAQLAQFSI 60

Query: 60  MEQSVQMNSTLQELLKSNNLAQASSYIGKNI----TNADGSISGVVNAIQ--VSSTGLTA 113
           +EQ   +N +        N  +A + IGKN+    T+ +G+ + VV  +       G   
Sbjct: 61  LEQMQNLNVSF-------NAVRAINLIGKNVYATITDDNGNSTSVVGNVDAVYKQNGEYY 113

Query: 114 ITVDNTEIPITTGIRIS 130
           + V+  ++P+     +S
Sbjct: 114 LEVNGIDVPLDAVTAVS 130


>gi|295399816|ref|ZP_06809797.1| flagellar hook capping protein [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312111672|ref|YP_003989988.1| flagellar hook capping protein [Geobacillus sp. Y4.1MC1]
 gi|294978219|gb|EFG53816.1| flagellar hook capping protein [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311216773|gb|ADP75377.1| flagellar hook capping protein [Geobacillus sp. Y4.1MC1]
          Length = 140

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 69/121 (57%), Gaps = 5/121 (4%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK 75
           +    + LG+D FLK+L+ Q+++QDP  PM+  E +AQ+A FS +EQ + ++S  + L++
Sbjct: 19  RKTGNQILGKDDFLKILLVQLQNQDPLNPMEDKEFIAQMANFSTLEQMINISSMFERLMQ 78

Query: 76  SNN---LAQASSYIGKNI--TNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           + N   L + S +IGKN+     + + SGVV ++      +     + + I  +  I++ 
Sbjct: 79  TQNNQALLRYSEWIGKNVYWQEEENTKSGVVKSVLQKDNQIFLELDNGSTINASLVIKVE 138

Query: 131 N 131
           +
Sbjct: 139 S 139


>gi|312792654|ref|YP_004025577.1| flagellar hook capping protein [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312179794|gb|ADQ39964.1| flagellar hook capping protein [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 164

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 66/123 (53%), Gaps = 13/123 (10%)

Query: 12  QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
           Q  + S +K  LG+  FL LL+TQ+++QDP +PM+  E VAQLA FS +EQ   +N + +
Sbjct: 17  QGLATSSTKNVLGKQEFLNLLVTQLRYQDPLKPMEDKEFVAQLAQFSALEQMQNLNESFE 76

Query: 72  ELLKSNNLAQASSYIGKNIT-----NADGSISGVVNAIQVSSTGLTAITVDNTEIPITTG 126
                  L +A S IG+ +      ++   I G V +++V  +    + V+NTEI     
Sbjct: 77  -------LLKAQSMIGRYVVATNPQDSSKQIEGRVESVKVDGS-KVYLKVNNTEISSENV 128

Query: 127 IRI 129
             I
Sbjct: 129 KEI 131


>gi|163939558|ref|YP_001644442.1| flagellar basal body rod modification protein [Bacillus
           weihenstephanensis KBAB4]
 gi|163861755|gb|ABY42814.1| flagellar hook capping protein [Bacillus weihenstephanensis KBAB4]
          Length = 192

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/139 (26%), Positives = 65/139 (46%), Gaps = 10/139 (7%)

Query: 3   INTEVNPTQQEF----SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFS 58
           +N   +P QQ      S  K+   +G+D FLKL ++  +HQDP   M  ++ + Q A  S
Sbjct: 27  VNGVQSPVQQTNGVSESAQKTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLS 86

Query: 59  QMEQSVQMNSTLQEL---LKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLT 112
            MEQ   M   +  L   + S  L     ++GK +   DG    ++G V  ++++     
Sbjct: 87  LMEQVQNMTKAVDSLRTTMYSTALDGGMKFLGKYVRGIDGDGKKVTGQVETVRLAENNDV 146

Query: 113 AITVDNTEIPITTGIRISN 131
            + +DN  + +    R+S+
Sbjct: 147 QLVIDNKIVSLRFVERVSD 165


>gi|52080230|ref|YP_079021.1| flagellar basal body rod modification protein [Bacillus
           licheniformis ATCC 14580]
 gi|52785607|ref|YP_091436.1| flagellar basal body rod modification protein [Bacillus
           licheniformis ATCC 14580]
 gi|319645991|ref|ZP_08000221.1| YlxG protein [Bacillus sp. BT1B_CT2]
 gi|52003441|gb|AAU23383.1| Flagellar hook capping protein [Bacillus licheniformis ATCC 14580]
 gi|52348109|gb|AAU40743.1| YlxG [Bacillus licheniformis ATCC 14580]
 gi|317391741|gb|EFV72538.1| YlxG protein [Bacillus sp. BT1B_CT2]
          Length = 155

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 65/124 (52%), Gaps = 4/124 (3%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
            ++  K+ S   LG+D FLKLL+ Q+++QDP  PM+  E +AQ+A FS +EQ   +N+T+
Sbjct: 28  AKKAEKAGSGSNLGKDEFLKLLMKQLQYQDPLNPMEDREFIAQMATFSSLEQLTNLNTTM 87

Query: 71  QELLKSNN-LAQASSYIGKNITNADGSI---SGVVNAIQVSSTGLTAITVDNTEIPITTG 126
              +   + +    S+IGK +T         + +V +++ S      +  D TE+     
Sbjct: 88  STFVGLQDPMTMYVSWIGKEVTYEGEDSEEKTALVKSVKSSDGQYLLVLDDGTEVNPWNV 147

Query: 127 IRIS 130
             +S
Sbjct: 148 TAVS 151


>gi|239826620|ref|YP_002949244.1| flagellar basal body rod modification protein [Geobacillus sp.
           WCH70]
 gi|239806913|gb|ACS23978.1| flagellar hook capping protein [Geobacillus sp. WCH70]
          Length = 140

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 69/121 (57%), Gaps = 5/121 (4%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK 75
           +    + LG+D FLK+L+ Q+++QDP  PM+  E +AQ+A FS +EQ + ++S +++ +K
Sbjct: 19  RKTGNQILGKDDFLKILLVQLQNQDPLNPMEDKEFIAQMASFSSLEQMINISSMIEQFIK 78

Query: 76  SN---NLAQASSYIGKNI--TNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           +     L + S +IGKN+     + + SG+V ++      +     + T I  +  +++ 
Sbjct: 79  TQHDHALLRYSEWIGKNVYWQEDENTKSGIVQSVSQKDQQIFLELDNGTTIKASLVVKVE 138

Query: 131 N 131
           +
Sbjct: 139 S 139


>gi|78356755|ref|YP_388204.1| basal-body rod modification protein FlgD [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
 gi|78219160|gb|ABB38509.1| basal-body rod modification protein FlgD [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
          Length = 263

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 7/104 (6%)

Query: 10  TQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST 69
           T   ++K K    LG++ FL LL+TQ+ HQDP  PM   E VAQLA FS +EQ   ++  
Sbjct: 16  TNDPYAKRKG-ADLGKEDFLTLLVTQLSHQDPLNPMDDKEFVAQLAQFSSLEQLTNISGG 74

Query: 70  LQELLKSNNLAQ---ASSYIGKNITNADGSIS---GVVNAIQVS 107
           +  L  ++N  Q   A  +IGK +  A  S+S   G  +++  +
Sbjct: 75  IDNLNDASNQGQMISAVGFIGKEVRAAGNSLSLEDGKASSVYFA 118


>gi|296330842|ref|ZP_06873317.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305674360|ref|YP_003866032.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. spizizenii str. W23]
 gi|296151847|gb|EFG92721.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305412604|gb|ADM37723.1| flagellar basal body rod modification protein [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 140

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 72/124 (58%), Gaps = 5/124 (4%)

Query: 3   INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           I++E    ++  + + S  +LG+D FLK+L+TQ+++QDP  P+   E ++Q+A FS +EQ
Sbjct: 4   ISSEYKLPEKTSTVTTSNSSLGKDEFLKILMTQVQNQDPLNPVDDKEFISQMATFSSLEQ 63

Query: 63  SVQMNSTLQELLKSNN-LAQASSYIGKNITNADGSI----SGVVNAIQVSSTGLTAITVD 117
            + MN T+ + +++ +       ++GK ++  DG      +G V++++ S      I  D
Sbjct: 64  MMNMNKTMTQFVENQDPFTSYVDWLGKEVSWTDGQSTTDKTGTVSSVKHSKGSYYLILDD 123

Query: 118 NTEI 121
            TEI
Sbjct: 124 GTEI 127


>gi|303240281|ref|ZP_07326800.1| flagellar hook capping protein [Acetivibrio cellulolyticus CD2]
 gi|302592191|gb|EFL61920.1| flagellar hook capping protein [Acetivibrio cellulolyticus CD2]
          Length = 297

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/133 (27%), Positives = 69/133 (51%), Gaps = 16/133 (12%)

Query: 7   VNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQM 66
           ++ T    +  ++   LG+D F+ LL+TQ+++QDP  P   ++ +AQ+A FS +EQ   +
Sbjct: 16  IDDTSATKASERNTGELGKDEFINLLVTQLQYQDPLNPQDDTQFIAQMAQFSALEQMQNL 75

Query: 67  NSTLQELLKSNNLAQASSYIGKNIT--------NADGSISGVVNAIQVSSTGLTAITVDN 118
           N+       S +  QA   IGK +T        +   +I+G V ++++ S G   + V+ 
Sbjct: 76  NT-------SYSATQAFGMIGKTVTANLKDGDSSKTNTITGEVTSVKMQS-GKAYVIVNG 127

Query: 119 TEIPITTGIRISN 131
            +IP+     + +
Sbjct: 128 NDIPVENVQEVKD 140


>gi|183220586|ref|YP_001838582.1| basal-body rod modification protein FlgD [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
 gi|189910694|ref|YP_001962249.1| endoflagellar hook capping protein [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167775370|gb|ABZ93671.1| Endoflagellar hook capping protein [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167779008|gb|ABZ97306.1| Basal-body rod modification protein FlgD [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
          Length = 194

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/118 (32%), Positives = 67/118 (56%), Gaps = 8/118 (6%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           + +K LG+D FLKLL+TQ+ HQDPT P++  + +AQ+A FS +EQ   ++S +  +    
Sbjct: 49  EKQKELGKDDFLKLLLTQLSHQDPTNPVQDKDFIAQMAQFSSLEQMKNISSGIARM---- 104

Query: 78  NLAQASSYIGKNITNAD----GSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
              Q+ S +GK ++  D      ++G+  AI   + G T + V+   + ++    IS+
Sbjct: 105 ESKQSYSVVGKIVSGPDLVTGEDVTGLAGAILFDNEGKTYVRVNGRMLDVSKINLISD 162


>gi|317129202|ref|YP_004095484.1| flagellar hook capping protein [Bacillus cellulosilyticus DSM 2522]
 gi|315474150|gb|ADU30753.1| flagellar hook capping protein [Bacillus cellulosilyticus DSM 2522]
          Length = 149

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 43/133 (32%), Positives = 70/133 (52%), Gaps = 13/133 (9%)

Query: 12  QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
           Q+  K+++   L +DAFL++LITQ+++QDP  PM+  E +AQ+A F+ +EQ   MN+ LQ
Sbjct: 15  QKQQKARNTGDLDKDAFLRILITQLQNQDPLNPMEDKEFIAQMAQFTSLEQMTNMNTNLQ 74

Query: 72  ELLKS--NNLAQASSYIGKNI------TNADGS-----ISGVVNAIQVSSTGLTAITVDN 118
           + L S  N     S  IGK +       N DGS     + GVV +++  +   + +  D 
Sbjct: 75  KFLDSHQNQFVSHSELIGKEVQWERERVNEDGSKRMEVVEGVVTSVKFQNGSASLVIDDQ 134

Query: 119 TEIPITTGIRISN 131
             +       I +
Sbjct: 135 HTVSTKDIQVIKS 147


>gi|269792938|ref|YP_003317842.1| flagellar hook capping protein [Thermanaerovibrio acidaminovorans
           DSM 6589]
 gi|269100573|gb|ACZ19560.1| flagellar hook capping protein [Thermanaerovibrio acidaminovorans
           DSM 6589]
          Length = 134

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 40/133 (30%), Positives = 70/133 (52%), Gaps = 5/133 (3%)

Query: 2   EINTEVNPTQQEFSKSKS-KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
           E+N            +++ KK LG+D FLK+LI Q+ HQDP +P+K  + +AQ+A FS +
Sbjct: 3   EVNGVTQAASGGQEATRAVKKELGKDDFLKILIAQLTHQDPLDPLKDRDFIAQMAQFSAL 62

Query: 61  EQSVQMNSTLQELLKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLTAITVD 117
           EQ + +   ++ L K + +A A +Y+G+ +   D      +GVV  +++    +T    D
Sbjct: 63  EQQMNIAKGIEGLSKLS-MASAVNYVGRTVGYTDDQGQEAAGVVKFVEMKDGSVTLHLAD 121

Query: 118 NTEIPITTGIRIS 130
              IP+     + 
Sbjct: 122 GNSIPMEKVQYVG 134


>gi|27381964|ref|NP_773493.1| flagellar basal body rod modification protein [Bradyrhizobium
           japonicum USDA 110]
 gi|27355134|dbj|BAC52118.1| hook formation protein [Bradyrhizobium japonicum USDA 110]
          Length = 140

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 41/111 (36%), Positives = 68/111 (61%), Gaps = 3/111 (2%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           +  + FL+LL+ ++K+QDPT PM  S+ ++Q A  S +EQ++Q N+ L  LL S +L+QA
Sbjct: 28  VDYNTFLQLLVAEMKNQDPTNPMDTSQYMSQFAQLSTVEQAMQTNTKLDALLSSQSLSQA 87

Query: 83  SSYIGKNITNAD---GSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
              IGK ++  D    + SG V +I ++S G  A   + T++ +  G+ IS
Sbjct: 88  DGLIGKTVSFTDATGATFSGKVKSISINSDGSVATLENGTKVAVGPGLTIS 138


>gi|254503888|ref|ZP_05116039.1| flagellar hook capping protein [Labrenzia alexandrii DFL-11]
 gi|222439959|gb|EEE46638.1| flagellar hook capping protein [Labrenzia alexandrii DFL-11]
          Length = 134

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 75/109 (68%), Gaps = 1/109 (0%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
           T+  +AFL+L++TQ+K+QDPT+PM ASEQ++QLA FSQ+EQ++Q NS L+ +L + +  Q
Sbjct: 27  TVDYNAFLQLMMTQMKNQDPTKPMDASEQLSQLATFSQVEQAIQTNSKLETMLTNMSFGQ 86

Query: 82  ASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
               IG+ +T+++G+ +GVV  +++ S G      +   + +  G+ IS
Sbjct: 87  VDDLIGRTVTDSNGT-TGVVEKVEIYSDGTILGLDNGKGVLLGPGVSIS 134


>gi|115523198|ref|YP_780109.1| flagellar basal body rod modification protein [Rhodopseudomonas
           palustris BisA53]
 gi|115517145|gb|ABJ05129.1| flagellar hook capping protein [Rhodopseudomonas palustris BisA53]
          Length = 135

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 41/129 (31%), Positives = 70/129 (54%), Gaps = 3/129 (2%)

Query: 5   TEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSV 64
              N ++   S S S  T+G + FL+LLI Q+K+QDP+ P   ++ ++Q A  S +EQ++
Sbjct: 7   GAANSSKSSSSSSSSSATVGYNEFLQLLIAQMKNQDPSNPTDMAQYMSQFAQLSSVEQAI 66

Query: 65  QMNSTLQELLKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLTAITVDNTEI 121
           Q N+ L  LL ++ L+QA   IG+  +  D    S +G + ++ +   G  A      ++
Sbjct: 67  QTNAKLDTLLSTSALSQAEGLIGRTASFTDEAGHSATGKIASVSIIQGGAVATLDTGVQV 126

Query: 122 PITTGIRIS 130
            +  GI IS
Sbjct: 127 LLGPGITIS 135


>gi|302872564|ref|YP_003841200.1| flagellar hook capping protein [Caldicellulosiruptor obsidiansis
           OB47]
 gi|302575423|gb|ADL43214.1| flagellar hook capping protein [Caldicellulosiruptor obsidiansis
           OB47]
          Length = 171

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 43/124 (34%), Positives = 67/124 (54%), Gaps = 13/124 (10%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           +Q  + S  K  LG+  FL LL+TQ+++QDP +PM+  E VAQLA FS +EQ   +N + 
Sbjct: 17  KQGLAVSSEKNILGKQEFLNLLVTQLRYQDPLKPMEDKEFVAQLAQFSALEQMQNLNQSF 76

Query: 71  QELLKSNNLAQASSYIGKNI---TNADG--SISGVVNAIQVSSTGLTAITVDNTEIPITT 125
           +       L +A S IG+ I   +  DG   I G V++I+V  +    + V+ TE+    
Sbjct: 77  E-------LLKAQSMIGRYIVATSTQDGLKQIEGRVDSIRVDGS-KVFLKVNGTEVLSDN 128

Query: 126 GIRI 129
              +
Sbjct: 129 IKEV 132


>gi|254473493|ref|ZP_05086890.1| flagellar hook capping protein [Pseudovibrio sp. JE062]
 gi|211957609|gb|EEA92812.1| flagellar hook capping protein [Pseudovibrio sp. JE062]
          Length = 152

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 43/131 (32%), Positives = 74/131 (56%), Gaps = 4/131 (3%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           N   +       +   +  L  +AFL L +  +K QDPT+P+  +E + QLA FS +EQS
Sbjct: 10  NGASSNEPVFKPQGSEQAYLDYNAFLMLFMESLKSQDPTDPLDTAEYMGQLAQFSAVEQS 69

Query: 64  VQMNSTLQELLKSNNLAQASSYIGKNIT--NADG--SISGVVNAIQVSSTGLTAITVDNT 119
            + N+ L  +L+ +++ QA++ IG  +   NADG  + +GV+ ++Q+ + G  A   D T
Sbjct: 70  TKTNTHLTAMLQQHSINQANNLIGATVEVPNADGTETTTGVIKSVQILTDGSIATLEDGT 129

Query: 120 EIPITTGIRIS 130
           ++ +  GI IS
Sbjct: 130 KVALVPGIEIS 140


>gi|169831905|ref|YP_001717887.1| flagellar hook capping protein [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169638749|gb|ACA60255.1| flagellar hook capping protein [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 134

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 32/129 (24%), Positives = 59/129 (45%), Gaps = 3/129 (2%)

Query: 3   INTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQ 62
           + +E     +      S     QD FLKLL+ Q+K+  P  P    + + Q A F  +E+
Sbjct: 6   VGSEYALPGKTTPPRPSSGLFDQDTFLKLLVAQLKNPSPFSPPDTDKMMEQAAQFGMLER 65

Query: 63  SVQMNSTLQELLKSNNLAQASSYIGKNIT--NADGSISGVVNAIQVSSTGLTAITVDNTE 120
            V++   L+E+ ++  LAQA+  +G+ +     D  ISG V  + ++  G   + +    
Sbjct: 66  LVKVEEALREMSRAAYLAQAAEIVGREVVVLAGDRQISGTVERVLLNERG-ARVVLGAES 124

Query: 121 IPITTGIRI 129
             I   + +
Sbjct: 125 YDINRVVEV 133


>gi|158422276|ref|YP_001523568.1| flagellar basal body rod modification protein [Azorhizobium
           caulinodans ORS 571]
 gi|158329165|dbj|BAF86650.1| flagellar hook assembly scaffolding protein [Azorhizobium
           caulinodans ORS 571]
          Length = 138

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 71/109 (65%), Gaps = 1/109 (0%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           +  + FL+LL+ Q+K+QDPT+PM ++  ++QLA FSQ+EQ    N  L  LL ++ L  A
Sbjct: 29  VDYNQFLQLLVAQLKNQDPTQPMDSTAYLSQLASFSQVEQQTNTNKKLDTLLSASALQSA 88

Query: 83  SSYIGKNITNADGSISGVVNAIQVSSTGLTAITV-DNTEIPITTGIRIS 130
            + IGK +T+ADG++SG V ++ + S G    T+ D +++ + + + IS
Sbjct: 89  DAAIGKTVTSADGTVSGTVASVSLVSGGAPIATLKDGSKVTLDSSVSIS 137


>gi|83589629|ref|YP_429638.1| flagellar hook capping protein [Moorella thermoacetica ATCC 39073]
 gi|83572543|gb|ABC19095.1| Flagellar hook capping protein [Moorella thermoacetica ATCC 39073]
          Length = 140

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 36/114 (31%), Positives = 62/114 (54%), Gaps = 7/114 (6%)

Query: 19  SKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN 78
             K LG+D FLKLL  Q+++QDP  P+  ++ +AQ+A FS +EQ   +  +  E L    
Sbjct: 19  PNKGLGKDDFLKLLAAQLQNQDPLNPVSNTDFIAQMAQFSVLEQMNNLYESFNEAL---- 74

Query: 79  LAQASSYIGKNITN--ADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           + QA   IGK +T    D +++G V+ +  S  G+  +TV   ++ +     ++
Sbjct: 75  MLQAVGLIGKEVTARINDQTLTGTVSKVNWSPEGII-LTVGEQQVSLKDVQEVA 127


>gi|218662878|ref|ZP_03518808.1| flagellar basal body rod modification protein [Rhizobium etli
           IE4771]
          Length = 146

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 57/114 (50%), Positives = 84/114 (73%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           + K TL  D FL+LLI Q+K+QDPT+PM ASEQ++QLA FSQ+EQ++Q N+ L  LL S+
Sbjct: 21  QKKATLNYDNFLQLLIAQMKNQDPTDPMDASEQMSQLASFSQVEQTIQTNTKLDTLLSSS 80

Query: 78  NLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           +L QASSY+GK + +ADG++ G V +++V S G+ A T D  +I +  GI +++
Sbjct: 81  SLTQASSYVGKYMESADGTVKGTVESVKVYSDGIIATTTDGGKILVQAGITVAD 134


>gi|229029433|ref|ZP_04185516.1| Flagellar hook assembly protein [Bacillus cereus AH1271]
 gi|228731892|gb|EEL82791.1| Flagellar hook assembly protein [Bacillus cereus AH1271]
          Length = 192

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 58/125 (46%), Gaps = 6/125 (4%)

Query: 13  EFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE 72
              + K+   +G+D FLKL +   +HQDP   M  ++ + Q A  S MEQ   M   +  
Sbjct: 41  SAGEQKTPGVMGKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDS 100

Query: 73  L---LKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLTAITVDNTEIPITTG 126
           L   + S  L     ++GK +   DG    ++G V  ++++      + +DN  + +   
Sbjct: 101 LKSTMYSTALDGGMKFLGKYVRGVDGDGKKVTGQVETVRLAENNEVQLVIDNKVVSLRFV 160

Query: 127 IRISN 131
            R+S+
Sbjct: 161 ERVSD 165


>gi|126653742|ref|ZP_01725660.1| flagellar basal body rod modification protein D [Bacillus sp.
           B14905]
 gi|126589706|gb|EAZ83842.1| flagellar basal body rod modification protein D [Bacillus sp.
           B14905]
          Length = 229

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 41/131 (31%), Positives = 61/131 (46%), Gaps = 16/131 (12%)

Query: 15  SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELL 74
           +K      LG+DAFL+LLITQ++HQDPT PM   E ++Q+A FS +EQ   M   ++ LL
Sbjct: 27  TKQTGNSELGKDAFLQLLITQLQHQDPTNPMNDREFISQMAQFSSLEQMQNMTKAVESLL 86

Query: 75  KSNNLAQASSY---IGKNITNAD-------------GSISGVVNAIQVSSTGLTAITVDN 118
            S    Q  +Y   +GK +   +                SGV+ +++     +     D 
Sbjct: 87  ASQQQTQMMNYATFVGKEVKWHEITDKTDEKGDPVVNEGSGVIESLKFVDGSVVFKLADG 146

Query: 119 TEIPITTGIRI 129
            EI       I
Sbjct: 147 KEITPGNISGI 157


>gi|328545486|ref|YP_004305595.1| flagellar hook capping protein [polymorphum gilvum SL003B-26A1]
 gi|326415227|gb|ADZ72290.1| Flagellar hook capping protein [Polymorphum gilvum SL003B-26A1]
          Length = 131

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 42/109 (38%), Positives = 74/109 (67%), Gaps = 1/109 (0%)

Query: 22  TLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81
           TL  +AFL+L++ Q+K+QDPT+P+ +++Q+AQLA FSQ+EQ+++ N+ L+ +L + +  Q
Sbjct: 24  TLDYNAFLQLMLAQMKNQDPTDPVDSTQQLAQLATFSQVEQAMKTNTKLEAMLTNMSFGQ 83

Query: 82  ASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
               IG+  T+A G+ +GVV +++V S G      +   I +  G++IS
Sbjct: 84  VDDLIGRTATDAIGT-TGVVTSVEVYSDGTLLGLDNGKGILLGPGVKIS 131


>gi|225620906|ref|YP_002722164.1| flagellar hook capping protein [Brachyspira hyodysenteriae WA1]
 gi|225215726|gb|ACN84460.1| flagellar hook capping protein [Brachyspira hyodysenteriae WA1]
          Length = 264

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 40/119 (33%), Positives = 61/119 (51%), Gaps = 4/119 (3%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           Q  F +  ++ +LG+DAFLKLL  Q+ HQDP  PM   + +AQLA FS +EQ  ++N  L
Sbjct: 27  QHNFQRDPTQNSLGKDAFLKLLTVQMSHQDPLSPMDNRDMIAQLAQFSSVEQMTEVNKNL 86

Query: 71  QELLKSNNLAQASSYIGKNIT---NADGSISGVVNAIQVSSTGLT-AITVDNTEIPITT 125
             +    +     S +GK++     A     G V  +  + TG+  A+  DN  I +  
Sbjct: 87  DSMKTFYSSQTGYSMLGKSVEVMDEAGNRFLGPVEMVMENDTGVALAVRTDNGLITVRP 145


>gi|47566135|ref|ZP_00237173.1| Basal-body rod modification protein flgD [Bacillus cereus G9241]
 gi|47557052|gb|EAL15382.1| Basal-body rod modification protein flgD [Bacillus cereus G9241]
          Length = 192

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 59/125 (47%), Gaps = 6/125 (4%)

Query: 13  EFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE 72
              + K+   +G+D FLKL +   +HQDP   M  ++ + Q A  S MEQ   M   +  
Sbjct: 41  SAGEQKTPGVMGKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDS 100

Query: 73  L---LKSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTG 126
           L   + S  +     ++GK +   DG+   ++G V  ++++      + +DN  + +   
Sbjct: 101 LKTTMYSTAIDGGMKFLGKYVRGVDGNGKKVTGQVETVRLAENNEVQLVIDNKVVSLRFV 160

Query: 127 IRISN 131
            R+S+
Sbjct: 161 ERVSD 165


>gi|116328902|ref|YP_798622.1| endoflagellar hook capping protein [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116330491|ref|YP_800209.1| endoflagellar hook capping protein [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
 gi|116121646|gb|ABJ79689.1| Endoflagellar hook capping protein [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116124180|gb|ABJ75451.1| Endoflagellar hook capping protein [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
          Length = 271

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 39/115 (33%), Positives = 66/115 (57%), Gaps = 8/115 (6%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA 80
           K+LG+D FLKLLITQ+  QDPT P+K  + +AQ+A FS +EQ   +++ +Q++       
Sbjct: 50  KSLGKDDFLKLLITQLSSQDPTNPVKDQDFIAQMAQFSSLEQMNNISTGIQKM----GNR 105

Query: 81  QASSYIGKNITNAD----GSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           Q+ S +GK ++  D     +++G+  A+     G T + V+   I +     IS+
Sbjct: 106 QSFSLVGKLVSGPDFVTGENVAGIAGALFFDGEGKTFVRVNGRSIDVEQISLISD 160


>gi|312135847|ref|YP_004003185.1| flagellar hook capping protein [Caldicellulosiruptor owensensis OL]
 gi|311775898|gb|ADQ05385.1| flagellar hook capping protein [Caldicellulosiruptor owensensis OL]
          Length = 170

 Score =  100 bits (249), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 38/118 (32%), Positives = 64/118 (54%), Gaps = 13/118 (11%)

Query: 17  SKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKS 76
           S +K  LG+  FL LL+TQ+++QDP +PM+  E VAQLA FS +EQ   +N++ +     
Sbjct: 22  SANKNILGKQEFLNLLVTQLRYQDPLKPMEDKEFVAQLAQFSALEQMQNLNNSFE----- 76

Query: 77  NNLAQASSYIGKNITNADG-----SISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
               +A S IG+ +   +       I G V++I+V  +    + V++TE+       +
Sbjct: 77  --FLKAQSMIGRYVIATNAQDGARQIEGRVDSIRVDGS-KVFLKVNDTEVLSDNVKEV 131


>gi|219670135|ref|YP_002460570.1| flagellar hook capping protein [Desulfitobacterium hafniense DCB-2]
 gi|219540395|gb|ACL22134.1| flagellar hook capping protein [Desulfitobacterium hafniense DCB-2]
          Length = 184

 Score =  100 bits (249), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 64/114 (56%), Gaps = 11/114 (9%)

Query: 14  FSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE- 72
                +K+ LG+D FLKLL+ ++ +QDP  PM   + + Q+A FS +EQ   M+ +++  
Sbjct: 23  AVSDATKEVLGKDDFLKLLVAELTNQDPLSPMDNKDMITQMAQFSSLEQMNNMSKSMENL 82

Query: 73  ------LLKSNNLAQASSYIGKNITNAD----GSISGVVNAIQVSSTGLTAITV 116
                 L +++ L+Q ++ IGK++  A+    G ++G+V ++Q  +     + V
Sbjct: 83  VGAFGALFQNSLLSQGAALIGKHVEGANIDGSGFVNGIVESVQWLNGNPQLVLV 136


>gi|224534247|ref|ZP_03674825.1| flagellar hook capping protein [Borrelia spielmanii A14S]
 gi|224514349|gb|EEF84665.1| flagellar hook capping protein [Borrelia spielmanii A14S]
          Length = 147

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 62/116 (53%), Gaps = 5/116 (4%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
            +K  LG+D FLKLLITQ+++QDPT PMK  E +AQ+A FS +EQ   M+ + ++L  S 
Sbjct: 31  SNKVNLGKDDFLKLLITQLRYQDPTNPMKDKEFIAQMAQFSALEQMANMSKSFEKLSSSL 90

Query: 78  NLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            + +    +GK I    G    + G V +I+  +  +  + V+         + + 
Sbjct: 91  EIRKDLDLLGKVIKFQHGDGEIVKGRVTSIK--TGAMPQVMVNGNYYVYKNILSVG 144


>gi|312115275|ref|YP_004012871.1| flagellar hook capping protein [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220404|gb|ADP71772.1| flagellar hook capping protein [Rhodomicrobium vannielii ATCC
           17100]
          Length = 100

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 68/100 (68%)

Query: 31  LLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQASSYIGKNI 90
           +L+ Q+++QDPT+P   ++ ++QLA FS +EQ V  NS L  LL    ++Q +S IGK +
Sbjct: 1   MLVAQLQNQDPTDPTDPTQFISQLASFSSVEQLVNANSRLDTLLTQTAISQGASLIGKTV 60

Query: 91  TNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           T+ADG+ISG + +I++SS+G  A   D + I + +G+ IS
Sbjct: 61  TSADGTISGTIASIEISSSGSVATLADGSTIELASGVVIS 100


>gi|216263922|ref|ZP_03435916.1| flagellar hook capping protein [Borrelia afzelii ACA-1]
 gi|215979966|gb|EEC20788.1| flagellar hook capping protein [Borrelia afzelii ACA-1]
          Length = 147

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 63/116 (54%), Gaps = 5/116 (4%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
            +K  LG+D FLKLLITQ+++QDPT PMK  E +AQ+A FS +EQ   M+ + ++L  S 
Sbjct: 31  SNKVNLGKDDFLKLLITQLRYQDPTNPMKDKEFIAQMAQFSALEQMANMSKSFEKLSSSL 90

Query: 78  NLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            + +    +GK I    G+   + G V +I+  +  +  I V+         + + 
Sbjct: 91  EIRKDLDLLGKVIKFQHGNGEIVEGRVTSIK--TGAIPQIMVNGNYYVYKNILSVG 144


>gi|119953083|ref|YP_945292.1| flagellar basal body rod modification protein [Borrelia turicatae
           91E135]
 gi|119861854|gb|AAX17622.1| basal-body rod modification protein FlgD [Borrelia turicatae
           91E135]
          Length = 144

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 62/124 (50%), Gaps = 5/124 (4%)

Query: 10  TQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST 69
           +  +  +      LG+D FLKLLITQ+K+QDPT+PMK  E +AQ+A FS +EQ   M+ +
Sbjct: 20  SNSKVQRGVKGNNLGRDDFLKLLITQLKYQDPTDPMKDKEFIAQMAQFSALEQMTNMSKS 79

Query: 70  LQELLKSNNLAQASSYIGKNITNA--DGS-ISGVVNAIQVSSTGLTAITVDNTEIPITTG 126
            + L     + +    +GK +     DG  I G V  I+  +  +  I +D         
Sbjct: 80  FESLSSVLGINKDLDLLGKIVEFEHVDGEIIKGKVTNIK--TGIVPQIMIDGKYYVYNNI 137

Query: 127 IRIS 130
           + + 
Sbjct: 138 LSVG 141


>gi|311068149|ref|YP_003973072.1| flagellar basal body rod modification protein [Bacillus atrophaeus
           1942]
 gi|310868666|gb|ADP32141.1| flagellar basal body rod modification protein [Bacillus atrophaeus
           1942]
          Length = 142

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 63/113 (55%), Gaps = 5/113 (4%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNN-LAQ 81
           LG+D FLK+L+ Q+++QDP  P+   E ++Q+A FS +EQ + +N+T+ + +   +    
Sbjct: 26  LGKDEFLKILMKQVQNQDPLNPVDDKEFISQMATFSSLEQMMNLNTTMTKFVDYQDPFTT 85

Query: 82  ASSYIGKNITNADG----SISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
             ++IGK+++ ++G      +G V++++ S      +  D  EI       + 
Sbjct: 86  YVNWIGKDVSWSEGQDGKEQTGKVSSVKHSKGEYFLVLEDGKEISPWNVTSVG 138


>gi|111115109|ref|YP_709727.1| flagellar basal body rod modification protein [Borrelia afzelii
           PKo]
 gi|110890383|gb|ABH01551.1| flagellar hook assembly protein [Borrelia afzelii PKo]
          Length = 147

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 62/116 (53%), Gaps = 5/116 (4%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
            +K  LG+D FLKLLITQ+++QDPT PMK  E +AQ+A FS +EQ   M+ + ++L  S 
Sbjct: 31  SNKVNLGKDDFLKLLITQLRYQDPTNPMKDKEFIAQMAQFSALEQMANMSKSFEKLSSSL 90

Query: 78  NLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            + +    +GK I    G    + G V +I+  +  +  I V+         + + 
Sbjct: 91  EIRKDLDLLGKVIKFQHGDGEIVEGRVTSIK--TGAIPQIMVNGNYYVYKNILSVG 144


>gi|56419761|ref|YP_147079.1| flagellar basal body rod modification protein [Geobacillus
           kaustophilus HTA426]
 gi|297530599|ref|YP_003671874.1| flagellar hook capping protein [Geobacillus sp. C56-T3]
 gi|56379603|dbj|BAD75511.1| flagellar hook capping protein [Geobacillus kaustophilus HTA426]
 gi|297253851|gb|ADI27297.1| flagellar hook capping protein [Geobacillus sp. C56-T3]
          Length = 142

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 68/120 (56%), Gaps = 5/120 (4%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK 75
           +    + LG+D FLK+L+ Q+++QDP  PM+  + +AQ+A FS +EQ + + + +Q+ ++
Sbjct: 20  RKTGNQILGKDDFLKILLAQLENQDPLNPMEDKDFIAQMASFSSLEQMMNIANLMQQWMQ 79

Query: 76  SNN---LAQASSYIGKNITNADGS--ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           +++   L + S +IGK +   DG   +S VV ++      +T    + T I     +++ 
Sbjct: 80  ASSRDALLRYSEWIGKTVHWQDGETMMSAVVQSVMQKDGQVTLGLDNGTTIAADAVVKVE 139


>gi|229058386|ref|ZP_04196770.1| Flagellar hook assembly protein [Bacillus cereus AH603]
 gi|229132565|ref|ZP_04261414.1| Flagellar hook assembly protein [Bacillus cereus BDRD-ST196]
 gi|229166593|ref|ZP_04294345.1| Flagellar hook assembly protein [Bacillus cereus AH621]
 gi|228616847|gb|EEK73920.1| Flagellar hook assembly protein [Bacillus cereus AH621]
 gi|228650911|gb|EEL06897.1| Flagellar hook assembly protein [Bacillus cereus BDRD-ST196]
 gi|228719895|gb|EEL71485.1| Flagellar hook assembly protein [Bacillus cereus AH603]
          Length = 192

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 36/139 (25%), Positives = 65/139 (46%), Gaps = 10/139 (7%)

Query: 3   INTEVNPTQQEFSKSKSKKT----LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFS 58
           +N   +P QQ    S  ++     +G+D FLKL ++  +HQDP   M  ++ + Q A  S
Sbjct: 27  VNGVQSPVQQTNGVSAGEQKTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLS 86

Query: 59  QMEQSVQMNSTLQEL---LKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLT 112
            MEQ   M   +  L   + S  L     ++GK +   DG    ++G V  ++++     
Sbjct: 87  LMEQVQNMTKAVDSLRTTMYSTALDGGMKFLGKYVRGIDGDGKKVTGQVETVRLAENNDV 146

Query: 113 AITVDNTEIPITTGIRISN 131
            + +DN  + +    R+S+
Sbjct: 147 QLVIDNKIVSLRFVERVSD 165


>gi|121533755|ref|ZP_01665582.1| flagellar hook capping protein [Thermosinus carboxydivorans Nor1]
 gi|121307746|gb|EAX48661.1| flagellar hook capping protein [Thermosinus carboxydivorans Nor1]
          Length = 136

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 62/116 (53%), Gaps = 11/116 (9%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           K    LG+D FLKLL+ Q+++QDP +PM+  E +AQ+A FS +EQ   +NST+  +    
Sbjct: 22  KKNDQLGKDDFLKLLVAQLRYQDPMKPMEDKEFIAQMAQFSSLEQIQNLNSTMVTM---- 77

Query: 78  NLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
              QA   IGK +   +      +G V A+++S      I V +T + ++    + 
Sbjct: 78  ---QAMGLIGKTVRWQNENGAEQAGNVRAVKISDR-QPYIVVGDTTVELSKIQVVE 129


>gi|299534780|ref|ZP_07048110.1| hypothetical protein BFZC1_02077 [Lysinibacillus fusiformis ZC1]
 gi|298729868|gb|EFI70413.1| hypothetical protein BFZC1_02077 [Lysinibacillus fusiformis ZC1]
          Length = 230

 Score =  100 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 62/134 (46%), Gaps = 16/134 (11%)

Query: 12  QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQ 71
           ++ +K      LG+DAFLKLLITQ++HQDPT PM   E ++Q+A FS +EQ   M   ++
Sbjct: 23  KKPTKQTGNSELGKDAFLKLLITQLQHQDPTNPMDDREFISQMAQFSSLEQMQNMTKAME 82

Query: 72  ---ELLKSNNLAQASSYIGKNITNAD-------------GSISGVVNAIQVSSTGLTAIT 115
                 + + +   +++IGK +   +                 GV+ +++     +    
Sbjct: 83  SLLSSQQQSQMMNYATFIGKEVKWHEITEEKDEKENPVVNEGIGVIESLKFVDGSVVFKL 142

Query: 116 VDNTEIPITTGIRI 129
            D  EI       I
Sbjct: 143 ADGKEISPGNISGI 156


>gi|46579855|ref|YP_010663.1| basal-body rod modification protein FlgD [Desulfovibrio vulgaris
           str. Hildenborough]
 gi|120602679|ref|YP_967079.1| flagellar hook capping protein [Desulfovibrio vulgaris DP4]
 gi|46449271|gb|AAS95922.1| basal-body rod modification protein FlgD [Desulfovibrio vulgaris
           str. Hildenborough]
 gi|120562908|gb|ABM28652.1| flagellar hook capping protein [Desulfovibrio vulgaris DP4]
 gi|311234144|gb|ADP86998.1| flagellar hook capping protein [Desulfovibrio vulgaris RCH1]
          Length = 265

 Score =  100 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 57/97 (58%), Gaps = 3/97 (3%)

Query: 12  QEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---S 68
           Q   K      LG+DAFL+LL+TQ+KHQDP  PM   E VAQLA F+ +EQ + +N   +
Sbjct: 17  QSAVKKSGNADLGKDAFLQLLVTQLKHQDPLNPMDDKEFVAQLAQFTSLEQLMGINTGVT 76

Query: 69  TLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQ 105
           ++ E  K   +  A SYIGK++  +   IS + + + 
Sbjct: 77  SMNEAFKQQQMMNAVSYIGKDVLASGDQISKIKDGVS 113


>gi|229160716|ref|ZP_04288708.1| Flagellar hook assembly protein [Bacillus cereus R309803]
 gi|228622731|gb|EEK79565.1| Flagellar hook assembly protein [Bacillus cereus R309803]
          Length = 192

 Score =  100 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 63/139 (45%), Gaps = 10/139 (7%)

Query: 3   INTEVNPTQQ----EFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFS 58
           +N   +P  Q      S+ K+   + +D FLKL +   +HQDP   M  ++ + Q A  S
Sbjct: 27  VNGVQSPVGQTNGVSASEQKAPGVMEKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLS 86

Query: 59  QMEQSVQMNSTLQEL---LKSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLT 112
            MEQ   M   +  L   + S  L     ++GK +   DG    ++G V  ++++     
Sbjct: 87  LMEQVQNMTKAVDSLRTTMYSTALDGGMKFLGKYVRGVDGEGNKVTGQVETVRLAENNEV 146

Query: 113 AITVDNTEIPITTGIRISN 131
            + +DN  + +    R+S+
Sbjct: 147 QLVIDNKVVSLRFVERVSD 165


>gi|157364670|ref|YP_001471437.1| flagellar hook capping protein [Thermotoga lettingae TMO]
 gi|157315274|gb|ABV34373.1| flagellar hook capping protein [Thermotoga lettingae TMO]
          Length = 219

 Score =  100 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 42/117 (35%), Positives = 60/117 (51%), Gaps = 6/117 (5%)

Query: 6   EVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQ 65
           + + +    S+     TL +DAFL LLITQ+K+QDP EPM   + +AQL  FS +EQ   
Sbjct: 6   DYSYSTYTSSERTPSNTLDKDAFLLLLITQLKNQDPLEPMDNKDFIAQLTQFSTLEQITN 65

Query: 66  MNSTLQELLKSNN---LAQASSYIGKNITNADGSIS---GVVNAIQVSSTGLTAITV 116
           M +++QE L        AQ++S IGK  T     I+   GV  +I         + V
Sbjct: 66  MTNSIQEFLTLQEGALQAQSASLIGKYATVQANQITVSDGVSESIVFELDEAAPVIV 122


>gi|194014528|ref|ZP_03053145.1| flagellar hook capping protein [Bacillus pumilus ATCC 7061]
 gi|194013554|gb|EDW23119.1| flagellar hook capping protein [Bacillus pumilus ATCC 7061]
          Length = 148

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 43/137 (31%), Positives = 65/137 (47%), Gaps = 10/137 (7%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           N  V  T       K   TLG+D FLK+L+TQ+++QDPT P+   E V QLA FS +EQ 
Sbjct: 8   NRTVAQTDTSSKAEKKTDTLGKDQFLKILLTQLQNQDPTNPLDDREFVTQLATFSSLEQQ 67

Query: 64  VQMNSTLQELLKSNNLAQA--------SSYIGKNITN--ADGSISGVVNAIQVSSTGLTA 113
             MN ++ +L +  +   A          +IGK ++    D  ISG V +++  +     
Sbjct: 68  TNMNDSITKLNQLMSTFVAHQDPFTTYVGWIGKEVSGKLDDKDISGTVKSVKNINNEYFL 127

Query: 114 ITVDNTEIPITTGIRIS 130
              D T+I       + 
Sbjct: 128 YLEDGTKISPWDVTAVG 144


>gi|225181605|ref|ZP_03735046.1| flagellar hook capping protein [Dethiobacter alkaliphilus AHT 1]
 gi|225167713|gb|EEG76523.1| flagellar hook capping protein [Dethiobacter alkaliphilus AHT 1]
          Length = 141

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/126 (28%), Positives = 74/126 (58%), Gaps = 6/126 (4%)

Query: 10  TQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST 69
           TQQ    + + + + +D FL+LL+TQ+++QDP +P   SE VAQ+A F+ +EQ   +N+T
Sbjct: 13  TQQSNKATGAMQEMDKDMFLQLLVTQLRYQDPLDPQDNSEFVAQMAQFTSLEQMQNLNNT 72

Query: 70  LQELLKSNNLA--QASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPIT 124
           + +LL   +     A +++G ++T  D +   ++G+V+A++    G   + +D     + 
Sbjct: 73  MAKLLDIQSSLHNSAPAFLGLSVTVKDDNGLPLTGIVSAVE-YDNGKPRLVIDGNRYGLE 131

Query: 125 TGIRIS 130
           +  +++
Sbjct: 132 SVQKVT 137


>gi|42780845|ref|NP_978092.1| flagellar basal body rod modification protein [Bacillus cereus ATCC
           10987]
 gi|42736765|gb|AAS40700.1| flagellar hook assembly protein family protein [Bacillus cereus
           ATCC 10987]
          Length = 192

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 59/125 (47%), Gaps = 6/125 (4%)

Query: 13  EFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE 72
              + K+   +G+D FLKL ++  +HQDP   M  ++ + Q A  S MEQ   M   +  
Sbjct: 41  SAGEQKTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDS 100

Query: 73  L---LKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLTAITVDNTEIPITTG 126
           L   + S  L     ++GK +   DG    ++G V  ++++      + +DN  + +   
Sbjct: 101 LRTTMYSTALDGGMKFLGKYVRGIDGDGKKVTGQVETVRLAENNDVQLVIDNKIVSLRFV 160

Query: 127 IRISN 131
            R+S+
Sbjct: 161 ERVSD 165


>gi|323705439|ref|ZP_08117014.1| flagellar hook capping protein [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323535341|gb|EGB25117.1| flagellar hook capping protein [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 134

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/134 (25%), Positives = 71/134 (52%), Gaps = 14/134 (10%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           N+ +N        +     LG+D FL+LL+TQ+++QDP  PM   E +AQ+A FS +EQ 
Sbjct: 9   NSYMNTYTDGTKVTNPNSELGKDQFLQLLVTQLENQDPLNPMDDKEFIAQMAQFSALEQM 68

Query: 64  VQMNSTLQELLKSNNLAQASSYIGKNIT------NADGSISGVVNAIQVSSTGLTAITVD 117
             +N +        +  +A S +GK +T       +  +++G V++++   + L  + ++
Sbjct: 69  QNLNESF-------SAVKAYSLLGKTVTASVDSNGSSSTVTGKVDSVKFDGSNL-YLEIN 120

Query: 118 NTEIPITTGIRISN 131
            +++ + +   +S+
Sbjct: 121 GSDVSLDSVTSVSD 134


>gi|261419426|ref|YP_003253108.1| flagellar basal body rod modification protein [Geobacillus sp.
           Y412MC61]
 gi|319766241|ref|YP_004131742.1| flagellar hook capping protein [Geobacillus sp. Y412MC52]
 gi|261375883|gb|ACX78626.1| flagellar hook capping protein [Geobacillus sp. Y412MC61]
 gi|317111107|gb|ADU93599.1| flagellar hook capping protein [Geobacillus sp. Y412MC52]
          Length = 142

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 68/120 (56%), Gaps = 5/120 (4%)

Query: 16  KSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLK 75
           +    + LG+D FLK+L+ Q+++QDP  PM+  + +AQ+A FS +EQ + + + +Q+ ++
Sbjct: 20  RKTGNQILGKDDFLKILLAQLENQDPLNPMEDKDFIAQMANFSSLEQMMNIANLMQQWMQ 79

Query: 76  SNN---LAQASSYIGKNITNADGS--ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
           +++   L + S +IGK +   DG   +S VV ++      +T    + T I     +++ 
Sbjct: 80  ASSRDALLRYSEWIGKTVHWQDGETMMSAVVQSVMQKDGQVTLGLDNGTTIAADAVVKVE 139


>gi|324325770|gb|ADY21030.1| flagellar basal body rod modification protein [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 192

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 58/125 (46%), Gaps = 6/125 (4%)

Query: 13  EFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---ST 69
              + K+   +G+D FLKL +   +HQDP   M  ++ + Q A  S MEQ   M      
Sbjct: 41  SAGEQKTPGVMGKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDK 100

Query: 70  LQELLKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLTAITVDNTEIPITTG 126
           LQ  + S  L     ++GK +   DG    ++G V  ++++      + +DN  + +   
Sbjct: 101 LQSTMYSTALDGGMKFLGKYVRGVDGDGKKVTGQVETVRLAENNEVQLVIDNKVVSLRFV 160

Query: 127 IRISN 131
            R+S+
Sbjct: 161 ERVSD 165


>gi|216264944|ref|ZP_03436936.1| flagellar hook capping protein [Borrelia burgdorferi 156a]
 gi|224533148|ref|ZP_03673748.1| flagellar hook capping protein [Borrelia burgdorferi WI91-23]
 gi|215981417|gb|EEC22224.1| flagellar hook capping protein [Borrelia burgdorferi 156a]
 gi|224511875|gb|EEF82276.1| flagellar hook capping protein [Borrelia burgdorferi WI91-23]
 gi|312148217|gb|ADQ30876.1| flagellar hook capping protein [Borrelia burgdorferi JD1]
 gi|312149592|gb|ADQ29663.1| flagellar hook capping protein [Borrelia burgdorferi N40]
          Length = 147

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/130 (30%), Positives = 63/130 (48%), Gaps = 5/130 (3%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           N     T        +K  LG+D FLKLLITQ+++QDPT PMK  E +AQ+A FS +EQ 
Sbjct: 17  NKVKKKTDFNVENISNKVNLGKDDFLKLLITQLRYQDPTNPMKDKEFIAQMAQFSALEQM 76

Query: 64  VQMNSTLQELLKSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTE 120
             M+ + ++L  S  + +    +GK I    G    + G V  I+  +  +  + V+   
Sbjct: 77  ANMSRSFEKLSSSLEIRKDLDLLGKVIKFQHGDGEIVEGRVTNIK--TGAIPQVMVNGNY 134

Query: 121 IPITTGIRIS 130
                 + + 
Sbjct: 135 YVYKNILSVG 144


>gi|289523566|ref|ZP_06440420.1| flagellar hook capping protein [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503258|gb|EFD24422.1| flagellar hook capping protein [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 142

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 43/136 (31%), Positives = 65/136 (47%), Gaps = 7/136 (5%)

Query: 1   MEIN--TEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFS 58
           M +N  + VN +     K + K  LG+D FLKLLITQ+ HQDP EP+  +E +AQ+A FS
Sbjct: 1   MAVNQVSSVNQSYYNEGKREIKNELGKDDFLKLLITQLTHQDPLEPVSDTEFIAQMAQFS 60

Query: 59  QMEQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSI----SGVVNAIQVSSTGLTAI 114
            +EQ   +   ++ LL S     A SYIGK +   D +        V +       +   
Sbjct: 61  TLEQMTNVAKGVESLL-SVTKLNAQSYIGKEVIYYDDNTGLYQQSSVRSAIFEDGEVYLE 119

Query: 115 TVDNTEIPITTGIRIS 130
             +   I +     ++
Sbjct: 120 LENGKYILLDEIKAVT 135


>gi|302389665|ref|YP_003825486.1| flagellar hook capping protein [Thermosediminibacter oceani DSM
           16646]
 gi|302200293|gb|ADL07863.1| flagellar hook capping protein [Thermosediminibacter oceani DSM
           16646]
          Length = 129

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/122 (31%), Positives = 63/122 (51%), Gaps = 10/122 (8%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
             + + +  +  LG+D FLKLLITQ+K+Q+P EP+ + E +AQLA FS +EQ   +NS +
Sbjct: 14  SGDDNPAVGRAQLGKDDFLKLLITQLKYQNPLEPLDSKEYIAQLATFSSLEQLQNLNSQI 73

Query: 71  QELLKSNNLAQASSYIGKN--ITNADGSISGVVNAIQVSSTGLTAITVDNTE-IPITTGI 127
             +        A S+IGK       +  +SG++  +      L  I  D  + +P+    
Sbjct: 74  SAM-------SAVSFIGKTGKARIEEEYVSGIIKGVTFDKGNLNLIIGDEEKLVPLQDVY 126

Query: 128 RI 129
            I
Sbjct: 127 EI 128


>gi|222095376|ref|YP_002529436.1| flagellar basal body rod modification protein [Bacillus cereus Q1]
 gi|221239434|gb|ACM12144.1| basal-body rod modification protein [Bacillus cereus Q1]
          Length = 192

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 58/125 (46%), Gaps = 6/125 (4%)

Query: 13  EFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---ST 69
              + K+   +G+D FLKL +   +HQDP   M  ++ + Q A  S MEQ   M      
Sbjct: 41  SAGEQKTPGVMGKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDK 100

Query: 70  LQELLKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLTAITVDNTEIPITTG 126
           LQ  + S  L     ++GK +   DG    ++G V  ++++      + +DN  + +   
Sbjct: 101 LQSTMYSTALDGGMKFLGKYVRGVDGDGKKVTGQVETVRLAENNEVQLVIDNKVVSLRFV 160

Query: 127 IRISN 131
            R+S+
Sbjct: 161 ERVSD 165


>gi|15594629|ref|NP_212418.1| flagellar basal body rod modification protein [Borrelia burgdorferi
           B31]
 gi|195941362|ref|ZP_03086744.1| flagellar basal body rod modification protein [Borrelia burgdorferi
           80a]
 gi|218249522|ref|YP_002374807.1| flagellar hook capping protein [Borrelia burgdorferi ZS7]
 gi|221217794|ref|ZP_03589262.1| flagellar hook capping protein [Borrelia burgdorferi 72a]
 gi|223888939|ref|ZP_03623530.1| flagellar hook capping protein [Borrelia burgdorferi 64b]
 gi|224533832|ref|ZP_03674420.1| flagellar hook capping protein [Borrelia burgdorferi CA-11.2a]
 gi|225549019|ref|ZP_03769994.1| flagellar hook capping protein [Borrelia burgdorferi 94a]
 gi|225550075|ref|ZP_03771035.1| flagellar hook capping protein [Borrelia burgdorferi 118a]
 gi|226320585|ref|ZP_03796145.1| flagellar hook capping protein [Borrelia burgdorferi 29805]
 gi|226321602|ref|ZP_03797128.1| flagellar hook capping protein [Borrelia burgdorferi Bol26]
 gi|1165268|gb|AAA85607.1| YlxG [Borrelia burgdorferi]
 gi|1196325|gb|AAB51417.1| flagellar hook assembly protein [Borrelia burgdorferi]
 gi|2688182|gb|AAC66664.1| flagellar hook assembly protein (flgD) [Borrelia burgdorferi B31]
 gi|218164710|gb|ACK74771.1| flagellar hook capping protein [Borrelia burgdorferi ZS7]
 gi|221192471|gb|EEE18690.1| flagellar hook capping protein [Borrelia burgdorferi 72a]
 gi|223885755|gb|EEF56854.1| flagellar hook capping protein [Borrelia burgdorferi 64b]
 gi|224513125|gb|EEF83488.1| flagellar hook capping protein [Borrelia burgdorferi CA-11.2a]
 gi|225369187|gb|EEG98640.1| flagellar hook capping protein [Borrelia burgdorferi 118a]
 gi|225370245|gb|EEG99683.1| flagellar hook capping protein [Borrelia burgdorferi 94a]
 gi|226232791|gb|EEH31544.1| flagellar hook capping protein [Borrelia burgdorferi Bol26]
 gi|226234004|gb|EEH32725.1| flagellar hook capping protein [Borrelia burgdorferi 29805]
          Length = 147

 Score = 99.2 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/130 (30%), Positives = 63/130 (48%), Gaps = 5/130 (3%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           N     T        +K  LG+D FLKLLITQ+++QDPT PMK  E +AQ+A FS +EQ 
Sbjct: 17  NKVKKKTDFNVDNISNKVNLGKDDFLKLLITQLRYQDPTNPMKDKEFIAQMAQFSALEQM 76

Query: 64  VQMNSTLQELLKSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTE 120
             M+ + ++L  S  + +    +GK I    G    + G V  I+  +  +  + V+   
Sbjct: 77  ANMSRSFEKLSSSLEIRKDLDLLGKVIKFQHGDGEIVEGRVTNIK--TGAIPQVMVNGNY 134

Query: 121 IPITTGIRIS 130
                 + + 
Sbjct: 135 YVYKNILSVG 144


>gi|45657071|ref|YP_001157.1| flagellar hook assembly scaffolding protein [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
 gi|45600308|gb|AAS69794.1| flagellar hook assembly scaffolding protein [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
          Length = 264

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/115 (34%), Positives = 66/115 (57%), Gaps = 8/115 (6%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA 80
           K+LG+D FLKLLITQ+  QDPT P+K  + +AQ+A FS +EQ   +++ +Q++       
Sbjct: 50  KSLGKDDFLKLLITQLSSQDPTNPVKDQDFIAQMAQFSSLEQMNNISNGIQKM----GNR 105

Query: 81  QASSYIGKNITNAD----GSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           Q+ S +GK ++  D     +I+G+  A+     G T + V+   I +     IS+
Sbjct: 106 QSFSLVGKLVSGPDFVNGENIAGIAGALFFDGEGKTFVRVNGRSIDVEQISLISD 160


>gi|206975041|ref|ZP_03235956.1| flagellar hook assembly protein family protein [Bacillus cereus
           H3081.97]
 gi|229195965|ref|ZP_04322718.1| Flagellar hook assembly protein [Bacillus cereus m1293]
 gi|206747060|gb|EDZ58452.1| flagellar hook assembly protein family protein [Bacillus cereus
           H3081.97]
 gi|228587524|gb|EEK45589.1| Flagellar hook assembly protein [Bacillus cereus m1293]
          Length = 192

 Score = 98.9 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 59/125 (47%), Gaps = 6/125 (4%)

Query: 13  EFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN---ST 69
              + K+   +G+D FLKL ++  +HQDP   M  ++ + Q A  S MEQ   M      
Sbjct: 41  SAGEQKTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDK 100

Query: 70  LQELLKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLTAITVDNTEIPITTG 126
           LQ  + S  L     ++GK +   DG    ++G V  ++++      + +DN  + +   
Sbjct: 101 LQSTMYSTALDGGMKFLGKYVRGIDGDGKKVTGQVETVRLAENNDVQLVIDNKVVSLRFV 160

Query: 127 IRISN 131
            R+S+
Sbjct: 161 ERVSD 165


>gi|89895711|ref|YP_519198.1| hypothetical protein DSY2965 [Desulfitobacterium hafniense Y51]
 gi|89335159|dbj|BAE84754.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 193

 Score = 98.9 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 66/132 (50%), Gaps = 14/132 (10%)

Query: 14  FSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE- 72
                +K+ LG+D FLKLL+ ++ +QDP  PM   + + Q+A FS +EQ   M+ +++  
Sbjct: 26  AVSDATKEVLGKDDFLKLLVAELTNQDPLSPMDNKDMITQMAQFSSLEQMNNMSKSMENL 85

Query: 73  ------LLKSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTG--LTAITVDNT-- 119
                 L +++ L+Q ++ IGK +   +     + G+V ++Q       L  +  D    
Sbjct: 86  VGAFGALFQNSLLSQGAAMIGKYVAGLNTEGKIVEGLVQSVQWLDGNPQLVVLLDDGKYS 145

Query: 120 EIPITTGIRISN 131
            I +   I +S+
Sbjct: 146 AIEMNEIISVSD 157


>gi|295110894|emb|CBL27644.1| Flagellar hook capping protein [Synergistetes bacterium SGP1]
          Length = 145

 Score = 98.9 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 4/94 (4%)

Query: 1  MEINTEVNPTQQEFSKSKS---KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVF 57
          M +N        + S +     +  L ++AFLKLLI ++ +QDP  PM+  E +AQ+A F
Sbjct: 1  MPVNGVAGAVNTDPSAATGAVRQNELDKNAFLKLLIAELSNQDPLNPMEDREFIAQMAQF 60

Query: 58 SQMEQSVQMNSTLQELLKSNNLAQASSYIGKNIT 91
          S +EQ   MN TL+ + +++    A SYIGK I+
Sbjct: 61 SSLEQMQNMNKTLESMAQASKFD-AVSYIGKAIS 93


>gi|217959236|ref|YP_002337784.1| flagellar basal body rod modification protein [Bacillus cereus
           AH187]
 gi|229138453|ref|ZP_04267042.1| Flagellar hook assembly protein [Bacillus cereus BDRD-ST26]
 gi|217062964|gb|ACJ77214.1| flagellar hook assembly protein family protein [Bacillus cereus
           AH187]
 gi|228644990|gb|EEL01233.1| Flagellar hook assembly protein [Bacillus cereus BDRD-ST26]
          Length = 192

 Score = 98.9 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 59/125 (47%), Gaps = 6/125 (4%)

Query: 13  EFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQE 72
              + K+   +G+D FLKL ++  +HQDP   M  ++ + Q A  S MEQ   M   +  
Sbjct: 41  SAGEQKTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDS 100

Query: 73  L---LKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLTAITVDNTEIPITTG 126
           L   + S  L     ++GK +   DG    ++G V  ++++      + +DN  + +   
Sbjct: 101 LRTTMYSTALDGGMKFLGKYVRGVDGDGKKVTGQVETVRLAENNEVQLVIDNKVVSLRFV 160

Query: 127 IRISN 131
            R+S+
Sbjct: 161 ERVSD 165


>gi|269976273|ref|ZP_06183269.1| putative flagellar hook capping protein [Mobiluncus mulieris 28-1]
 gi|269935602|gb|EEZ92140.1| putative flagellar hook capping protein [Mobiluncus mulieris 28-1]
          Length = 374

 Score = 98.9 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/129 (23%), Positives = 65/129 (50%), Gaps = 7/129 (5%)

Query: 10  TQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNST 69
           T +  +K +    LG+D F+KLL+  +K+QDPT+PM  ++ + Q +  + MEQ +QM   
Sbjct: 101 TDKAQTKKEDPTKLGKDDFMKLLLATLKYQDPTQPMDTAQLLEQTSTMTNMEQMIQMTEA 160

Query: 70  LQELLKSNNLAQASSYIGKNIT-------NADGSISGVVNAIQVSSTGLTAITVDNTEIP 122
            +   ++    Q +S +G+              + +G V+A++  + G     + + ++ 
Sbjct: 161 SKRAYEAQQRVQGASMVGRTAVYDLIDDEGNAKTTAGKVDAVEFLAEGKVLAHIGDKKVK 220

Query: 123 ITTGIRISN 131
           +   + I++
Sbjct: 221 MEDILGIAD 229


>gi|218235843|ref|YP_002366438.1| flagellar basal body rod modification protein [Bacillus cereus
           B4264]
 gi|229109209|ref|ZP_04238808.1| Flagellar hook assembly protein [Bacillus cereus Rock1-15]
 gi|218163800|gb|ACK63792.1| flagellar hook assembly protein family protein [Bacillus cereus
           B4264]
 gi|228674219|gb|EEL29464.1| Flagellar hook assembly protein [Bacillus cereus Rock1-15]
          Length = 192

 Score = 98.9 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/139 (25%), Positives = 64/139 (46%), Gaps = 10/139 (7%)

Query: 3   INTEVNPTQQE----FSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFS 58
           +N   +P QQ         K+   +G+D FLKL ++  +HQDP   M  ++ + Q A  S
Sbjct: 27  VNGVQSPVQQSNGVSAGAQKTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLS 86

Query: 59  QMEQSVQMN---STLQELLKSNNLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLT 112
            MEQ   M      LQ  + S  L     ++GK +   DG    ++G V  ++++     
Sbjct: 87  LMEQVQNMTKAVDKLQSTMYSTALDGGMKFLGKYVRGVDGEGNKVTGQVETVRLAENNDV 146

Query: 113 AITVDNTEIPITTGIRISN 131
            + ++N  + +    R+S+
Sbjct: 147 QLVINNKVVSLRFVERVSD 165


>gi|15022423|dbj|BAB62244.1| flagellar protein [Treponema medium]
          Length = 159

 Score = 98.9 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/131 (29%), Positives = 65/131 (49%), Gaps = 6/131 (4%)

Query: 1   MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60
           ME++T     Q      K K+ LG+D FL+LL+ Q+ HQDPT P++ ++ VAQ+A F+ +
Sbjct: 29  MEVDTI--NKQNFPEGRKPKQELGKDDFLQLLVAQLTHQDPTSPLEDTQFVAQMAQFTSL 86

Query: 61  EQSVQMNSTLQELLKSNNLAQASSYIGKNI--TNADGSISGVVNAIQVSSTGLTAITVDN 118
           EQ   MN     L +    + A + +GK +    + G++SG + A          + V+ 
Sbjct: 87  EQLTNMNQNFGMLNRLIGDSSAVNVVGKQVDIEQSSGTVSGTITAATRGEN--PQVQVNG 144

Query: 119 TEIPITTGIRI 129
                +    +
Sbjct: 145 KWYAWSDVQTV 155


>gi|229078935|ref|ZP_04211487.1| Flagellar hook assembly protein [Bacillus cereus Rock4-2]
 gi|228704349|gb|EEL56783.1| Flagellar hook assembly protein [Bacillus cereus Rock4-2]
          Length = 192

 Score = 98.9 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/139 (25%), Positives = 64/139 (46%), Gaps = 10/139 (7%)

Query: 3   INTEVNPTQQE----FSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFS 58
           +N   +P QQ         K+   +G+D FLKL ++  +HQDP   M  ++ + Q A  S
Sbjct: 27  VNGVQSPVQQSNGVSAGAQKTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLS 86

Query: 59  QMEQSVQMN---STLQELLKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLT 112
            MEQ   M      LQ  + S  L     ++GK +   DG    ++G V  ++++     
Sbjct: 87  LMEQVQNMTKAVDKLQSTMYSTALDGGMKFLGKYVRGVDGDGNKVTGQVETVRLAENNDV 146

Query: 113 AITVDNTEIPITTGIRISN 131
            + ++N  + +    R+S+
Sbjct: 147 QLVINNKVVSLRFVERVSD 165


>gi|24215549|ref|NP_713030.1| flagellar hook assembly scaffolding protein [Leptospira interrogans
           serovar Lai str. 56601]
 gi|24196694|gb|AAN50048.1| flagellar hook assembly scaffolding protein [Leptospira interrogans
           serovar Lai str. 56601]
          Length = 264

 Score = 98.9 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/115 (34%), Positives = 66/115 (57%), Gaps = 8/115 (6%)

Query: 21  KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLA 80
           K+LG+D FLKLLITQ+  QDPT P+K  + +AQ+A FS +EQ   +++ +Q++       
Sbjct: 50  KSLGKDDFLKLLITQLSSQDPTNPVKDQDFIAQMAQFSSLEQMNNISNGIQKM----GNR 105

Query: 81  QASSYIGKNITNAD----GSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
           Q+ S +GK ++  D     +I+G+  A+     G T + V+   I +     IS+
Sbjct: 106 QSFSLVGKLVSGPDFVNGENIAGIAGALFFDGEGKTFVRVNGRSIDVEQISLISD 160


>gi|295696120|ref|YP_003589358.1| flagellar hook capping protein [Bacillus tusciae DSM 2912]
 gi|295411722|gb|ADG06214.1| flagellar hook capping protein [Bacillus tusciae DSM 2912]
          Length = 151

 Score = 98.9 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/128 (25%), Positives = 64/128 (50%), Gaps = 2/128 (1%)

Query: 6   EVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQ 65
             +      S       L +++FL+LL+ Q+K+QDP +PM +++ ++QLA FS +EQ   
Sbjct: 13  NSSGYASPTSVINPNSQLDKNSFLQLLVAQLKNQDPLQPMDSTQFISQLAQFSALEQMTN 72

Query: 66  MNSTLQELLKSNNLAQASSYIGKNITNAD--GSISGVVNAIQVSSTGLTAITVDNTEIPI 123
           +    ++   +  +  A+ +IGK I+  D  G+I   V        GL  + +    +P 
Sbjct: 73  VAEGQEKAATATEMQAAAEWIGKRISYLDDKGNIQSGVAQAMQVKEGLVYLDLGGLSVPW 132

Query: 124 TTGIRISN 131
           ++ + + +
Sbjct: 133 SSILEVGD 140


>gi|300870372|ref|YP_003785243.1| flagellar hook capping protein FlgD [Brachyspira pilosicoli
           95/1000]
 gi|300688071|gb|ADK30742.1| flagellar hook capping protein, FlgD [Brachyspira pilosicoli
           95/1000]
          Length = 233

 Score = 98.9 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 55/108 (50%), Gaps = 3/108 (2%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
           Q  F +  +K +LG+D FLKLL  Q+ HQDP  PM   + +AQLA FS +EQ  ++N  L
Sbjct: 27  QHNFERDPAKNSLGKDDFLKLLTVQMSHQDPLSPMDNRDMIAQLAQFSSVEQMTEVNKNL 86

Query: 71  QELLKSNNLAQASSYIGKNIT---NADGSISGVVNAIQVSSTGLTAIT 115
           + +    +     S +GK++     A     G V  +  + TG+    
Sbjct: 87  ESMKTFYSSQSGYSMLGKSVEVMDEAGNRFLGPVEMVMENDTGVALAV 134


>gi|157692307|ref|YP_001486769.1| flagellar basal body rod modification protein [Bacillus pumilus
           SAFR-032]
 gi|157681065|gb|ABV62209.1| flagellar basal body rod modification protein [Bacillus pumilus
           SAFR-032]
          Length = 148

 Score = 98.9 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/137 (30%), Positives = 64/137 (46%), Gaps = 10/137 (7%)

Query: 4   NTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQS 63
           N  V  T       K   TLG+D FLK+L+TQ+++QDPT P+   E V QLA FS +EQ 
Sbjct: 8   NRTVTQTDTSSKAEKKTDTLGKDQFLKILLTQLQNQDPTNPLDDREFVTQLATFSSLEQQ 67

Query: 64  VQMNSTLQELLKSNNLAQA--------SSYIGKNITN--ADGSISGVVNAIQVSSTGLTA 113
             MN ++ +L +  +   A          +IGK ++    D  ISG V +++  +     
Sbjct: 68  TNMNDSITKLNQLMSTFVAHQDPFTTYVGWIGKEVSGKLDDKDISGTVKSVKNINNEYFL 127

Query: 114 ITVDNTEIPITTGIRIS 130
              D  +I       + 
Sbjct: 128 YLEDGMKISPWDVTAVG 144


>gi|225552001|ref|ZP_03772941.1| flagellar hook capping protein [Borrelia sp. SV1]
 gi|225370999|gb|EEH00429.1| flagellar hook capping protein [Borrelia sp. SV1]
          Length = 147

 Score = 98.9 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 61/116 (52%), Gaps = 5/116 (4%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
            +K  LG+D FLKLLITQ+++QDPT PMK  E +AQ+A FS +EQ   M+ + ++L  S 
Sbjct: 31  SNKVNLGKDDFLKLLITQLRYQDPTNPMKDKEFIAQMAQFSALEQMANMSRSFEKLSSSL 90

Query: 78  NLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            + +    +GK I    G    + G V  I+  +  +  + V+         + + 
Sbjct: 91  EIRKDLDLLGKVIKFQHGDGEIVEGRVTNIK--TGAIPQVMVNGNYYVYKNILSVG 144


>gi|302338084|ref|YP_003803290.1| flagellar hook capping protein [Spirochaeta smaragdinae DSM 11293]
 gi|301635269|gb|ADK80696.1| flagellar hook capping protein [Spirochaeta smaragdinae DSM 11293]
          Length = 149

 Score = 98.5 bits (244), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 60/114 (52%), Gaps = 4/114 (3%)

Query: 20  KKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNL 79
            ++LG+D FLKLL+TQ+++QDPT+PM+  E +AQ+A FS +EQ   ++     +  +   
Sbjct: 33  NQSLGKDDFLKLLLTQLQYQDPTKPMEDKEFIAQMAQFSSLEQMNNLSQQFVSVKNTLGR 92

Query: 80  AQASSYIGKNI--TNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRISN 131
             A   IG+ +     D  I G V A+  S      + V+ T     +   +SN
Sbjct: 93  NAAYDLIGRQVDILQGDQKIHGTVEAV--SGKDYPQLLVNGTYYDYDSVETVSN 144


>gi|298530011|ref|ZP_07017413.1| flagellar hook capping protein [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298509385|gb|EFI33289.1| flagellar hook capping protein [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 241

 Score = 98.5 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/91 (35%), Positives = 50/91 (54%), Gaps = 3/91 (3%)

Query: 11  QQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTL 70
             +  + +    LG+  FLKLLITQ+++QDP +PM   E VAQLA FS +EQ   ++  +
Sbjct: 19  NNDIPRDEDPAELGKMDFLKLLITQLENQDPLDPMDDKEFVAQLAQFSSLEQLTNISEGM 78

Query: 71  QELLKSNN---LAQASSYIGKNITNADGSIS 98
           + + ++     +  A  +IGK I      IS
Sbjct: 79  ESMNENQARQEMLGAVGFIGKEIRADGDGIS 109


>gi|220934393|ref|YP_002513292.1| flagellar hook capping protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995703|gb|ACL72305.1| flagellar hook capping protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 226

 Score = 98.5 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/126 (27%), Positives = 63/126 (50%), Gaps = 8/126 (6%)

Query: 2   EINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQME 61
           +I  ++  T  E + +K    LGQ  FL+L+ITQ+++QDP +PM++ E + QLA F  + 
Sbjct: 10  DIMNKLGLTSHETANTKGDDRLGQSDFLRLMITQLENQDPFKPMESGEFLGQLAQFGTVS 69

Query: 62  QSVQMNSTLQEL---LKSNNLAQASSYIGKNITNADGSI-----SGVVNAIQVSSTGLTA 113
               +  +       + S    QA++ + +++T     I      G+  A+QV ++    
Sbjct: 70  GIEDLQKSFNRFSQSIASGQALQAAALVDRHVTVPGDMIIMDPAEGMRGAVQVPASAEVV 129

Query: 114 ITVDNT 119
           I V N 
Sbjct: 130 IGVYNQ 135


>gi|206970764|ref|ZP_03231716.1| flagellar hook assembly protein family protein [Bacillus cereus
           AH1134]
 gi|228920463|ref|ZP_04083808.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|229069304|ref|ZP_04202594.1| Flagellar hook assembly protein [Bacillus cereus F65185]
 gi|229178161|ref|ZP_04305532.1| Flagellar hook assembly protein [Bacillus cereus 172560W]
 gi|206734400|gb|EDZ51570.1| flagellar hook assembly protein family protein [Bacillus cereus
           AH1134]
 gi|228605291|gb|EEK62741.1| Flagellar hook assembly protein [Bacillus cereus 172560W]
 gi|228713791|gb|EEL65676.1| Flagellar hook assembly protein [Bacillus cereus F65185]
 gi|228839093|gb|EEM84389.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 192

 Score = 98.5 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/139 (25%), Positives = 64/139 (46%), Gaps = 10/139 (7%)

Query: 3   INTEVNPTQQE----FSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFS 58
           +N   +P QQ         K+   +G+D FLKL ++  +HQDP   M  ++ + Q A  S
Sbjct: 27  VNGVQSPVQQSNGVSAGAQKTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLS 86

Query: 59  QMEQSVQMN---STLQELLKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLT 112
            MEQ   M      LQ  + S  L     ++GK +   DG    ++G V  ++++     
Sbjct: 87  LMEQVQNMTKAVDKLQSTMYSTALDGGMKFLGKYVRGVDGDGNKVTGQVETVRLAENNDV 146

Query: 113 AITVDNTEIPITTGIRISN 131
            + ++N  + +    R+S+
Sbjct: 147 QLVINNKVVSLRFVERVSD 165


>gi|296445191|ref|ZP_06887151.1| flagellar hook capping protein [Methylosinus trichosporium OB3b]
 gi|296257365|gb|EFH04432.1| flagellar hook capping protein [Methylosinus trichosporium OB3b]
          Length = 134

 Score = 98.5 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 53/108 (49%), Positives = 78/108 (72%)

Query: 23  LGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQA 82
           LG D FL LL+T++++QDPT P+ +++ V+QLA FS +EQ V+ N TL  +L S +L QA
Sbjct: 27  LGYDQFLTLLVTEMQNQDPTNPVDSTQTVSQLASFSAVEQQVKTNDTLTSMLASQSLTQA 86

Query: 83  SSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            S+IGK +T+ADGS+SGVV ++ + S+  TA   D + I +TTGI +S
Sbjct: 87  QSFIGKTVTSADGSVSGVVASVTIGSSSQTATLTDGSTIDLTTGITVS 134


>gi|253573525|ref|ZP_04850868.1| flagellar hook capping protein [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251847053|gb|EES75058.1| flagellar hook capping protein [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 167

 Score = 98.5 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 44/142 (30%), Positives = 72/142 (50%), Gaps = 22/142 (15%)

Query: 8   NPTQQEFSKSKSK-KTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQM 66
           N +Q    K+ +K   LG+DAFLKL+I Q+++QDP  PM  ++ VAQ+A F+ +EQ   +
Sbjct: 13  NYSQSNVQKASTKSNELGKDAFLKLMIAQMQNQDPLSPMDNTQMVAQIAQFTSVEQLTNI 72

Query: 67  NSTLQELLKSNNLAQASSYIGKNITNADGSIS------------------GVVNAIQVSS 108
           +  +  L +S  L   S  IGK +T    + +                  G+V +I V S
Sbjct: 73  SEQIAALGES--LGNDSGLIGKEVTWVTETKTGNYDVSTGKAEVIIEKESGIVESIIVRS 130

Query: 109 TGLTAITVDNTEIPITTGIRIS 130
            G+  + V + EI I+   ++ 
Sbjct: 131 -GVHYVKVGDKEIKISDIEQVG 151


>gi|228938866|ref|ZP_04101466.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228971747|ref|ZP_04132368.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228978356|ref|ZP_04138733.1| Flagellar hook assembly protein [Bacillus thuringiensis Bt407]
 gi|228781373|gb|EEM29574.1| Flagellar hook assembly protein [Bacillus thuringiensis Bt407]
 gi|228787837|gb|EEM35795.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228820715|gb|EEM66740.1| Flagellar hook assembly protein [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|326939366|gb|AEA15262.1| flagellar basal body rod modification protein [Bacillus
           thuringiensis serovar chinensis CT-43]
          Length = 192

 Score = 98.5 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/139 (25%), Positives = 64/139 (46%), Gaps = 10/139 (7%)

Query: 3   INTEVNPTQQE----FSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFS 58
           +N   +P QQ         K+   +G+D FLKL ++  +HQDP   M  ++ + Q A  S
Sbjct: 27  VNGVQSPVQQSNGVSAGAQKTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLS 86

Query: 59  QMEQSVQMN---STLQELLKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLT 112
            MEQ   M      LQ  + S  L     ++GK +   DG    ++G V  ++++     
Sbjct: 87  LMEQVQNMTKAVDKLQSTMYSTALDGGMKFLGKYVRGVDGDGNKVTGQVETVRLAENNDV 146

Query: 113 AITVDNTEIPITTGIRISN 131
            + ++N  + +    R+S+
Sbjct: 147 QLVINNKVVSLRFVERVSD 165


>gi|224531754|ref|ZP_03672386.1| flagellar hook capping protein [Borrelia valaisiana VS116]
 gi|224511219|gb|EEF81625.1| flagellar hook capping protein [Borrelia valaisiana VS116]
          Length = 147

 Score = 98.5 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 61/116 (52%), Gaps = 5/116 (4%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
            +K  LG+D FLKLLITQ+++QDPT PMK  E +AQ+A FS +EQ   M+ + ++L  S 
Sbjct: 31  ANKVNLGKDDFLKLLITQLRYQDPTNPMKDKEFIAQMAQFSSLEQMANMSKSFEKLSSSL 90

Query: 78  NLAQASSYIGKNITNADGS---ISGVVNAIQVSSTGLTAITVDNTEIPITTGIRIS 130
            + +    +GK I    G    + G V  I+  +  +  I V+         + + 
Sbjct: 91  EIRKDLDLLGKVIKFQHGDGEIVKGRVTNIK--TGAIPQIMVNGNYYVYKNILSVG 144


>gi|114320056|ref|YP_741739.1| flagellar hook capping protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226450|gb|ABI56249.1| flagellar hook capping protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 222

 Score = 98.5 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/106 (30%), Positives = 61/106 (57%), Gaps = 11/106 (10%)

Query: 8   NPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMN 67
           + ++ + ++ +    LGQD FLKL+ITQ+++QDP  PM++ E ++Q+A F+      Q+ 
Sbjct: 10  DYSRAQPTQREPAGELGQDDFLKLMITQLQNQDPMNPMESGEFMSQIASFTTASGMDQLQ 69

Query: 68  STLQEL---LKSNNLAQASSYIGKNITN--------ADGSISGVVN 102
            +  E    +++N   QA+S +G+ +          ADG ++G+V 
Sbjct: 70  KSFSEFQQDMRANQALQAASLVGREVLVETDAGRLPADGEMTGIVQ 115


>gi|229096238|ref|ZP_04227211.1| Flagellar hook assembly protein [Bacillus cereus Rock3-29]
 gi|229102352|ref|ZP_04233060.1| Flagellar hook assembly protein [Bacillus cereus Rock3-28]
 gi|229115193|ref|ZP_04244603.1| Flagellar hook assembly protein [Bacillus cereus Rock1-3]
 gi|228668333|gb|EEL23765.1| Flagellar hook assembly protein [Bacillus cereus Rock1-3]
 gi|228680999|gb|EEL35168.1| Flagellar hook assembly protein [Bacillus cereus Rock3-28]
 gi|228687198|gb|EEL41103.1| Flagellar hook assembly protein [Bacillus cereus Rock3-29]
          Length = 192

 Score = 98.1 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 64/139 (46%), Gaps = 10/139 (7%)

Query: 3   INTEVNPTQQ----EFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFS 58
           +N   +P QQ         K+   +G+D FLKL ++  +HQDP   M  ++ + Q A  S
Sbjct: 27  VNGVQSPVQQTNGVSAGAQKTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMNQTAQLS 86

Query: 59  QMEQSVQMNSTLQEL---LKSNNLAQASSYIGKNITNADG---SISGVVNAIQVSSTGLT 112
            MEQ   M   +  L   + S  L     ++GK +   DG    ++G V  ++++     
Sbjct: 87  LMEQVQNMTKAVDSLRTTMYSTALDGGMKFLGKYVRGVDGDGNKVTGQVETVRLAENNDV 146

Query: 113 AITVDNTEIPITTGIRISN 131
            + ++N  + +    R+S+
Sbjct: 147 QLIINNKVVSLRFVERVSD 165


>gi|328948414|ref|YP_004365751.1| flagellar hook capping protein [Treponema succinifaciens DSM 2489]
 gi|328448738|gb|AEB14454.1| flagellar hook capping protein [Treponema succinifaciens DSM 2489]
          Length = 149

 Score = 98.1 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 41/114 (35%), Positives = 62/114 (54%), Gaps = 4/114 (3%)

Query: 18  KSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSN 77
           K ++ LG+D FLKLLITQ+ +QDPT PM+ +E +AQ+A FS +EQ   MN    ++    
Sbjct: 35  KVQRDLGKDDFLKLLITQLSNQDPTSPMENTEFIAQMAQFSSLEQMTNMNQEFAKMNSML 94

Query: 78  NLAQASSYIGKNI--TNADGSISGVVNAIQVSSTGLTAITVDNTEIPITTGIRI 129
             +QA   IGK +  T  D   +GVV A+   +     + V+N    +     +
Sbjct: 95  VSS