RPSBLAST alignment for GI: 254780520 and conserved domain: pfam03963

>gnl|CDD|146544 pfam03963, FlgD, Flagellar hook capping protein. FlgD is known to be absolutely required for hook assembly, yet it has not been detected in the mature flagellum. It appears to act as a hook-capping protein to enable assembly of hook protein subunits. Length = 140
 Score = 85.1 bits (211), Expect = 5e-18
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 3/80 (3%)

Query: 15 SKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQEL- 73
          +KS S   L +D FLKLL  Q+++QDP  PM  +E +AQLA FS +EQ   +N+TL+ L 
Sbjct: 18 AKSTSSSELDKDDFLKLLTAQLQNQDPLNPMDNTEFIAQLAQFSTVEQIQNLNTTLESLA 77

Query: 74 --LKSNNLAQASSYIGKNIT 91
            ++S+   QASS IGK + 
Sbjct: 78 ASMQSSQALQASSLIGKTVL 97