RPSBLAST alignment for GI: 254780520 and conserved domain: PRK12633

>gnl|CDD|183638 PRK12633, flgD, flagellar basal body rod modification protein; Provisional. Length = 230
 Score = 48.4 bits (115), Expect = 5e-07
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 25 QDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ--- 81
          QD FL LL+TQ+++QDP  PM+ +E  +QLA  S +E    + +T+  +    +++Q   
Sbjct: 28 QDQFLTLLVTQLRNQDPLNPMENAELTSQLAQISTVEGINNLKNTMLAISGQIDVSQSMD 87

Query: 82 ASSYIGKNI 90
          A S IGK +
Sbjct: 88 AVSMIGKGV 96