BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780520|ref|YP_003064933.1| flagellar basal body rod modification protein [Candidatus Liberibacter asiaticus str. psy62] (131 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780520|ref|YP_003064933.1| flagellar basal body rod modification protein [Candidatus Liberibacter asiaticus str. psy62] Length = 131 Score = 261 bits (667), Expect = 3e-72, Method: Compositional matrix adjust. Identities = 131/131 (100%), Positives = 131/131 (100%) Query: 1 MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60 MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM Sbjct: 1 MEINTEVNPTQQEFSKSKSKKTLGQDAFLKLLITQIKHQDPTEPMKASEQVAQLAVFSQM 60 Query: 61 EQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE 120 EQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE Sbjct: 61 EQSVQMNSTLQELLKSNNLAQASSYIGKNITNADGSISGVVNAIQVSSTGLTAITVDNTE 120 Query: 121 IPITTGIRISN 131 IPITTGIRISN Sbjct: 121 IPITTGIRISN 131 >gi|254780432|ref|YP_003064845.1| acetylornithine transaminase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 392 Score = 24.6 bits (52), Expect = 0.64, Method: Compositional matrix adjust. Identities = 11/26 (42%), Positives = 16/26 (61%) Query: 89 NITNADGSISGVVNAIQVSSTGLTAI 114 NI +DG + V+N ++ GLTAI Sbjct: 290 NIIQSDGFLENVINIAKILFEGLTAI 315 >gi|254780399|ref|YP_003064812.1| DNA mismatch repair protein [Candidatus Liberibacter asiaticus str. psy62] Length = 594 Score = 21.9 bits (45), Expect = 3.7, Method: Compositional matrix adjust. Identities = 9/21 (42%), Positives = 15/21 (71%) Query: 62 QSVQMNSTLQELLKSNNLAQA 82 QS++MN L+E+ K+ N +Q Sbjct: 553 QSIEMNRLLREMEKNPNSSQC 573 >gi|254780392|ref|YP_003064805.1| leucyl aminopeptidase [Candidatus Liberibacter asiaticus str. psy62] Length = 494 Score = 20.8 bits (42), Expect = 8.8, Method: Compositional matrix adjust. Identities = 12/45 (26%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Query: 37 KHQDPTEPMKASEQVAQLAVFSQMEQSVQMNSTLQELLKSNNLAQ 81 K ++ + P ++ E ++ V ++QS Q+ + +Q ++K NLA+ Sbjct: 139 KKRESSSP-RSKENISVTIVTEMIQQSSQVVADIQSVVKGVNLAR 182 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.307 0.121 0.306 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,955 Number of Sequences: 1233 Number of extensions: 1981 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 131 length of database: 328,796 effective HSP length: 65 effective length of query: 66 effective length of database: 248,651 effective search space: 16410966 effective search space used: 16410966 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits) S2: 34 (17.7 bits)