RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780521|ref|YP_003064934.1| flagellar biosynthesis repressor FlbT [Candidatus Liberibacter asiaticus str. psy62] (153 letters) >gnl|CDD|35002 COG5443, FlbT, Flagellar biosynthesis regulator FlbT [Cell motility and secretion]. Length = 148 Score = 132 bits (333), Expect = 5e-32 Identities = 63/148 (42%), Positives = 95/148 (64%) Query: 1 MNSPLRISLKAGERIFLNGAVVRVNNKVILELLNDITFILEHHVIREEEAITPFHQLYLI 60 M S LRISLK GE+IF+NGAV+RV+ KV LELLND+TF+LE+HV++ ++A TP QLY I Sbjct: 1 MKSTLRISLKPGEKIFINGAVLRVDRKVALELLNDVTFLLENHVLQPDQATTPLRQLYFI 60 Query: 61 VQMIFLVPTKKDYLIDLGRRYINILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTL 120 QM+ + P + ++ R+ +N+L ++ +++ ALK I+ L+ +GR FEALK IR L Sbjct: 61 AQMMLINPAGAEQATEMFRKSLNMLLACFKDAEILAALKRIDGLVMAGRAFEALKAIRGL 120 Query: 121 SFIDNIDPNGSAIFASIFQSIRQEIKSW 148 I++ + + R+ W Sbjct: 121 YPIEDEILGAQEHVPATVEQGRKAGAPW 148 >gnl|CDD|37588 KOG2377, KOG2377, KOG2377, Uncharacterized conserved protein [Function unknown]. Length = 657 Score = 28.9 bits (64), Expect = 0.67 Identities = 23/111 (20%), Positives = 45/111 (40%), Gaps = 13/111 (11%) Query: 54 FHQLYLIVQMIFLVPTKKD--YLIDLGRRYINI-LFNIIQNQQLILALKNIESLINSGRF 110 F+ L+ +Q L +K L+ L Y ++ ++L + IE L++ G+ Sbjct: 528 FYMLHQFLQYHVLSDSKPVACLLLSLESFYPPAHQLSLDMLKRLSAHDEIIEVLLSKGQV 587 Query: 111 FEALKNIRTLSFIDNIDP----------NGSAIFASIFQSIRQEIKSWKST 151 AL+ R + DN+ + +F +IF+ Q + + T Sbjct: 588 LAALRFARGIGGHDNVSARKFLEAAKQTEDNMLFYTIFRFFEQRNQRLRET 638 >gnl|CDD|31086 COG0743, Dxr, 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism]. Length = 385 Score = 28.2 bits (63), Expect = 1.0 Identities = 12/52 (23%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Query: 96 LALKNIESLINSGRFFEALKNIRTLSFIDNIDPNGSAIFASIFQSIRQEIKS 147 +AL N ESL+ +G + +D +AIF + ++ +K Sbjct: 116 IALANKESLVTAGELVMDAAKESGAQLLP-VDSEHNAIFQCLQGETQKGVKK 166 >gnl|CDD|145153 pfam01837, DUF39, Domain of unknown function DUF39. This presumed domain is about is about 320 residues long. It is found in proteins that have two C-terminal pfam00571 domains. The function of this domain is unknown. One member has been misannotated as an inosine monophosphate dehydrogenase based on the similarity to the CBS domains. Length = 300 Score = 27.1 bits (61), Expect = 2.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Query: 2 NSPLRISLKAGERIFLNGAV 21 N P ++ G RIFL GA Sbjct: 184 NDPGLRTIGIGTRIFLGGAE 203 >gnl|CDD|145059 pfam01706, FliG_C, FliG C-terminal domain. FliG is a component of the flageller rotor, present in about 25 copies per flagellum. This domain functions specifically in motor rotation. Length = 110 Score = 25.9 bits (58), Expect = 4.6 Identities = 10/29 (34%), Positives = 13/29 (44%) Query: 72 DYLIDLGRRYINILFNIIQNQQLILALKN 100 + L+ L R I L + L LALK Sbjct: 23 EDLVRLDDRDIQRLLREVDKDVLALALKG 51 >gnl|CDD|39703 KOG4503, KOG4503, KOG4503, Uncharacterized conserved membrane protein [Function unknown]. Length = 230 Score = 25.7 bits (56), Expect = 5.0 Identities = 10/36 (27%), Positives = 16/36 (44%) Query: 27 KVILELLNDITFILEHHVIREEEAITPFHQLYLIVQ 62 K I+ L ND+ + +E + I YLI + Sbjct: 104 KFIVGLQNDVGYKMESRKAEIQHQIAECKTSYLINK 139 >gnl|CDD|34689 COG5085, COG5085, Predicted membrane protein [Function unknown]. Length = 230 Score = 25.7 bits (56), Expect = 5.0 Identities = 10/36 (27%), Positives = 16/36 (44%) Query: 27 KVILELLNDITFILEHHVIREEEAITPFHQLYLIVQ 62 K I+ L ND+ + +E + I YLI + Sbjct: 104 KFIVGLQNDVGYKMESRKAEIQHQIAECKTSYLINK 139 >gnl|CDD|176851 cd00177, START, Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins. This family includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, and related domains, such as the START domain of the Arabidopsis homeobox protein GLABRA 2. The mammalian STARDs are grouped into 8 subfamilies. This family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. For some members of this family, specific lipids that bind in this pocket are known; these include cholesterol (STARD1/STARD3/ STARD4/STARD5), 25-hydroxycholesterol (STARD5), phosphatidylcholine (STARD2/ STARD7/STARD10), phosphatidylethanolamine (STARD10) and ceramides (STARD11). The START domain is found either alone or in association with other domains. Mammalian STARDs participate in the control of various cellular processes including lipid trafficking between intracellular compartments, lipid metabolism, and modulation of signaling events. Mutation or altered expression of STARDs is linked to diseases such as cancer, genetic disorders, and autoimmune disease. The Arabidopsis homeobox protein GLABRA 2 suppresses root hair formation in hairless epidermal root cells. Length = 193 Score = 25.4 bits (56), Expect = 6.0 Identities = 28/151 (18%), Positives = 63/151 (41%), Gaps = 31/151 (20%) Query: 20 AVVRVNNKVILELLNDITF-------ILEHHVIREEEAITPFHQLYLIVQMIFLVPTKKD 72 V+ + + + ELL DI E VI E + T +Y + + V + +D Sbjct: 45 GVIPASPEQVFELLMDIDLRKKWDKNFEEFEVIEEIDEHT--DIIYYKTKPPWPV-SPRD 101 Query: 73 YLIDLGRRYINILFNIIQNQQLILALKNIES-------------LINSGRFFEALKNIRT 119 ++ RR ++ +I++ K+++ + SG E L +T Sbjct: 102 FVYLRRRRKLD------DGTYVIVS-KSVDHDSHPKEKGYVRAEIKLSGWIIEPLDPGKT 154 Query: 120 -LSFIDNIDPNGSAIFASIFQSIRQEIKSWK 149 ++++ +DP GS + + + ++++ S+ Sbjct: 155 KVTYVLQVDPKGSIPKSLVNSAAKKQLASFL 185 >gnl|CDD|34452 COG4843, COG4843, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 179 Score = 24.9 bits (54), Expect = 8.4 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Query: 82 INILFNIIQNQQLILALKNIESLINSGRFFEALKNIRTLSFI-DNID 127 IN+L+ I +LIL LK L FE + + LS + DN+D Sbjct: 14 INVLYVTIYTVRLILTLKGYRYLAALVSVFEMIVYVVGLSLVLDNLD 60 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.326 0.142 0.395 Gapped Lambda K H 0.267 0.0811 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,854,812 Number of extensions: 98342 Number of successful extensions: 316 Number of sequences better than 10.0: 1 Number of HSP's gapped: 316 Number of HSP's successfully gapped: 17 Length of query: 153 Length of database: 6,263,737 Length adjustment: 86 Effective length of query: 67 Effective length of database: 4,405,363 Effective search space: 295159321 Effective search space used: 295159321 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 53 (24.0 bits)