RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780522|ref|YP_003064935.1| flagellar biosynthesis regulatory protein FlaF [Candidatus Liberibacter asiaticus str. psy62] (114 letters) >gnl|CDD|35001 COG5442, FlaF, Flagellar biosynthesis regulator FlaF [Cell motility and secretion]. Length = 115 Score = 114 bits (287), Expect = 5e-27 Identities = 54/115 (46%), Positives = 80/115 (69%), Gaps = 1/115 (0%) Query: 1 MRQYYHETIQESSIECRK-REHWILDRSISLLSIAHKSLPNSKQAVEALFYTSRVWVVFI 59 M Q+ + + E + K RE +L RSI+LL A +S++A+EAL++T RVW FI Sbjct: 1 MYQFSYADVMEDGVASAKDRERQLLTRSIALLDAARAPGDDSREAIEALYFTRRVWTRFI 60 Query: 60 QDLVSEDNHLPQEVKLNLISIGLWVLKECERIRRNKSNSYQDIIDVISIVRDGLK 114 +DL S DN LP E++ NLISIG+WVL+E E IR+ +SN+++ +I++ I+RDGLK Sbjct: 61 EDLGSPDNQLPMELRANLISIGIWVLRESEAIRQGESNNFEGLIEITQIIRDGLK 115 >gnl|CDD|37654 KOG2443, KOG2443, KOG2443, Uncharacterized conserved protein [Function unknown]. Length = 362 Score = 30.7 bits (69), Expect = 0.082 Identities = 15/67 (22%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Query: 18 KREHWILDR----SISLLSIAHKSLPNSKQAV---EALFYTSRVWVVFIQDLVSEDNHLP 70 +HW+ + S + I LP+ K LF+ WV +V+ L Sbjct: 170 LTKHWLANNLLGMSFCIAGIEFLRLPSLKTGALLLGGLFFYDIFWVFGTNVMVTVATSLD 229 Query: 71 QEVKLNL 77 +KL Sbjct: 230 APIKLVF 236 >gnl|CDD|145046 pfam01691, Adeno_E1B_19K, Adenovirus E1B 19K protein / small t-antigen. This family consists of adenovirus E1B 19K protein or small t-antigen. The E1B 19K protein inhibits E1A induced apoptosis and hence prolongs the viability of the host cell. It can also inhibit apoptosis mediated by tumour necrosis factor alpha and Fas antigen. E1B 19K blocks apoptosis by interacting with and inhibiting the p53-inducible and death- promoting Bax protein. The E1B region of adenovirus encodes two proteins E1B 19K the small t-antigen as found in this family and E1B 55K the large t-antigen which is not found in this family; both of these proteins inhibit E1A induced apoptosis. Length = 135 Score = 24.5 bits (54), Expect = 6.5 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 8/61 (13%) Query: 30 LLSIAHKSLPNSKQAVEALFYTSR-------VWVVFIQDLVSEDNHLPQEVKLNLISIGL 82 L++ H SL K V L ++S ++ FI D S D+HL + L+L+ L Sbjct: 64 SLNLGHTSLFEEK-VVPELDFSSPGRTVASLAFLAFILDKWSADSHLSEGYLLDLLCAPL 122 Query: 83 W 83 W Sbjct: 123 W 123 >gnl|CDD|39067 KOG3863, KOG3863, KOG3863, bZIP transcription factor NRF1 [Transcription]. Length = 604 Score = 24.2 bits (52), Expect = 6.9 Identities = 8/51 (15%), Positives = 19/51 (37%) Query: 62 LVSEDNHLPQEVKLNLISIGLWVLKECERIRRNKSNSYQDIIDVISIVRDG 112 L+ E + L + + + + +++R + N Y + DG Sbjct: 530 LLRERDELDSTLGVMKQQLSELYQEVFQQLRDEEGNPYSPSQYALQQAADG 580 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.135 0.396 Gapped Lambda K H 0.267 0.0762 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,360,888 Number of extensions: 60226 Number of successful extensions: 97 Number of sequences better than 10.0: 1 Number of HSP's gapped: 97 Number of HSP's successfully gapped: 12 Length of query: 114 Length of database: 6,263,737 Length adjustment: 80 Effective length of query: 34 Effective length of database: 4,535,017 Effective search space: 154190578 Effective search space used: 154190578 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (23.4 bits)