RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780522|ref|YP_003064935.1| flagellar biosynthesis regulatory protein FlaF [Candidatus Liberibacter asiaticus str. psy62] (114 letters) >d1y0ka1 c.52.1.31 (A:1-209) Hypothetical protein PA4535 {Pseudomonas aeruginosa [TaxId: 287]} Length = 209 Score = 25.7 bits (56), Expect = 1.1 Identities = 11/47 (23%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Query: 18 KREHWILDRSISLLSIAHKS---LPNSKQAVEALFYTSRVWVVFIQD 61 RE W+ R + L++ ++ +Q + LF + V F+ D Sbjct: 28 DRERWVCQRFLEALNVPYRQEDFAAPGEQPPDVLFKGAGFEVFFVLD 74 >d2d0oa2 c.55.1.6 (A:1-92,A:255-403) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} Length = 241 Score = 25.5 bits (56), Expect = 1.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 57 VFIQDLVSEDNHLPQEVK 74 +FIQDL++ D +P V Sbjct: 165 IFIQDLLAVDTSVPVSVT 182 >d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Score = 23.7 bits (51), Expect = 4.9 Identities = 12/47 (25%), Positives = 21/47 (44%) Query: 33 IAHKSLPNSKQAVEALFYTSRVWVVFIQDLVSEDNHLPQEVKLNLIS 79 + ++LPN + A +A FI + SE N + + + IS Sbjct: 13 MIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTIS 59 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.321 0.135 0.396 Gapped Lambda K H 0.267 0.0500 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 416,672 Number of extensions: 16162 Number of successful extensions: 27 Number of sequences better than 10.0: 1 Number of HSP's gapped: 27 Number of HSP's successfully gapped: 10 Length of query: 114 Length of database: 2,407,596 Length adjustment: 72 Effective length of query: 42 Effective length of database: 1,419,036 Effective search space: 59599512 Effective search space used: 59599512 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.4 bits)