HHsearch alignment for GI: 254780523 and conserved domain: PRK06945

>PRK06945 flgK flagellar hook-associated protein FlgK; Validated.
Probab=96.48  E-value=0.043  Score=29.02  Aligned_cols=71  Identities=11%  Similarity=0.027  Sum_probs=64.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             99999999986689999999999899999999986433327888999999999999999999999997368
Q gi|254780523|r  281 LSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKL  351 (357)
Q Consensus       281 ~~~i~~~~a~lGa~~~~l~~~~~~l~~~~~~l~~~~s~l~daD~ae~~t~l~~~q~~~qas~~~~a~i~~~  351 (357)
T Consensus       571 ~~~y~~~vs~iG~~a~~a~~~~~~q~~l~~~~~~~r~SvSGVnlDEEl~nLikyQqaY~AaArvItt~deM  641 (649)
T PRK06945        571 TGAYAQLVNDIGNKASQLKVSSAAQTALLTQITTAQQSVSGVNLDEEAANLLQYQQLYQANAKVIQTASTL  641 (649)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999974406139999999999999999999999999999