HHsearch alignment for GI: 254780523 and conserved domain: pfam00669

>pfam00669 Flagellin_N Bacterial flagellin N-terminal helical region. Flagellins polymerize to form bacterial flagella. This family includes flagellins and hook associated protein 3. Structurally this family forms an extended helix that interacts with pfam00700.
Probab=100.00  E-value=2.1e-33  Score=203.12  Aligned_cols=138  Identities=25%  Similarity=0.299  Sum_probs=134.8

Q ss_pred             ECHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             21899999999999999999999999972022046421289999999999999999999999999999999999998888
Q gi|254780523|r    6 ISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLVTKRLSTSQAHLSS   85 (357)
Q Consensus         6 Ist~~~~~~~~~~l~~~~~~l~~~~~qlsTGk~i~~~sddp~~~~~~~~l~~~~~~l~~~~~n~~~a~~~l~~~e~~L~~   85 (357)
T Consensus         1 I~tN~~a~~al~~l~~~~~~l~~~~~qlSTGkri~~~sDdp~~~~~~~~l~~~~~~~~q~~~N~~~a~~~l~~~e~al~~   80 (139)
T pfam00669         1 ISTNALALAARRTLNRNQAELQKAQEELSTGLRIDSALDLGAGTAISVSLRSQIRGLSQAVRNNNLGISRLQTAQGALSE   80 (139)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             96519999999999999999999999987268457844269999999999999999999999899999999978899999


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH-HCCCCEEECCCCC
Q ss_conf             999999999999851378889889999999998656777777652-0024304105665
Q gi|254780523|r   86 MQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANM-TDEGQYLFSGINS  143 (357)
Q Consensus        86 i~~~l~~~~~~~v~a~n~t~~~~d~~~~a~e~~~~~~~l~~~aN~-~~~g~~~f~G~~~  143 (357)
T Consensus        81 i~~~l~r~kel~v~a~n~~~~~~dr~ai~~Ei~~l~~~i~~~an~t~~nG~~lFsGt~T  139 (139)
T pfam00669        81 VTDILQRLRELAVQAANGGNSDIDRASAQAEIQQLTSELNNIANTTSFNGEYLFSGTNT  139 (139)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             99999999999998846899999999999999999999999998577187301289696