HHsearch alignment for GI: 254780523 and conserved domain: pfam07164

>pfam07164 consensus.
Probab=100.00  E-value=0  Score=353.23  Aligned_cols=347  Identities=29%  Similarity=0.459  Sum_probs=312.3

Q ss_pred             CCCCEECHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97613218999999999999999999999999720220464212899999999999999999999999999999999999
Q gi|254780523|r    1 MKTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLVTKRLSTSQ   80 (357)
Q Consensus         1 m~~~~Ist~~~~~~~~~~l~~~~~~l~~~~~qlsTGk~i~~~sddp~~~~~~~~l~~~~~~l~~~~~n~~~a~~~l~~~e   80 (357)
T Consensus         1 m~~~~ist~~~~~~~r~~~~r~Q~~l~~~~~E~sTG~~ad~~~~lg~~~~~~~~L~~~~~~l~~~~~~~~~a~~rl~~~q   80 (347)
T pfam07164         1 MKASFISTLALQNAMRSTILKNQAELVKAQTEATTGRHADVGLALGARTARSVSLRRDLDRLSVLVDTNSLVTQRLAATQ   80 (347)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEECCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             96520218988989999999999999999998703820564001033389999899999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             98888999999999999851378889889999999998656777777652002430410566544321223333322222
Q gi|254780523|r   81 AHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKK  160 (357)
Q Consensus        81 ~~L~~i~~~l~~~~~~~v~a~n~t~~~~d~~~~a~e~~~~~~~l~~~aN~~~~g~~~f~G~~~~~~p~~~~~~~~~~~~~  160 (357)
T Consensus        81 ~aL~~i~~~~~~~~~~l~~~~~~~~~~---~~~~~~a~~~l~~li~~LNt~~~GryLFaG~~Td~~Pl~~~~~~~~~~~~  157 (347)
T pfam07164        81 TALGQMAEAAQEFLKDLVTATSSDAPT---LTVVSQASSALQNFTSALNTSFNGEYLFAGINTDVKPIDDYADGSAAKNA  157 (347)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCHH---HHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCH
T ss_conf             999999999999999998406898517---99999999999999999843508852326867898865245767532000


Q ss_pred             CCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCEEECCCCCCEEEEEECCC
Q ss_conf             22100010134543222456653211233322100123344444566543200111566520000025641022320353
Q gi|254780523|r  161 SFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNM  240 (357)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (357)
T Consensus       158 ~~-~~~~~------~~~~~~~~~~~a~~t~~~~~~~~~~~~~~~~~~~~~~~~~s~~s~~~~~~~is~~e~~~~~~~An~  230 (347)
T pfam07164       158 VD-TAFAA------AFGFAQTDPSVASITKAQMEDFLTTTFAAQFNDAFWATNWSKASDQNMTSRISTTEVADTSTSANS  230 (347)
T ss_pred             HH-HHHHH------HHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCC
T ss_conf             23-68888------760367870154411777765533543212455420145555777765510368844630465772


Q ss_pred             CHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             10112333332100233445551135667777789999999999999998668999999999989999999998643332
Q gi|254780523|r  241 RGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI  320 (357)
Q Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~i~~~~a~lGa~~~~l~~~~~~l~~~~~~l~~~~s~l~  320 (357)
T Consensus       231 ~~~r~~~~~~~~~~~~~~~~ls~~~~~~~~~~a~~~l~~a~~~l~~~~a~lG~~q~rie~a~~r~~~~~~~l~~~~~~le  310 (347)
T pfam07164       231 DGFRKFALAAVMVMELMDPKLSSEAFDMVVTKALGLIGQAITGLTQEQSTLGLSQSRVSKATTSLKAQQKILNTHILDLE  310 (347)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             88999999999987325778787899999999999999999999999998638998899999989999999999987411


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCC
Q ss_conf             7888999999999999999999999997368505209
Q gi|254780523|r  321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL  357 (357)
Q Consensus       321 daD~ae~~t~l~~~q~~~qas~~~~a~i~~~SL~dyL  357 (357)
T Consensus       311 ~vD~aEa~trl~~~q~qLeasy~vtarl~~LSL~nyL  347 (347)
T pfam07164       311 GVDPYEASTRVNTLQTQIETSYSLTSRLQKMSLINYL  347 (347)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             6589999999999999999999999998342397409