PSIBLAST alignment of GI: 254780523 and protein with PDB id: 2zbi

>gi|167013356|pdb|2ZBI|A Chain A, Crysatl Structure Of A Bacterial Cell-Surface Flagellin Length = 292
>gi|167013357|pdb|2ZBI|B Chain B, Crysatl Structure Of A Bacterial Cell-Surface Flagellin Length = 292
 Score = 63.5 bits (152), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 22/285 (7%), Positives = 54/285 (18%), Gaps = 24/285 (8%)

Query: 56  EQEKNHIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAG 115
             +   + +   + +       T++  L  +   +Q +    V    G            
Sbjct: 1   TAQIKGLTQAQRNANDGISLAQTAEGALGEISNNLQRIRELAVQASNGTNTQTDRDALQA 60

Query: 116 MLRDSYESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSK 175
            +          A  T          + +                S     Q      S 
Sbjct: 61  EVTQLQSEIQRVAEQTSFNGQKLLDGSFNGVQFQIGANAGETIGVSKIXNAQTASLGGSL 120

Query: 176 SLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDD------------------------EYWA 211
           +                         +                             +   
Sbjct: 121 TRTTSTIDATDLTKYDTAXAAGDLTINGVDVGKIDAASTAQERAAQLTEAINRVSSQTNV 180

Query: 212 NNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTK 271
               + +   +         +  +AN                T     N    +     +
Sbjct: 181 GASYDKTTGQVTLTSNAAIAVAGAANDATVAGWANNATTGTATTTTGINSLTVSSFTNAQ 240

Query: 272 KMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYI 316
           + ++ +   L  I   RA LG  +         LQ+    + + +
Sbjct: 241 QTITQIDNALKDINTARADLGAVQNRFTSTVANLQSXTENLSSAL 285