BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780523|ref|YP_003064936.1| flagellar hook-associated
protein FlgL [Candidatus Liberibacter asiaticus str. psy62]
         (357 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|120554040|ref|YP_958391.1| flagellar hook-associated protein FlgL [Marinobacter aquaeolei VT8]
 gi|120323889|gb|ABM18204.1| flagellar hook-associated protein 3 [Marinobacter aquaeolei VT8]
          Length = 410

 Score =  176 bits (444), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 54/410 (13%), Positives = 113/410 (27%), Gaps = 55/410 (13%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              IS+  IF       +++N + V   +++ TG+  +           IL+ +QE    
Sbjct: 1   MIRISSQQIFSGGINRLQDINSNLVNTQQQLSTGKKVNKPSDDPVAAARILKLDQELQRS 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
                + +L   RL   ++ L+S   I+Q +    V    G    N     +  L++   
Sbjct: 61  ETYGRNANLADNRLKQEESTLASAVDIIQRVRELTVQAGNGSLSANDRQSISAELKERLG 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                AN  D              P            +  +      +++     ++   
Sbjct: 121 QLANIANTRDASGEYIFSGFQGSTPAFAQNDDGKWVYQGDEGQRVLEIDDGVTVPISDHG 180

Query: 183 LEVSSMNAQQMTDFIKQLEDK--------------------FSDDEYWANNWSNASDHNI 222
             +    A+ +        D                       DD   A   + A D  I
Sbjct: 181 KGIFVDVAKGVFAKGSTSVDGYISNLEFVAPKDMTDAFSPRVPDDFDIAVTANGAGDLEI 240

Query: 223 KYRI----------------------------------KDTEGIDVSANVNMRGI-RDIM 247
                                                 +D +   +  N           
Sbjct: 241 SASYTRGGIIYPLAVEPAGALVGDEFQVAGVKLTINDAQDGDTFTLGVNDKQSVFGTIEN 300

Query: 248 FVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQN 307
            +A +     +   +    + L  + L  +      II ++  LG     +     FL++
Sbjct: 301 LIAGLDGISKTTPKSSAEYDALIAETLVNLDNAQESIILKQTELGGRLNAVESTTAFLED 360

Query: 308 KNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
                    S+   V+   A + LS     ++ +     ++ +LS+ + L
Sbjct: 361 SALYTKEIRSQLQDVDYAEAISNLSFQSFVLQAAQQSFAQVSQLSLFDRL 410


>gi|311694368|gb|ADP97241.1| flagellar hook-associated protein FlgL [marine bacterium HP15]
          Length = 407

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 52/407 (12%), Positives = 106/407 (26%), Gaps = 52/407 (12%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              IS+  IF       +ELN       +++ TGQ  +           IL+ +QE + +
Sbjct: 1   MIRISSQQIFSGGINRLQELNTSLNNTQQQISTGQRVNKPSDDPVAAARILKLDQELSRV 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
                +  L   RL   +  LSS   ++Q +    V    G    N     +  L +   
Sbjct: 61  ETYQRNVDLADNRLKQEENALSSSIDVIQRIRELTVQAGNGSLSANDRRSISSELEERLG 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                AN  D                       S   +  +      +++     ++   
Sbjct: 121 QLANIANTRDASGEYIFSGFQGSVKAFEQDPSGSWVYQGDEGQRVLEIDDGVTVPISDNG 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
            ++       +T     +    +                      D   ++V A  N+  
Sbjct: 181 KDIFVRVPAAITGEHSTVSTPGASISGVKLVNEADLAAAYPNSFPDDITVEVDAGGNIIA 240

Query: 243 IRDIMFVAVIGTE----------------------------------------------- 255
                 V  +                                                  
Sbjct: 241 TDSQGDVLTVDPATYQSGEPFEVAGVEVTLTDAVPGAGDVFTLKINEKQSVFGTIENLIS 300

Query: 256 -----FLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNN 310
                  S        + L    L  +      II ++  LG     +   + FL++ + 
Sbjct: 301 GLNNIDKSSPDGQSQYDDLIANSLINLDNAQESIILKQTELGGRMNAVESTKSFLEDSSV 360

Query: 311 IIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             +   S+   V+   A + LS     ++ +     ++ +LS+ + L
Sbjct: 361 YSNEIRSQLQDVDYAEAISTLSFQSFVLQAAQQSFAQVSQLSLFDRL 407


>gi|188586844|ref|YP_001918389.1| flagellar hook-associated protein 3 [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179351531|gb|ACB85801.1| flagellar hook-associated protein 3 [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 328

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 46/354 (12%), Positives = 112/354 (31%), Gaps = 27/354 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++   + + M        +D      ++ TG+         A     L+   E+  +A
Sbjct: 1   MRVTNKMMSDNMLRNLNTNLRDMNHTQNKLSTGKRILSPSDDPAGTARTLDLRTEETELA 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       L+++ + L  +  ++Q +    +       D       A  + +  E 
Sbjct: 61  KYKQNVDDADSWLTSTDSALDEVDDVLQRVRELTIYAASDSVDQQSREALAAEVMELKEH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V  AN    G+++F G N+++KP +    ++   ++            N          
Sbjct: 121 LVEVANTDFGGKHIFGGHNTTDKPFDMDDVEEMNGEEGEYNTFDVEYSGNR--------- 171

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
                              + + D       S        +   D E    +       I
Sbjct: 172 ------------------GRLNTDISSDVTISKNLHGEEVFGSFDEEENGENGENGDEAI 213

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
              MF  + G          G    L+ + L  +   +   ++ RA +G  +  +   + 
Sbjct: 214 SQNMFKMLDGVYDSMMEDDGGGTEKLSNEHLQDLDHWIENNLDNRAEVGARQNRLELSKN 273

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            LQ+  ++    +S++   +       L +  N   M+     ++ + ++L++L
Sbjct: 274 RLQDIEHLTKEDLSETEEADMAKTIMDLKSQENVHRMALSAGARIIQPTLLDFL 327


>gi|220934401|ref|YP_002513300.1| flagellar hook-associated protein 3 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995711|gb|ACL72313.1| flagellar hook-associated protein 3 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 400

 Score =  170 bits (429), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 49/400 (12%), Positives = 120/400 (30%), Gaps = 46/400 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +ST+ IF       ++  +   +   ++ TG+         +     L++        
Sbjct: 1   MRVSTTQIFRNGIGAIQDNQQGLARTQLQLGTGKRILSPSDDPSGAVQALQFRSSVEKTE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + ++V +RL  S+  L+S+ + +Q +    V    G   N      AG +R   + 
Sbjct: 61  QYQRNGNIVEQRLRLSETILTSVGEGLQRVRELAVQGNNGSQTNETRRYIAGEIRQILDE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V  +N  D          +S            +     D   +  +    +  +     
Sbjct: 121 LVQLSNTRDANGEYIYAGLTSLTQPFSPGAGGEVFYNGDDGQRRLQISPVRQLAIGDSGQ 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNW----------------------------- 214
            V          F+ + +   +                                      
Sbjct: 181 AVFMDIPTGNGTFVVRDDPGNTGGGVIDAGSVIDFNAWQADTYTISFSEVGGELFYEVSG 240

Query: 215 -----------------SNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFL 257
                                +  I+    D +   +S + N         +A      +
Sbjct: 241 GGLPPVSTPFVEGEAIRFAGIETRIQGTPADGDSFTLSPSENQDLFATYRQLAEALEAPV 300

Query: 258 SKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYIS 317
           +   +    N    + L  + Q L  I++ RA +G   K +  +R   ++    + T +S
Sbjct: 301 TDTPSRARLNNAVNRALVNLDQALGNILDTRASVGSRLKTVENQRNINEDVLLQLRTTLS 360

Query: 318 KSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +   ++   A ++ +     ++ +     ++Q+LS+ N++
Sbjct: 361 EIEDLDYAEAISRFNLQQTALQAAQQSYVQVQRLSLFNFI 400


>gi|149375026|ref|ZP_01892799.1| Flagellin and related hook-associated protein [Marinobacter
           algicola DG893]
 gi|149360915|gb|EDM49366.1| Flagellin and related hook-associated protein [Marinobacter
           algicola DG893]
          Length = 403

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 47/403 (11%), Positives = 114/403 (28%), Gaps = 48/403 (11%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              IS+  IF       +ELN    +  E++ TG+  +           IL+ +QE + I
Sbjct: 1   MIRISSQQIFSGGINRLQELNSSLNQTQEQISTGKRVNKPSDDPVAAARILKLDQELSRI 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
                +  L   RL   ++ L+S   ++Q +    V    G    +     +  +++   
Sbjct: 61  ETYQRNAGLAENRLQQEESALASSVDVIQRIRELTVQAGNGSLSPSDRKSISSEMKERIG 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                AN  D                 G     S   +  +      +++     ++   
Sbjct: 121 QLANIANTRDASGEYIFSGFQGSTAAFGKDASGSWVYQGDEGQRVLEIDDGVTVPISDHG 180

Query: 183 LEVSSMNAQQMT------------------------------------DFIKQLEDKFSD 206
             + S     +                                     D +       + 
Sbjct: 181 KGIYSSVPAAVFAESDPGNAAAARIDGIQVADDGALSAVSPDDITITVDTVAGTVSAVNS 240

Query: 207 DEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIR------------DIMFVAVIGT 254
                   + A+  + +          ++   N                     +  +  
Sbjct: 241 RTGDPLTVTPAAYTSGESFEVAGVQATITDAGNGDEFTLRTGERQSVFATIENLIDGLDN 300

Query: 255 EFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDT 314
              +      A + L    L  +      I++++  +G     ++  + FL++ +   + 
Sbjct: 301 IDKTSPAGQAAYDDLIAASLQNLDNAQESIVQKQTEIGGRLNAVDSTKSFLEDSSVYSED 360

Query: 315 YISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             S+   V+   A + LS     ++ +     ++ +LS+ + L
Sbjct: 361 IRSQLRDVDYAEAISNLSFQSFVLQAAQQSFAQVSQLSLFDRL 403


>gi|254849317|ref|ZP_05238667.1| flagellin core protein A [Vibrio cholerae MO10]
 gi|254845022|gb|EET23436.1| flagellin core protein A [Vibrio cholerae MO10]
          Length = 402

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 37/370 (10%), Positives = 93/370 (25%), Gaps = 20/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           +   +     E + +G   +      A +        +   
Sbjct: 24  MTINVNTNVSAMTAQRYLTKATGELNTSMERLSSGNRINSAKDDAAGLQISNRLTAQSRG 83

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++            
Sbjct: 84  LDVAMRNANDGISIAQTAEGAMNESTSILQRMRDLALQSANGTNSASERQALNEESVALQ 143

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +         +S +A Q
Sbjct: 144 DELNRIAETTSFGGRKLLNGSFGEASFQIGSSSGEAIIMGLTSVRADDFRMGGQSFIAEQ 203

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D   +   K  +         +  D        + +     A+V+  
Sbjct: 204 PKTKEWGVPPTARDLKFEFTKKDGEAVVLDIIAKDGDDIEELATYINGQTDLFKASVDQE 263

Query: 242 --------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
                               G+   + +        +    D      ++  +  +   L
Sbjct: 264 GKLQIFVAEPNIEGNFNISGGLATELGLNGGPGVKTTVQDIDITSVGGSQNAVGIIDAAL 323

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +  QRA LG  +  ++     L N    ++   S+    +      QL+      +  
Sbjct: 324 KYVDSQRADLGAKQNRLSHSISNLSNIQENVEASKSRIKDTDFAKETTQLTKSQILQQAG 383

Query: 342 YMITTKLQKL 351
             I  + ++L
Sbjct: 384 TSILAQAKQL 393


>gi|154250151|ref|YP_001410976.1| flagellin domain-containing protein [Fervidobacterium nodosum
           Rt17-B1]
 gi|154154087|gb|ABS61319.1| flagellin domain protein [Fervidobacterium nodosum Rt17-B1]
          Length = 391

 Score =  169 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 26/381 (6%), Positives = 83/381 (21%), Gaps = 33/381 (8%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +             + D  K  E + +G   +      A +    +   +   + 
Sbjct: 1   MRINHNLSALNAWRQITLTDSDMKKSLERLSSGLRINRASDDAAGLAISEKMRGQVKGLE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               +       + T++  L+ +  I+Q M    V        +         +    + 
Sbjct: 61  MASKNAQDAISLIQTAEGALNEIHAILQRMRELAVQAATDTNTDVDRWNIQAEIDQLRDE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               +  T+         N             +         +        +     +  
Sbjct: 121 IDRISRATEFNTKKLLNGNLEGFRAAPDAKVVAEGNIDLKVSIASSYVSVVEGTYILEIG 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           +        +   +  +++  +      N               +T   +++        
Sbjct: 181 QFQGTTTSNLDARVVLIKNNGTTVATVKNYTVGYVTIGGIKVTWNTTRFNINQFGGALPK 240

Query: 244 RDIMFVAVIGTEFLSKNLTD---------------------------------GARNVLT 270
             ++   V   E L+                                             
Sbjct: 241 ETVIDTGVARVEGLNTTGNQLIFQIGANEGANMVAGIDAVDSKNLGLITTVLKVTSQNAA 300

Query: 271 KKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQ 330
           ++ +S +   +  +   R+ LG  +  +      L      +    S+    +       
Sbjct: 301 ERAISVIDGAIHKVSSIRSQLGAIQNRLEHTIANLGVAAENLTAAESRIRDADMAKEMMA 360

Query: 331 LSTLINKIEMSYMITTKLQKL 351
            +     ++    +  +   L
Sbjct: 361 FTKQQILMQSGMAMLAQSNGL 381


>gi|15642187|ref|NP_231819.1| flagellin [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121586233|ref|ZP_01676023.1| flagellin core protein A [Vibrio cholerae 2740-80]
 gi|121726531|ref|ZP_01679780.1| flagellin core protein A [Vibrio cholerae V52]
 gi|147674518|ref|YP_001217705.1| flagellin [Vibrio cholerae O395]
 gi|153817119|ref|ZP_01969786.1| flagellin core protein A [Vibrio cholerae NCTC 8457]
 gi|153820885|ref|ZP_01973552.1| flagellin core protein A [Vibrio cholerae B33]
 gi|227082312|ref|YP_002810863.1| flagellin core protein A [Vibrio cholerae M66-2]
 gi|229507734|ref|ZP_04397239.1| flagellin protein FlaC [Vibrio cholerae BX 330286]
 gi|229512071|ref|ZP_04401550.1| flagellin protein FlaC [Vibrio cholerae B33]
 gi|229519207|ref|ZP_04408650.1| flagellin protein FlaC [Vibrio cholerae RC9]
 gi|229607238|ref|YP_002877886.1| flagellin [Vibrio cholerae MJ-1236]
 gi|255747112|ref|ZP_05421057.1| flagellin protein FlaC [Vibrio cholera CIRS 101]
 gi|262161344|ref|ZP_06030454.1| flagellin protein FlaC [Vibrio cholerae INDRE 91/1]
 gi|262167785|ref|ZP_06035487.1| flagellin protein FlaC [Vibrio cholerae RC27]
 gi|298500433|ref|ZP_07010238.1| flagellin core protein A [Vibrio cholerae MAK 757]
 gi|172044515|sp|P0C6C3|FLAA_VIBCH RecName: Full=Flagellin A; AltName: Full=Flagellin core protein
 gi|172047624|sp|A5F672|FLAA_VIBC3 RecName: Full=Flagellin A; AltName: Full=Flagellin core protein
 gi|2443635|gb|AAC33160.1| flagellin core protein A [Vibrio cholerae]
 gi|9656743|gb|AAF95333.1| flagellin core protein A [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121549499|gb|EAX59525.1| flagellin core protein A [Vibrio cholerae 2740-80]
 gi|121630984|gb|EAX63363.1| flagellin core protein A [Vibrio cholerae V52]
 gi|126512387|gb|EAZ74981.1| flagellin core protein A [Vibrio cholerae NCTC 8457]
 gi|126521677|gb|EAZ78900.1| flagellin core protein A [Vibrio cholerae B33]
 gi|146316401|gb|ABQ20940.1| flagellin core protein A [Vibrio cholerae O395]
 gi|227010200|gb|ACP06412.1| flagellin core protein A [Vibrio cholerae M66-2]
 gi|227014084|gb|ACP10294.1| flagellin core protein A [Vibrio cholerae O395]
 gi|229343896|gb|EEO08871.1| flagellin protein FlaC [Vibrio cholerae RC9]
 gi|229352036|gb|EEO16977.1| flagellin protein FlaC [Vibrio cholerae B33]
 gi|229355239|gb|EEO20160.1| flagellin protein FlaC [Vibrio cholerae BX 330286]
 gi|229369893|gb|ACQ60316.1| flagellin protein FlaC [Vibrio cholerae MJ-1236]
 gi|255735514|gb|EET90914.1| flagellin protein FlaC [Vibrio cholera CIRS 101]
 gi|262023850|gb|EEY42549.1| flagellin protein FlaC [Vibrio cholerae RC27]
 gi|262028655|gb|EEY47309.1| flagellin protein FlaC [Vibrio cholerae INDRE 91/1]
 gi|297541126|gb|EFH77180.1| flagellin core protein A [Vibrio cholerae MAK 757]
          Length = 379

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 37/370 (10%), Positives = 93/370 (25%), Gaps = 20/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           +   +     E + +G   +      A +        +   
Sbjct: 1   MTINVNTNVSAMTAQRYLTKATGELNTSMERLSSGNRINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTSILQRMRDLALQSANGTNSASERQALNEESVALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +         +S +A Q
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGEASFQIGSSSGEAIIMGLTSVRADDFRMGGQSFIAEQ 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D   +   K  +         +  D        + +     A+V+  
Sbjct: 181 PKTKEWGVPPTARDLKFEFTKKDGEAVVLDIIAKDGDDIEELATYINGQTDLFKASVDQE 240

Query: 242 --------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
                               G+   + +        +    D      ++  +  +   L
Sbjct: 241 GKLQIFVAEPNIEGNFNISGGLATELGLNGGPGVKTTVQDIDITSVGGSQNAVGIIDAAL 300

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +  QRA LG  +  ++     L N    ++   S+    +      QL+      +  
Sbjct: 301 KYVDSQRADLGAKQNRLSHSISNLSNIQENVEASKSRIKDTDFAKETTQLTKSQILQQAG 360

Query: 342 YMITTKLQKL 351
             I  + ++L
Sbjct: 361 TSILAQAKQL 370


>gi|295401180|ref|ZP_06811153.1| flagellar hook-associated protein 3 [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294976773|gb|EFG52378.1| flagellar hook-associated protein 3 [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 304

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 34/354 (9%), Positives = 97/354 (27%), Gaps = 51/354 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++   +   M        +   K  E++VTG+               + + ++   + 
Sbjct: 1   MRVTQFMLANNMLRNLSNSYERLGKYQEQLVTGKKISRPSDDPVVAMKGIAYREDLARVK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +   V   + ++   L  +   +Q +   +V               A  +    + 
Sbjct: 61  QYQRNIGEVHNWIDSADDALDKVGLALQRVQELVVQASTDTATPEDRKKIADEIEQIQKH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V  AN    G+Y+F+G ++      GY         + +                    
Sbjct: 121 IVDVANTKVGGKYIFNGADTKNPLFIGYPDGMGGLGLNPN-------------------- 160

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
             ++ +  ++  F     D   + +                     +  D +   +    
Sbjct: 161 --ANTSDVEIEVFDGIKLDVNINGKELFAGTIGQDGIVRLLEKIKNDLRDGTKTGDD--- 215

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                                         L  ++     ++  R+ LG  +  +     
Sbjct: 216 --------------------------IDGYLGKIEAQQDALLAARSELGAKQNRVEMMEN 249

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L  +  I    +S +  +E       L T  +   ++  +  ++ + +++++L
Sbjct: 250 RLSTQEVIATKLMSNNEDIEYEKTITDLITQESVHRVALSVGARIIQPTLVDFL 303


>gi|254225809|ref|ZP_04919414.1| flagellin core protein A [Vibrio cholerae V51]
 gi|125621715|gb|EAZ50044.1| flagellin core protein A [Vibrio cholerae V51]
          Length = 379

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 38/370 (10%), Positives = 95/370 (25%), Gaps = 20/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           +   D     E + +G   +      A +        +   
Sbjct: 1   MTINVNTNVSAMTAQRYLTKATGDLNTSMERLSSGNRINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G   +++        R   
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTSILQRMRDLALQSANGTNSDSERQALDEESRALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +         +S ++ Q
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGEASFQIGSSSGEAIIMGLTSVRADDFRMGGQSFVSEQ 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D   +   K  +         +  D        + +     A+V+  
Sbjct: 181 AKTKEWGVPPTARDLKFEFTKKDGEAVVLDIMAKDGDDIEELATYINGQTDLFKASVDEE 240

Query: 242 --------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
                               G+   + +        +    D      ++  +  +   L
Sbjct: 241 GKLQIFVAEPNIEGNFNISGGLATELGLNGGPGVKTTVQDIDITSVGGSQNAVGIIDAAL 300

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +  QRA LG  +  ++     L N    ++   S+    +      QL+      +  
Sbjct: 301 KYVDSQRADLGAKQNRLSHSISNLSNIQENVEASKSRIKDTDFAKETTQLTKSQILQQAG 360

Query: 342 YMITTKLQKL 351
             I  + ++L
Sbjct: 361 TSILAQAKQL 370


>gi|15643521|ref|NP_228567.1| flagellin [Thermotoga maritima MSB8]
 gi|4981286|gb|AAD35840.1|AE001746_1 flagellin [Thermotoga maritima MSB8]
          Length = 387

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 26/378 (6%), Positives = 79/378 (20%), Gaps = 30/378 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +           +      K  E + +G   +      A +    +   +   + 
Sbjct: 1   MRINHNISALNAWRNISQTQYSMSKTLERLSSGLRINRAGDDAAGLAISEKMRGQIKGLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
             + +       + T++  L+ +  I+Q M    V        +         +    E 
Sbjct: 61  MAIKNAQDAISLIQTAEGALTEVHSILQRMRELAVQAASDTNTDVDREQIQKEIDQLREE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A  T+                       +    +               ++     
Sbjct: 121 IDRIARTTEFNTKKLLDGKLESFRSQVDAKVVTGGNINVQLGSVSSAAVEGTYVIEVGQF 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVS-------- 235
             +  +   +   +       +         +   + N  +        D          
Sbjct: 181 NGAETSELDVKITLFTAGGYSTTVVTITVGSATVGNINFTWDTDVLSINDFGGALPKNEV 240

Query: 236 ------------ANVNMRGIRDIMFVAVIGTEFLSKNLT----------DGARNVLTKKM 273
                        + +    +            +               D       ++ 
Sbjct: 241 VDSAVVRVEAIYTSASQLIFQIGANEGHNMVAGIDDMSAAALGLTTVSLDVTTQDAAERA 300

Query: 274 LSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLST 333
           +  V   +  +   RA LG  +  +      L      +    S+    +      + + 
Sbjct: 301 IMVVDAAIHRVSTARAALGAVQNRLEHTISNLGVAAENLTAAESRIRDADMAKEMMEFTK 360

Query: 334 LINKIEMSYMITTKLQKL 351
               ++ S  +  +   L
Sbjct: 361 QQILLQSSMAMLAQSNTL 378


>gi|153213626|ref|ZP_01948899.1| flagellin core protein A [Vibrio cholerae 1587]
 gi|153825341|ref|ZP_01978008.1| flagellin core protein A [Vibrio cholerae MZO-2]
 gi|183179573|ref|ZP_02957784.1| flagellin core protein A [Vibrio cholerae MZO-3]
 gi|229513833|ref|ZP_04403295.1| flagellin protein FlaC [Vibrio cholerae TMA 21]
 gi|229522138|ref|ZP_04411555.1| flagellin protein FlaC [Vibrio cholerae TM 11079-80]
 gi|229524184|ref|ZP_04413589.1| flagellin protein FlaC [Vibrio cholerae bv. albensis VL426]
 gi|254286496|ref|ZP_04961453.1| flagellin core protein A [Vibrio cholerae AM-19226]
 gi|262191681|ref|ZP_06049857.1| flagellin protein FlaC [Vibrio cholerae CT 5369-93]
 gi|297580835|ref|ZP_06942760.1| flagellin core protein A [Vibrio cholerae RC385]
 gi|124115825|gb|EAY34645.1| flagellin core protein A [Vibrio cholerae 1587]
 gi|149741025|gb|EDM55094.1| flagellin core protein A [Vibrio cholerae MZO-2]
 gi|150423445|gb|EDN15389.1| flagellin core protein A [Vibrio cholerae AM-19226]
 gi|183012984|gb|EDT88284.1| flagellin core protein A [Vibrio cholerae MZO-3]
 gi|229337765|gb|EEO02782.1| flagellin protein FlaC [Vibrio cholerae bv. albensis VL426]
 gi|229341063|gb|EEO06068.1| flagellin protein FlaC [Vibrio cholerae TM 11079-80]
 gi|229349014|gb|EEO13971.1| flagellin protein FlaC [Vibrio cholerae TMA 21]
 gi|262032420|gb|EEY50982.1| flagellin protein FlaC [Vibrio cholerae CT 5369-93]
 gi|297534661|gb|EFH73497.1| flagellin core protein A [Vibrio cholerae RC385]
          Length = 379

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 37/370 (10%), Positives = 93/370 (25%), Gaps = 20/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           +   +     E + +G   +      A +        +   
Sbjct: 1   MTINVNTNVSAMTAQRYLTKATGELNTSMERLSSGNRINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTSILQRMRDLALQSANGTNSASERQALNEESVALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +         +S +A Q
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGEASFQIGSSSGEAIIMGLTSVRADDFRMGGQSFIAEQ 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D   +   K  +         +  D        + +     A+V+  
Sbjct: 181 PKTKEWGVPPTARDLKFEFTKKDGEAVVLDIMAKDGDDIEELATYINGQTDLFKASVDQE 240

Query: 242 --------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
                               G+   + +        +    D      ++  +  +   L
Sbjct: 241 GKLQIFVAEPNIEGNFNISGGLATELGLNGGPGVKTTVQDIDITSVGGSQNAVGIIDAAL 300

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +  QRA LG  +  ++     L N    ++   S+    +      QL+      +  
Sbjct: 301 KYVDSQRADLGAKQNRLSHSISNLSNIQENVEASKSRIKDTDFAKETTQLTKSQILQQAG 360

Query: 342 YMITTKLQKL 351
             I  + ++L
Sbjct: 361 TSILAQAKQL 370


>gi|217076162|ref|YP_002333878.1| flagellin [Thermosipho africanus TCF52B]
 gi|217036015|gb|ACJ74537.1| flagellin [Thermosipho africanus TCF52B]
          Length = 388

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 34/378 (8%), Positives = 93/378 (24%), Gaps = 30/378 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +             N +  K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINHNLSALNAWRQISLTNSNMSKTLEKLSSGLRINRAADDAAGLAISEKMRGQIKGLD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               +       + T++  L+ +  I+Q M    V        +         +    + 
Sbjct: 61  MARKNAQDAISLIQTAEGALNEVHSILQRMRELAVQAASDTNTDVDRENIQAEIEQLRQE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A  T+         N      N      +               +    L+     
Sbjct: 121 IDRIARSTEFNTKKLLNGNLESFRANPEANIVNGGIIDLTINTLNQNAKEGTYLVEVGQF 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWS---------------------------- 215
             S  +A  +   +      +S                                      
Sbjct: 181 RGSPTSALDVRITLVTTSSVYSTIVTSFAQGYVLVGGVTLRWDSTVLSISNYNGLPSGEV 240

Query: 216 -NASDHNIKYRIKDTEGIDVSANVNMRG-IRDIMFVAVIGTEFLSKNLTDGARNVLTKKM 273
            +A+   I+ +   ++ +      N    +   +         L+ +L D       +++
Sbjct: 241 IDAAVARIEGKYTGSDYLVFQIGANEGANMIGGIDAVDSKNLGLNTSLIDVTSQDGAERV 300

Query: 274 LSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLST 333
           +S +   +  +   R+ LG  +  +      L   +  + +  S+    +        + 
Sbjct: 301 ISLIDAAIDKVSGIRSKLGAMQNRLEHTIANLGVSSENLTSSESRIRDADMAKQMMFFTK 360

Query: 334 LINKIEMSYMITTKLQKL 351
               I+    +  +   L
Sbjct: 361 QQILIQSGMAMLAQANTL 378


>gi|229528806|ref|ZP_04418196.1| flagellin protein FlaC [Vibrio cholerae 12129(1)]
 gi|229332580|gb|EEN98066.1| flagellin protein FlaC [Vibrio cholerae 12129(1)]
 gi|327484709|gb|AEA79116.1| Flagellin protein FlaC [Vibrio cholerae LMA3894-4]
          Length = 379

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 37/370 (10%), Positives = 93/370 (25%), Gaps = 20/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           +   +     E + +G   +      A +        +   
Sbjct: 1   MTINVNTNVSAMTAQRYLTKATGELNTSMERLSSGNRINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTSILQRMRDLALQSANGTNSASERQALNEESVALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +         +S +A Q
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGEASFQIGSSSGEAIIMGLTSVRADDFRMGGQSFIAEQ 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D   +   K  +         +  D        + +     A+V+  
Sbjct: 181 PKTKEWGVPPTARDLKFEFTKKDGEAVVLDIMAKDGDDIEELATYINGQTDLFKASVDQE 240

Query: 242 --------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
                               G+   + +        +    D      ++  +  +   L
Sbjct: 241 GKLQIFVAEPNIEGNFNISGGLATELGLNGGPGVRTTVQDIDITSVGGSQNAVGIIDAAL 300

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +  QRA LG  +  ++     L N    ++   S+    +      QL+      +  
Sbjct: 301 KYVDSQRADLGAKQNRLSHSISNLSNIQENVEASKSRIKDTDFAKETTQLTKSQILQQAG 360

Query: 342 YMITTKLQKL 351
             I  + ++L
Sbjct: 361 TSILAQAKQL 370


>gi|2271022|gb|AAC01552.1| flagellin [Vibrio cholerae]
          Length = 379

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 37/370 (10%), Positives = 93/370 (25%), Gaps = 20/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           +   +     E + +G   +      A +        +   
Sbjct: 1   MTINVNTNVSAMTAQRYLTKATGELNTSMERLSSGNRINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTSILQRMRDLALQSANGTNSASERQALNEESVALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +         +S +A Q
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGEASFQIGSSSGEAIIMGLTSVRADDFRMGGQSFIAEQ 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D   +   K  +         +  D        + +     A+V+  
Sbjct: 181 PKTKEWGVPPTARDLKFEFTKKDGEAVVLDIIAKDGDDIEELATYINGQTDLFKASVDQE 240

Query: 242 --------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
                               G+   + +        +    D      ++  +  +   L
Sbjct: 241 GKLQIFVAEPNIEGNFNISGGLATELGLNGGPGVKTTVQDIDITSVGGSQNAVGIIDAAL 300

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +  QRA LG  +  ++     L N    ++   S+    +      QL+      +  
Sbjct: 301 KYVDSQRADLGAKQNRLSHSISNLSNIQENVEASKSRIKDTDFAKETTQLTKSHILQQAG 360

Query: 342 YMITTKLQKL 351
             I  + ++L
Sbjct: 361 TSILAQAKQL 370


>gi|114320064|ref|YP_741747.1| flagellar hook-associated protein 3 [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226458|gb|ABI56257.1| flagellar hook-associated protein 3 [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 408

 Score =  167 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 51/408 (12%), Positives = 112/408 (27%), Gaps = 54/408 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +STS +  +             K   ++ +G+         A  + ILE E+  N + 
Sbjct: 1   MRLSTSQLALQGVNSILSQQASLSKTQAQLASGRQILTPSDDPAGASRILELEKAINTVE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               +      RL  S+  L+     +Q +    V    G  D       A  LR + + 
Sbjct: 61  RYNRNADQAETRLGLSENILNEFGNTLQRVRELSVQAANGSQDRETRAYIASELRQAQDQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V  AN  D         + +            +         +  +  +    +     
Sbjct: 121 LVQLANTDDGNGEFLFAGSETRTQPFTKTAGGKVVYNGDQGQREVRIGPSRTLAVDSSGF 180

Query: 184 EV---------------SSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKD 228
           +                +  N+      +          E +   +       + YR+ D
Sbjct: 181 DAFMKIPNGNGDYQAREAQGNSGSGIITVGDSPALVQPGEAYTIAFEQDGAGGMTYRVLD 240

Query: 229 TEGIDVSANVNMRGI---------------------------------------RDIMFV 249
            +   V+ +                                             + +   
Sbjct: 241 GDDQPVAVDGEPVTGPYEPGMTLRFPAESGQSLQVKLDGRPEEGDRFEVSAARPQSVFET 300

Query: 250 AVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKN 309
                  L  +    A N    + L+ + QG+  II  R+ LG     ++  R   +   
Sbjct: 301 VNNLIRTLEDDGDGPALNNAVNRFLADIDQGMENIIRVRSELGARLNTLDASRDANEGAL 360

Query: 310 NIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             ++   S+   ++   A  + +  +  ++ +    T+LQ LS+  ++
Sbjct: 361 LDLNAAKSRLADLDYAEATGRFNQELVGLQAAQQTYTRLQGLSLFEFI 408


>gi|150388563|ref|YP_001318612.1| flagellar hook-associated protein 3 [Alkaliphilus metalliredigens
           QYMF]
 gi|149948425|gb|ABR46953.1| flagellar hook-associated protein 3 [Alkaliphilus metalliredigens
           QYMF]
          Length = 318

 Score =  167 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 38/354 (10%), Positives = 99/354 (27%), Gaps = 37/354 (10%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + +   M            +   +  TG+           ++  L+   +   + 
Sbjct: 1   MRITNNMMISSMMQNLNGNLLRMDQKQLQATTGKRIHKPSDDPIGISRSLKLRSDIKELE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       L T++  + ++   V+ +    V    G    ++       + +    
Sbjct: 61  QYKKNVDDTISWLETTELAVHNVGAAVERLRELTVQASNGVLTEDETKKIKAEVVELKNQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            ++  N T  G+Y+FSG  + +K  N                                  
Sbjct: 121 IISLGNTTYGGKYVFSGKKTDQKLFNDAGEY----------------------------- 151

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
                    +++          DD+   N     +        +   G +VS   ++ G+
Sbjct: 152 --------NVSNLSIDHAPDAIDDKIKFNVGMGETIEINVVGFELFGGDEVSHEDDVVGV 203

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                  +I      +   +          L  +          R+ +G     +     
Sbjct: 204 EGGEQAGIIKMIEDIEAKLEAGDTAGLTDDLQNIDIYYDQYSTIRSEIGAKVNRMELVEN 263

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            + +    +    SK    +    + QL    N    S  I +++ + +++++L
Sbjct: 264 RIVDDRLNLMELQSKIEDADVAEVYMQLMAEENVYRSSLAIGSRIIQPTLMDFL 317


>gi|188586840|ref|YP_001918385.1| flagellin domain protein [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179351527|gb|ACB85797.1| flagellin domain protein [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 383

 Score =  167 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 37/372 (9%), Positives = 97/372 (26%), Gaps = 26/372 (6%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+      +   ++ N++  K  E + +GQ  +      A ++   +   + + + 
Sbjct: 1   MRINTNIEALNAHRNLEQTNQNMQKNLERLSSGQRINRAADDAAGLSISEKMRGQVSGLD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +       + T++  L     I+Q M    V        +         +    E 
Sbjct: 61  QAVRNAQDSISLIQTAEGALEESHSILQRMRELAVQSANDTNIDADRGEIQEEIDQLAEE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                  T+         + +     G     +L     +            +    +  
Sbjct: 121 LHRIEETTEFNTQNLVDGDFAGTFHIGANEGQNLQLNIDNMGASELGVGEEYTATNDEAD 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNA-------------------------- 217
                 A   T  + +L++          +                              
Sbjct: 181 LDEIAVADGETYEVVELDETLDGVFDGNGDAHYGLVNNEGEYVALADDEAQEFEFLDDAE 240

Query: 218 SDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTV 277
           +D +     + ++      N   RG   I        E  ++   +        + ++ +
Sbjct: 241 ADLDEIGSDEVSDESVDFGNTVDRGSVTIEENDEGEIEATARMGIEVDEQESADEAITDI 300

Query: 278 QQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINK 337
              +  +  QR+ LG  +  +      L   +  +    S+   V+        ST    
Sbjct: 301 DNAIDTVSSQRSELGALQNRLEHTINNLSVASENLSAAESRIRDVDMAEEMMDFSTQQVL 360

Query: 338 IEMSYMITTKLQ 349
            E    +  +  
Sbjct: 361 EEAGTAMMAQAN 372


>gi|258621057|ref|ZP_05716091.1| Flagellin A [Vibrio mimicus VM573]
 gi|258586445|gb|EEW11160.1| Flagellin A [Vibrio mimicus VM573]
          Length = 402

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 36/370 (9%), Positives = 92/370 (24%), Gaps = 20/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           +   +     E + +G   +      A +        +   
Sbjct: 24  MTINVNTNVSAMTAQRYLNKATGELNTSMERLSSGNRINSAKDDAAGLQISNRLTAQSRG 83

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q +    +    G     +            
Sbjct: 84  LDVAMRNANDGISIAQTAEGAMNESTSILQRIRDLALQSANGTNSTAERQALNEEATALQ 143

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +         +S +A Q
Sbjct: 144 DELNRIAETTSFGGRKLLNGSFGEASFQIGSSSGEAIIMGLTSVRADDFRMGGQSFVAEQ 203

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D   +   K  +         +  D        + +     A+V+  
Sbjct: 204 AKTKEWGVPPTARDLKFEFTKKDGEAVVLDIMAKDGDDIEELATYINGQTDLFKASVDQE 263

Query: 242 --------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
                               G+   + +        +    D      ++  +  +   L
Sbjct: 264 GKLQVFVAEPNIQGNFNISGGLATELGLNGGPGVKTTVKDIDITSVGGSQNAVGIIDAAL 323

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +  QRA LG  +  ++     L N    ++   S+    +      QL+      +  
Sbjct: 324 KYVDSQRADLGAKQNRLSHSISNLSNIQENVEASKSRIKDTDFAKETTQLTKSQILQQAG 383

Query: 342 YMITTKLQKL 351
             I  + ++L
Sbjct: 384 TSILAQAKQL 393


>gi|258626881|ref|ZP_05721686.1| Flagellin A [Vibrio mimicus VM603]
 gi|258580837|gb|EEW05781.1| Flagellin A [Vibrio mimicus VM603]
          Length = 402

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 36/370 (9%), Positives = 92/370 (24%), Gaps = 20/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           +   +     E + +G   +      A +        +   
Sbjct: 24  MTINVNTNVSAMTAQRYLNKATGELNTSMERLSSGNRINSAKDDAAGLQISNRLTAQSRG 83

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q +    +    G     +            
Sbjct: 84  LDVAMRNANDGISIAQTAEGAMNESTSILQRIRDLALQSANGTNSTAERQALNEEATALQ 143

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +         +S +A Q
Sbjct: 144 DELNRIAETTSFGGRKLLNGSFGEASFQIGSSSGEAIIMGLTSVRADDFRMGGQSFVAEQ 203

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D   +   K  +         +  D        + +     A+V+  
Sbjct: 204 AKTKEWGVPPTARDLKFEFTKKDGEAVVLDIMAKDGDDIEELATYINGQTDLFKASVDQD 263

Query: 242 --------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
                               G+   + +        +    D      ++  +  +   L
Sbjct: 264 GKLQVFVAEPNIQGNFNISGGLATELGLNGGPGVKTTVKDIDITSVGGSQNAVGIIDAAL 323

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +  QRA LG  +  ++     L N    ++   S+    +      QL+      +  
Sbjct: 324 KYVDSQRADLGAKQNRLSHSISNLSNIQENVEASKSRIKDTDFAKETTQLTKSQILQQAG 383

Query: 342 YMITTKLQKL 351
             I  + ++L
Sbjct: 384 TSILAQAKQL 393


>gi|148269315|ref|YP_001243775.1| flagellin domain-containing protein [Thermotoga petrophila RKU-1]
 gi|147734859|gb|ABQ46199.1| flagellin domain protein [Thermotoga petrophila RKU-1]
          Length = 387

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 27/378 (7%), Positives = 76/378 (20%), Gaps = 30/378 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +           +      K  E + +G   +      A +    +   +   + 
Sbjct: 1   MRINHNISALNAWRNIDQTQYSMSKTLERLSSGLRINRAGDDAAGLAISEKMRGQIKGLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
             + +       + T++  L+ +  I+Q M    V        N         +    E 
Sbjct: 61  MAIKNAQDAISLIQTAEGALTEVHSILQRMRELAVQAASDTNTNVDREQIQKEIDQLREE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A  T+                       +    +               ++     
Sbjct: 121 IDRIARTTEFNTKKLLDGKLEGFRSQVDAKVVTGGNINVQLGTVSSKAVEGTYVIEVGQF 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVS-------- 235
             +  +   +   +       S         +       K+        D          
Sbjct: 181 NGTETSQLDVKITLFTAGGYSSTVVTITAGSATLGGITFKWDTNVLSINDFGGALPKNEV 240

Query: 236 ------------ANVNMRGIRDIMFVAVIGTEFLSKNLTDG----------ARNVLTKKM 273
                          +    +            +                       ++ 
Sbjct: 241 VDSAVVRVEAIYTAASQLIFQIGANEGHNMVAGIDNMSASALGLTTISLKVTTQDAAERA 300

Query: 274 LSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLST 333
           +  V   +  +   RA LG  +  +      L      +    S+    +      + + 
Sbjct: 301 IMVVDAAIHRVSTARAALGAIQNRLEHTISNLGVAAENLTAAESRIRDADMAKEMMEFTK 360

Query: 334 LINKIEMSYMITTKLQKL 351
               ++ S  +  +   L
Sbjct: 361 QQILLQSSMAMLAQSNTL 378


>gi|312135424|ref|YP_004002762.1| flagellar hook-associated protein 3 [Caldicellulosiruptor
           owensensis OL]
 gi|311775475|gb|ADQ04962.1| flagellar hook-associated protein 3 [Caldicellulosiruptor
           owensensis OL]
          Length = 315

 Score =  166 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 42/354 (11%), Positives = 102/354 (28%), Gaps = 41/354 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + +     I   +       +  +M TG+   Y           L    + + I 
Sbjct: 1   MRITNNMMVNNFLINLNKNLSRLDDIQYKMATGKKIRYPSDDPVVTARSLRLRTDVSEIE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       +  +++ L+ + + +Q +    V    G          A  +    + 
Sbjct: 61  QLQKNVDDAISWVDITESALADITENLQRVRELTVRGANGTNTKEDMAQIAKEVAQIKQH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +   N    G+Y+FSG  +   P+N   +                   ++ S  +    
Sbjct: 121 IIQVGNTNYAGRYIFSGFKTDTAPINPDGSF-----------------SDTGSFTSSGGY 163

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
            +       +  F                         +            +    ++G 
Sbjct: 164 PIDLSTGNNIIQF------------------------ELMKANYIGINKTANQIFYIQGE 199

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
            D     +        N  +         +LS + + +  ++ QR  +G  +  +   + 
Sbjct: 200 ADENKGNLFKVLDNLINALESGDVNTVNSLLSNIDRHIDNVVAQRGDVGALQNRLELIKN 259

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L + N    T +S +  V+      QL T  N    +     ++   ++L++L
Sbjct: 260 RLSDDNVNFTTLLSNNEDVDMAEIIMQLKTAENVYRAALQTGAQILPPTLLDFL 313


>gi|261211314|ref|ZP_05925602.1| flagellin protein FlaC [Vibrio sp. RC341]
 gi|260839269|gb|EEX65895.1| flagellin protein FlaC [Vibrio sp. RC341]
          Length = 379

 Score =  165 bits (417), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 37/370 (10%), Positives = 96/370 (25%), Gaps = 20/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           +   D     E + +G   +      A +        +   
Sbjct: 1   MTINVNTNVSAMTAQRYLTKATGDLNTSMERLSSGNRINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G   +++        +   
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTSILQRMRDLALQSANGTNSDSERQALDEESKALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +         +S ++ Q
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGEASFQIGSSSGEAIIMGLTSVRADDFRMGGQSFVSEQ 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D   +   K  +      +  +  D        + +     A+V+  
Sbjct: 181 AKTKEWGVPPTARDLKFEFTKKDGEAVVLDISAKSGDDIEELATYINGQTDLFKASVDQD 240

Query: 242 --------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
                               G+   + +        +    D      ++  +  +   L
Sbjct: 241 GKLQIFVSEPNVQGNFNISGGLATELGLNGGPGVKTTVQDIDITSVGGSQNAVGIIDAAL 300

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +  QRA LG  +  ++     L N    ++   S+    +      QL+      +  
Sbjct: 301 KYVDSQRADLGAKQNRLSHSISNLSNIQENVEASKSRIKDTDFAKETTQLTKSQILQQAG 360

Query: 342 YMITTKLQKL 351
             I  + ++L
Sbjct: 361 TSILAQAKQL 370


>gi|83647166|ref|YP_435601.1| flagellar hook-associated protein FlgL [Hahella chejuensis KCTC
           2396]
 gi|83635209|gb|ABC31176.1| Flagellin and related hook-associated protein [Hahella chejuensis
           KCTC 2396]
          Length = 412

 Score =  165 bits (417), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 43/412 (10%), Positives = 105/412 (25%), Gaps = 58/412 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST  +F R      ++     K   ++ +G+            T IL+  QE + I 
Sbjct: 1   MRISTQQLFNRGLDNILDVTSQLQKTQLQISSGRRVLTPADDPVASTRILQINQELSLID 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + +L   RLS     L  + +++Q +    V   +G  + +     A  ++     
Sbjct: 61  QYKSNINLAENRLSLEDGLLDGVGEVIQRLRELTVQAGDGSQNADDKKFIAAEVQQRLSQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V   N  D            ++         +      +      ++ N          
Sbjct: 121 LVGMLNTKDPSGEYIFAGFQGKQEPFQLNAAGAYRYVGDEGRRFMQIDANVSVAAGDNGK 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG- 242
           EV          F  Q   + + +           D  +       + + V  +      
Sbjct: 181 EVFVNIKSANNTFYTQASPRNTAEPPAIITQGQMIDQELYDAFYPEDMVVVFNDETDVVP 240

Query: 243 --------------------------------------------------IRDIMFVAVI 252
                                                               +   +   
Sbjct: 241 PAPNYSIVQRSDGKPVLNNQRYATGQPIQVQGVQFEIIGSPQPGDTFFVQSSEKQGLLTT 300

Query: 253 GTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQ-------RAVLGISEKNINEERVFL 305
                             + +   +   L+            R+ LG     I++ +   
Sbjct: 301 VERLAEGLEDYQDTPAGRQTLTDLLDSTLANFTNAETKLLETRSRLGARLNTIDDTKQLH 360

Query: 306 QNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           ++   +    +S+   ++   A + L+     ++ +    +++  LS+ + L
Sbjct: 361 EDVEVLTKEVLSELQDLDYAEAVSNLTLQNFVLQAAQQSYSRVTSLSLFDLL 412


>gi|281411987|ref|YP_003346066.1| flagellin domain protein [Thermotoga naphthophila RKU-10]
 gi|281373090|gb|ADA66652.1| flagellin domain protein [Thermotoga naphthophila RKU-10]
          Length = 387

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 27/378 (7%), Positives = 76/378 (20%), Gaps = 30/378 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +           +      K  E + +G   +      A +    +   +   + 
Sbjct: 1   MRINHNISALNAWRNIDQTQYSMSKTLERLSSGLRINRAGDDAAGLAISEKMRGQIKGLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
             + +       + T++  L+ +  I+Q M    V        N         +    E 
Sbjct: 61  MAIKNAQDAISLIQTAEGALTEVHSILQRMRELAVQAASDTNTNVDREQIQKEIDQLREE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A  T+                       +    +               ++     
Sbjct: 121 IDRIARTTEFNTKKLLDGKLEGFRSQVDAKVVTGGNINVQLGTVSSKAVEGTYVIEVGQF 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVS-------- 235
             +  +   +   +       S         +       K+        D          
Sbjct: 181 NGTETSQLDVKITLFTAGGYSSTVVTITAGSATLGGITFKWDTNVLSINDFGGALPKNEV 240

Query: 236 ------------ANVNMRGIRDIMFVAVIGTEFLSKNLTDG----------ARNVLTKKM 273
                          +    +            +                       ++ 
Sbjct: 241 VDSAVVRVEAIYTAASQLIFQIGANEGHNMVAGIDDMSAAALGLTTTSLKVTTQDAAERA 300

Query: 274 LSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLST 333
           +  V   +  +   RA LG  +  +      L      +    S+    +      + + 
Sbjct: 301 IMVVDAAIHRVSTARAALGAIQNRLEHTISNLGVAAENLTAAESRIRDADMAKEMMEFTK 360

Query: 334 LINKIEMSYMITTKLQKL 351
               ++ S  +  +   L
Sbjct: 361 QQILLQSSMAMLAQSNTL 378


>gi|262404532|ref|ZP_06081087.1| flagellin protein FlaC [Vibrio sp. RC586]
 gi|262349564|gb|EEY98702.1| flagellin protein FlaC [Vibrio sp. RC586]
          Length = 379

 Score =  165 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 36/370 (9%), Positives = 93/370 (25%), Gaps = 20/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           +   +     E + +G   +      A +        +   
Sbjct: 1   MTINVNTNVSAMTAQRYLTKATGELNTSMERLSSGNRINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTSILQRMRDLALQSANGTNSASERQALNEESVALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +         +S ++ Q
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGEASFQIGSSSGEAIIMGLTSVRADDFRMGGQSFVSEQ 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D   +   K  +         +  D        + +     A+V+  
Sbjct: 181 AKTKEWGVPPTARDLKFEFTKKDGEAVVLDIMAKDGDDIEELATYINGQTDLFKASVDQD 240

Query: 242 --------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
                               G+   + +        +    D      ++  +  +   L
Sbjct: 241 GKLQIFVSEPNVQGDFNISGGLATELGLNGGPGVKTTVQDIDITSVGGSQNAVGIIDAAL 300

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +  QRA LG  +  ++     L N    ++   S+    +      QL+      +  
Sbjct: 301 KYVDSQRADLGAKQNRLSHSISNLSNIQENVEASKSRIKDTDFAKETTQLTKSQILQQAG 360

Query: 342 YMITTKLQKL 351
             I  + ++L
Sbjct: 361 TSILAQAKQL 370


>gi|262170833|ref|ZP_06038511.1| flagellin protein FlaC [Vibrio mimicus MB-451]
 gi|261891909|gb|EEY37895.1| flagellin protein FlaC [Vibrio mimicus MB-451]
          Length = 379

 Score =  165 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 36/370 (9%), Positives = 92/370 (24%), Gaps = 20/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           +   +     E + +G   +      A +        +   
Sbjct: 1   MTINVNTNVSAMTAQRYLNKATGELNTSMERLSSGNRINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q +    +    G     +            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTSILQRIRDLALQSANGTNSTAERQALNEEATALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +         +S +A Q
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGEASFQIGSSSGEAIIMGLTSVRADDFRMGGQSFVAEQ 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D   +   K  +         +  D        + +     A+V+  
Sbjct: 181 AKTKEWGVPPTARDLKFEFTKKDGEAVVLDIMAKDGDDIEELATYINGQTDLFKASVDQD 240

Query: 242 --------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
                               G+   + +        +    D      ++  +  +   L
Sbjct: 241 GKLQVFVAEPNIQGNFNISGGLATELGLNGGPGVKTTVKDIDITSVGGSQNAVGIIDAAL 300

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +  QRA LG  +  ++     L N    ++   S+    +      QL+      +  
Sbjct: 301 KYVDSQRADLGAKQNRLSHSISNLSNIQENVEASKSRIKDTDFAKETTQLTKSQILQQAG 360

Query: 342 YMITTKLQKL 351
             I  + ++L
Sbjct: 361 TSILAQAKQL 370


>gi|88799030|ref|ZP_01114611.1| Flagellin and related hook-associated protein [Reinekea sp. MED297]
 gi|88778257|gb|EAR09451.1| Flagellin and related hook-associated protein [Reinekea sp. MED297]
          Length = 418

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 36/417 (8%), Positives = 102/417 (24%), Gaps = 61/417 (14%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST   F+R       L  +  K  E++ +G+              +L+ +QE   
Sbjct: 1   MVDRVSTYWTFQRPVNDMLRLQSNLNKTSEQIASGKKMLSPADDPVGAARVLQLDQEIAL 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGK-TDNNKFPINAGMLRDS 120
           + +   + +L+  RL   +  L  +  ++Q +    V          ++    A  L + 
Sbjct: 61  LNQYERNITLLDSRLEQEEGVLDGVTSVLQRVRELTVQAGNAAVYSESERQAIALELDER 120

Query: 121 YESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
            +     AN  D            EK             +  + +    +          
Sbjct: 121 LKELFDLANSRDGSGEYLFSGFQGEKQTFVQNPGGGYGYQGDEGVRFLQISRTITMASGD 180

Query: 181 QHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNI------------------ 222
              ++       +  F     ++   +     +     D                     
Sbjct: 181 TGKDIFMDVPATVPSFNSYASNENRGNPPGIISQGITVDQEALDEFFPENAVITFENPLD 240

Query: 223 --------------KYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNV 268
                           R+ D        + +  G   +    +       + + + + + 
Sbjct: 241 VDPPRKNYTVRQKSDGRVIDGLENIPYNSGSPIGFAGMNVNVIGNPAPGDQFIVETSPSQ 300

Query: 269 LTKKMLSTVQQGLS----------------------------GIIEQRAVLGISEKNINE 300
                +  +   L+                             + + RA +G        
Sbjct: 301 NMMVTVEKLTFALNNYSTSPEFSDVYDTAISNTLENIDNALQNVSQVRARIGARLNTTEN 360

Query: 301 ERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
                 +         +    ++   A ++L      ++ +        +L++ +++
Sbjct: 361 TANQHADNKLAAQDIRADIRDLDYAEAVSRLQLEEFILQATQQSFATTTQLNLFDFI 417


>gi|146296675|ref|YP_001180446.1| flagellar hook-associated protein FlgL [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410251|gb|ABP67255.1| flagellar hook-associated protein 3 [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 315

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 43/354 (12%), Positives = 99/354 (27%), Gaps = 41/354 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + +     I   +       +  +M TG+   Y           L    + + I 
Sbjct: 1   MRITNNMMVNNFLINLNKNLNRLDDIQYKMATGKKIRYPSDDPVVTARSLRLRTDVSEIE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T+++ L+ + + +Q +    V    G          A  +    + 
Sbjct: 61  QLQKNVDDAMSWVDTTESALADINESLQRVRELAVRGANGTNTKEDMAQIAKEVAQIKQH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +   N    G+Y+FSG  +   PLN                                  
Sbjct: 121 IIQIGNTNYAGRYIFSGFKTDTAPLN---------------------------------- 146

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
                     +                 +   N     +            +    ++G 
Sbjct: 147 -------SDGSFSDTGNFASNGGYPVDLSTGKNIIQFELMKANYININKTANQIFYIQGE 199

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
            D     +        N  +         +LS + + +  ++ QR  +G  +  +   + 
Sbjct: 200 ADENKGNLFKVLDNLINALESGDVTTVNSLLSDIDRHIDNVVAQRGDVGALQNRLELIKN 259

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L ++N    T +S +  V+      QL T  N    +     ++   ++L++L
Sbjct: 260 RLSDENVNFTTLLSNNEDVDMAEIIMQLKTAENVYRAALRTGAQILPPTLLDFL 313


>gi|222100796|ref|YP_002535364.1| Flagellin [Thermotoga neapolitana DSM 4359]
 gi|221573186|gb|ACM23998.1| Flagellin [Thermotoga neapolitana DSM 4359]
          Length = 387

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 24/378 (6%), Positives = 77/378 (20%), Gaps = 30/378 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +           +      K  E + +G   +      A +    +   +   + 
Sbjct: 1   MRINHNISALNAWRNISQTQYSMSKTLERLSSGLRINRAGDDAAGLAISEKMRGQIKGLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
             + +       + T++  L+ +  I+Q M    V        +         +    E 
Sbjct: 61  MAIKNAQDAISLIQTAEGALTEVHSILQRMRELAVQAASDTNTDVDREQIQKEIDQLREE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A  T+                       +    +               ++     
Sbjct: 121 IDRIARTTEFNTKKLLDGKLESFRSQVDAKVVTGGNINVQLGTVSSAAVEGTYVIEVGQF 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVS-------- 235
             +  +   +   +  +    S         +   +    +        D          
Sbjct: 181 SGTVTSELDVKITLFSVGGSTSKIATITAGTAALGNITFTWDTNVLSISDFGGALPSNEV 240

Query: 236 ------------ANVNMRGIRDIMFVAVIGTEFLSKNLTDG----------ARNVLTKKM 273
                          +    +            +                       ++ 
Sbjct: 241 VDSAVVRVEAVYTAASQLIFQIGANEGHNMVAGIDDMSAAALGLTTASLKVTDQDSAERT 300

Query: 274 LSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLST 333
           +  +   +  +   RA LG  +  +      L      +    S+    +      + + 
Sbjct: 301 IMVIDAAIHRVSTARAALGAIQNRLEHTISNLGVAAENLTAAESRIRDADMAKEMMEFTK 360

Query: 334 LINKIEMSYMITTKLQKL 351
               ++ S  +  +   L
Sbjct: 361 QQILLQSSMAMLAQANTL 378


>gi|312877568|ref|ZP_07737527.1| flagellar hook-associated protein 3 [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311795643|gb|EFR12013.1| flagellar hook-associated protein 3 [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 315

 Score =  164 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 44/354 (12%), Positives = 103/354 (29%), Gaps = 41/354 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + +     I   +       +  +M TG+   Y           L    + + I 
Sbjct: 1   MRITNNMMVNNFLINLNKNLSRLDDIQYKMATGKKIRYPSDDPVITARSLRLRTDVSEIE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +    T  + T+++ L+ + + +Q +    V    G          A  +    + 
Sbjct: 61  QLQKNVDDATSWVDTTESALADVNESLQRVRELAVRGANGTNTKEDMAQIAKEVAQIKQH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +   N    G+Y+FSG  +   PLN   +                   ++    +    
Sbjct: 121 IIQVGNTNYAGRYIFSGFKTDTAPLNSDGSF-----------------SDTGGFTSSGGY 163

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
            +       +  F                         +            +    ++G 
Sbjct: 164 PIDLSTGNNIIQF------------------------ELMKANYIGINKTANQIFYIQGE 199

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
            D     +        N  +         +LS + + +  ++ QR  +G  +  +   + 
Sbjct: 200 ADENKGNLFKVLDNLINALESGDVNTVNSLLSDIDRHIDNVVAQRGDVGALQNRLELIKN 259

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L + N    T +S +  V+      QL T  N    +     ++   ++L++L
Sbjct: 260 RLSDDNVNFTTLLSNNEDVDMAEIIMQLKTAENVYRAALQTGAQILPPTLLDFL 313


>gi|312793869|ref|YP_004026792.1| flagellar hook-associated protein 3 [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312181009|gb|ADQ41179.1| flagellar hook-associated protein 3 [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 315

 Score =  164 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 44/354 (12%), Positives = 103/354 (29%), Gaps = 41/354 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + +     I   +       +  +M TG+   Y           L    + + I 
Sbjct: 1   MRITNNMMVNNFLINLNKNLSRLDDIQYKMATGKKIRYPSDDPVITARSLRLRTDVSEIE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +    T  + T+++ L+ + + +Q +    V    G          A  +    + 
Sbjct: 61  QLQKNVDDATSWVDTTESALADINESLQRVRELAVRGANGTNTKEDMAQIAKEVAQIKQH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +   N    G+Y+FSG  +   PLN   +                   ++    +    
Sbjct: 121 IIQVGNTNYAGRYIFSGFKTDTAPLNSDGSF-----------------SDTGGFTSSGGY 163

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
            +       +  F                         +            +    ++G 
Sbjct: 164 PIDLSTGNNIIQF------------------------ELMKANYIGINKTANQIFYIQGE 199

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
            D     +        N  +         +LS + + +  ++ QR  +G  +  +   + 
Sbjct: 200 ADENKGNLFKVLDNLINALESGDVNTVNSLLSDIDRHIDNVVAQRGDVGALQNRLELIKN 259

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L + N    T +S +  V+      QL T  N    +     ++   ++L++L
Sbjct: 260 RLSDDNVNFTTLLSNNEDVDMAEIIMQLKTAENVYRAALQTGAQILPPTLLDFL 313


>gi|222529659|ref|YP_002573541.1| flagellar hook-associated protein FlgL [Caldicellulosiruptor bescii
           DSM 6725]
 gi|222456506|gb|ACM60768.1| flagellar hook-associated protein 3 [Caldicellulosiruptor bescii
           DSM 6725]
          Length = 315

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 43/354 (12%), Positives = 100/354 (28%), Gaps = 41/354 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + +     I   +       +  +M TG+   Y           L    + + I 
Sbjct: 1   MRITNNMMVNNFLINLNKNLSRLDDIQYKMATGKKIRYPSDNPVITARSLRLRTDVSEIE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T+++ L+ + + +Q +    V    G          A  +    + 
Sbjct: 61  QLQKNVDDAISWVDTTESALADINESLQRVRELAVRGANGTNTKEDMAQIAKEVAQIKQH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +   N    G+Y+FSG  +   P+N                                  
Sbjct: 121 IIQVGNTNYAGRYIFSGFKTDTAPIN---------------------------------- 146

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
                     +       D         +   N     +      +     +    ++G 
Sbjct: 147 -------SDGSFSDTNSFDSTGGYPIDLSTGKNIIQFELMKANYISINKIANQVFYIQGE 199

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
            D     +        N  +         +LS + + +  ++ QR  +G  +  +   + 
Sbjct: 200 TDENKGNLFKVLDNLINALESGDVTSVNSLLSDIDRHIDNVVAQRGDVGALQNRLELIKN 259

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L + N    T +S +  V+      QL T  N    +     ++   ++L++L
Sbjct: 260 RLSDDNVNFTTLLSNNEDVDMAEIIMQLKTAENVYRAALQTGAQILPPTLLDFL 313


>gi|312127298|ref|YP_003992172.1| flagellar hook-associated protein 3 [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311777317|gb|ADQ06803.1| flagellar hook-associated protein 3 [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 315

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 42/354 (11%), Positives = 99/354 (27%), Gaps = 41/354 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + +     I   +       +  +M TG+   Y           L    + + I 
Sbjct: 1   MRITNNMMINNFLINLNKNLSRLDDIQYKMATGKKIRYPSDDPVITARSLRLRTDVSEIE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +    T  ++T+++ L+ + + +Q +    V    G          A  +    + 
Sbjct: 61  QLQKNVDDATSWVNTTESALADINESLQRVRELAVRGANGTNTKEDMAQIAKEVAQIKQH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +   N    G+Y+FSG  +   P+N                                  
Sbjct: 121 IIQVGNTNYAGRYIFSGFKTDTAPIN---------------------------------- 146

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
                     +                 +   N     +            +    ++G 
Sbjct: 147 -------SDGSFSDTGDFTSTGGYPVDLSTGKNIIQFELMKANYIGINKTANQVFYIQGE 199

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
            D     +        N            +L+ + + +  ++ QR  +G  +  +   + 
Sbjct: 200 TDENKGNLFKVLDNLINALQNGDGSTVNSLLADIDRHIDNVVAQRGDIGALQNRLELIKN 259

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L + N    T +S +  V+      QL T  N    +     ++   ++L++L
Sbjct: 260 RLSDDNVNFTTLLSNNEDVDMAEIIMQLKTAENVYRAALQTGAQVLPPTLLDFL 313


>gi|227355969|ref|ZP_03840361.1| flagellin 2 [Proteus mirabilis ATCC 29906]
 gi|227163957|gb|EEI48859.1| flagellin 2 [Proteus mirabilis ATCC 29906]
          Length = 397

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 37/357 (10%), Positives = 91/357 (25%), Gaps = 8/357 (2%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+ +                   E + +G   +      A       +    N 
Sbjct: 31  MAQVINTNYLSLVTQNNLNRSQSALGNAIERLSSGMRINSAKDDAAGQAIANRFTSNING 90

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q +    V    G   N+        +    
Sbjct: 91  LTQASRNANDGISVSQTTEGALNEINNNLQRIRELTVQAKNGTNSNSDITSIQNEVNQRL 150

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  T            S+  +      + + + + D++    L   S +L   +
Sbjct: 151 DEINRVSEQTQFNGVKVLSGEKSKMTIQVGTNDNEVIEFNLDKIDNDTLGVASDNLFDAK 210

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D         +      +      D  +       +       V+  
Sbjct: 211 TEKKGVKETGAAIDAKDIGVSGGTSYLSGISVKEYKVDGKVSADKVVLKEGSDEYVVSKS 270

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVL--------TKKMLSTVQQGLSGIIEQRAVLGI 293
                        EF     T    +              L+T+   +S + E R+ LG 
Sbjct: 271 DFTLKSGTTTGEIEFTGSKTTKFTADAGKDVKILNVKDDALATLDNAISKVDESRSKLGA 330

Query: 294 SEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            +         L N  N +    S+ +  +  T  + +S      +    +  +  +
Sbjct: 331 IQNRFQSTINNLNNTVNNLSASRSRILDADYATEVSNMSKNQILQQAGTAVLAQANQ 387


>gi|260767761|ref|ZP_05876696.1| flagellin protein FlaC [Vibrio furnissii CIP 102972]
 gi|260617270|gb|EEX42454.1| flagellin protein FlaC [Vibrio furnissii CIP 102972]
 gi|315179407|gb|ADT86321.1| flagellin [Vibrio furnissii NCTC 11218]
          Length = 379

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 37/370 (10%), Positives = 99/370 (26%), Gaps = 20/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           + + +     E + +G   +      A +        +   
Sbjct: 1   MTINVNTNVSAMTAQRYLNKASNELNTSMERLSSGNRINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTSILQRMRDLSLQSANGTNSASERKALNEEVTALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +          S ++ Q
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGEASFQIGASSGEAIIMGLTSIRADDHRMGGMSFVSEQ 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +        D   +   K  +      N     D        + +     A+V+  
Sbjct: 181 GKDKNWGVPDNARDLKFEFTGKDGEPVTLNINAKTGDDIEELATYINGQTDIFKASVDQD 240

Query: 242 --------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
                               G+   + +     ++ +    D      ++  +  +   L
Sbjct: 241 GKLQIFIAQPELAEDFSISGGLASQLGLNTDNGQYTTVQDIDVNTVGGSQNAVGIIDAAL 300

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +  QRA LG  +  ++     L N    +++  S+    +      QL+      +  
Sbjct: 301 KYVDSQRADLGAKQNRLSHSISNLANIQENVESSKSRIKDTDFAKETTQLTKSQILQQAG 360

Query: 342 YMITTKLQKL 351
             I  + ++L
Sbjct: 361 TSILAQAKQL 370


>gi|253681497|ref|ZP_04862294.1| flagellar hook-associated protein 3 [Clostridium botulinum D str.
           1873]
 gi|253561209|gb|EES90661.1| flagellar hook-associated protein 3 [Clostridium botulinum D str.
           1873]
          Length = 345

 Score =  162 bits (409), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 46/354 (12%), Positives = 116/354 (32%), Gaps = 10/354 (2%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++   +        +   ++  K+ ++  +G+           V   ++   + N   
Sbjct: 1   MRVTNKMLSNNFLADMRANLENVNKIQQQNTSGKKFRKPSDDPFAVARSMQLHTDINTNK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + + V+  L T+   L     ++Q +   L+    G    ++       + +    
Sbjct: 61  QYSKNITDVSNWLDTTDTALGQAGNVLQRVRELLITSGNGGYTKSERRAIKDEINEKIGE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N    G Y+F G  S+ KP         ++K     +   ++ ++ +        
Sbjct: 121 MSQILNTNFSGNYIFGGTRSTTKP-------MDVSKNDDGNVSLNYISKDGRQYNIDNSK 173

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           +   + A     F K L +   +          +    + Y +  T+ ++     N  G 
Sbjct: 174 KPIQIEAVDKKPFDKTLVEDEYNQVTSRLKVEVSQGVTMDYNVTATDVLEFK---NEAGD 230

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
              +            +      N L  + L+ V   +S +++ RA +G  +  I     
Sbjct: 231 SINLMNLFKDITTHLDSEDPKEINKLIGEDLTKVSDTISNLLKIRAEVGAKQNRIEGAED 290

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             ++    +   +SK   V         +T++     S   + K+ + S+++YL
Sbjct: 291 RNKDGTFNMTKILSKHEDVNYTENMTNYATMLTVYMASLQTSAKIIQPSLMDYL 344


>gi|37525877|ref|NP_929221.1| flagellin [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36785306|emb|CAE14247.1| Flagellin [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 355

 Score =  162 bits (409), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 33/349 (9%), Positives = 85/349 (24%), Gaps = 4/349 (1%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+                   E + +G   +      A       +      
Sbjct: 1   MAQVINTNSLSLLTQNNLNRSQGTLGSAIERLSSGLRINSAKDDAAGQAIANRFTANVRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q +    V    G    +        +    
Sbjct: 61  LTQAARNANDGISIAQTTEGALNEINTNLQRIRELTVQSQNGSNSESDIKSIQEEVTQRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  T          +S      G    + +         +              
Sbjct: 121 KEIDRISEQTQFNGVRVLREDSKMTIQVGANDNEVIDIDLKKIDKEALNLGKFTISAEVP 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
           H EV     +Q+ D     ++     +       +   +                     
Sbjct: 181 HGEVV----KQVDDGAGGKKNIDHTADAKVKGLKSVEVYEALKDDGSVNPGKYVVKGTDD 236

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
               + +     T+              ++K L T+   L+ +   R+ LG  +  +   
Sbjct: 237 TDGKVKYFEATITKEGKLTADADITAKASEKPLETLDSALAQVDSLRSSLGAIQNRLEST 296

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              L N  N +    S+    +  T  + +S      +    +  +  +
Sbjct: 297 VNNLNNTVNNLSAARSRIEDADYATEVSNMSRGQILQQAGTAVLAQANQ 345


>gi|312622117|ref|YP_004023730.1| flagellar hook-associated protein 3 [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202584|gb|ADQ45911.1| flagellar hook-associated protein 3 [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 315

 Score =  162 bits (409), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 44/354 (12%), Positives = 100/354 (28%), Gaps = 41/354 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + +     I   +       +  +M TG+   Y           L    + + I 
Sbjct: 1   MRITNNMMVNNFLINLNKNLSRLDDIQYKMATGKKIRYPSDNPVITARSLRLRTDVSEIE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T+++ L+ + + +Q +    V    G          A  +    + 
Sbjct: 61  QLQKNVDDAISWVDTTESALADINESLQRVRELAVRGANGTNTKEDMAQIAKEVAQIKQH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +   N    G+Y+FSG  +   P+N                             +    
Sbjct: 121 IIQVGNTNYAGRYIFSGFKTDTAPINSD--------------------------GSFSDT 154

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
                      D          +         N + + + Y                +G 
Sbjct: 155 NSFDSTGGYPIDLSTGKNIIQFELMKANYISINKTANQVFYI---------------QGE 199

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
            D     +        N  +         +LS + + +  ++ QR  +G  +  +   + 
Sbjct: 200 TDENKGNLFKVLDNLINALESGDATSVNSLLSDIDRHIDNVVAQRGDVGALQNRLELIKN 259

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L + N    T +S +  V+      QL T  N    +     ++   ++L++L
Sbjct: 260 RLSDDNVNFTTLLSNNEDVDMAEIIMQLKTAENVYRAALQTGAQILPPTLLDFL 313


>gi|83589612|ref|YP_429621.1| flagellin-like [Moorella thermoacetica ATCC 39073]
 gi|83572526|gb|ABC19078.1| Flagellin-like protein [Moorella thermoacetica ATCC 39073]
          Length = 380

 Score =  162 bits (409), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 38/369 (10%), Positives = 87/369 (23%), Gaps = 23/369 (6%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +             N    K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINQNISALNAYRNLTVTNNALTKSMEKLSSGLRINRAADDAAGLAISEKMRGQIRGLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +       + T++  L+    I+Q M    V                  +    E 
Sbjct: 61  QAVRNAQDGISLIQTAEGALNETHSILQRMRELAVQSANDTNTAADRWEIQKEINQLSEE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLA---- 179
               AN T+       G N       G     ++  +           E S    A    
Sbjct: 121 LTRIANTTEFNTKNLLGGNFEGTFQIGANKDQNITLQIGGMKSSDLKTEVSGYAAAVNPV 180

Query: 180 -------------------GQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDH 220
                              G   +VS        +    +  K +     +   S     
Sbjct: 181 DSVLTGAANLKPASGKAILGGAYDVSLATGSAAGNIKITVVIKNTAGSSISLTGSAGVAS 240

Query: 221 NIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQG 280
                   +  ID + +             V   E  +             K ++T+   
Sbjct: 241 GKLTAKNGSYSIDFTWSGTAVAGTSAKLYIVGKDENGNNQGISVITQADANKAITTINNA 300

Query: 281 LSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEM 340
           +  +  +R+ LG  +  +      L      +    S+   ++        +      + 
Sbjct: 301 IETVSAERSKLGAYQNRLEHTIANLGTAAENLTAAESRIRDLDMAQEMMAFTRNQILSQA 360

Query: 341 SYMITTKLQ 349
              +  +  
Sbjct: 361 GTAMLAQAN 369


>gi|61807192|gb|AAX55760.1| flagellin [Vibrio harveyi]
          Length = 379

 Score =  162 bits (408), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 37/370 (10%), Positives = 99/370 (26%), Gaps = 20/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           + + +     E + +G   +      A +        +   
Sbjct: 1   MTINVNTNVSAMTAQRYLNKASNELNTSMERLSSGNRINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTSILQRMRDLSLQSANGTNSASERKALNEEVTALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +          S ++ Q
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGEASFQIGASSGEAIIMGLTSIRADDHRMGGMSFVSEQ 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +        D   +   K  +      N     D        + +     A+V+  
Sbjct: 181 GKDKNWGVPDNARDLKFEFTGKDGEPVTLNINAKTGDDIEELATYINGQTDIFKASVDQD 240

Query: 242 --------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
                               G+   + +     ++ +    D      ++  +  +   L
Sbjct: 241 GKLQIFIAQPELAEDFSISGGLASQLGLNTDNGQYTTVQDIDVNTVGGSQNAVGIIDAAL 300

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +  QRA LG  +  ++     L N    +++  S+    +      QL+      +  
Sbjct: 301 KYVDSQRADLGAKQNRLSHSISNLANIQENVESSKSRIKDTDFAKETTQLTKSQILQQAG 360

Query: 342 YMITTKLQKL 351
             I  + ++L
Sbjct: 361 TSILAQAKQL 370


>gi|304390202|ref|ZP_07372156.1| flagellar protein [Mobiluncus curtisii subsp. curtisii ATCC 35241]
 gi|315657466|ref|ZP_07910348.1| flagellar protein [Mobiluncus curtisii subsp. holmesii ATCC 35242]
 gi|304326684|gb|EFL93928.1| flagellar protein [Mobiluncus curtisii subsp. curtisii ATCC 35241]
 gi|315491938|gb|EFU81547.1| flagellar protein [Mobiluncus curtisii subsp. holmesii ATCC 35242]
          Length = 344

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 25/355 (7%), Positives = 80/355 (22%), Gaps = 47/355 (13%)

Query: 5   GISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAE 64
            I+ + +             +  K  E++ +G   +      + +        +     +
Sbjct: 31  SINQNIMAMNSYRNLSLTQSNLGKSLEKLSSGFRINRAADDSSGLAISEGLRSQVRGNKQ 90

Query: 65  RLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESF 124
            + +       + T++  L+ +  ++Q M    V       D+         +       
Sbjct: 91  AVKNAQDGISVVQTAEGALNEVHDMLQRMRELAVKGANDTNDSKARAFIEQEMGQLKMEL 150

Query: 125 VTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLE 184
           V     T+                                                    
Sbjct: 151 VRVGASTNFDGRKLLW------------------------------------------NG 168

Query: 185 VSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIR 244
                   +T     + +    D+      S            D +  D+S  +      
Sbjct: 169 AKVDKDTVVTGSDFAIAETAGKDQAEWWGKSKGVLAFQVGANGDAQVDDISVQLEDLVTT 228

Query: 245 DIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVF 304
            +  +    +   ++       +      +  +   +  + + R+  G  +         
Sbjct: 229 TLKSLDTKYSVKGTEADIAIKDHKGYMAEIGKIDTAIHAVSKLRSDFGSVQNRFEHTINN 288

Query: 305 LQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK-----LSIL 354
           L      +    ++    +  +   Q +      +    +  +  +     LS+L
Sbjct: 289 LNVAVENLSASEARIRDTDMASEMMQFTRGQILQQAGTSMLAQANQVPQTVLSLL 343


>gi|289208575|ref|YP_003460641.1| flagellin domain protein [Thioalkalivibrio sp. K90mix]
 gi|288944206|gb|ADC71905.1| flagellin domain protein [Thioalkalivibrio sp. K90mix]
          Length = 375

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 28/361 (7%), Positives = 83/361 (22%), Gaps = 14/361 (3%)

Query: 5   GISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAE 64
            ++T+ +        ++         + + +GQ  +      A +     +  +   + +
Sbjct: 6   SVATNLLSLNAQRHLRQSQAALQTAFQRLASGQRINSARDDAAGLAISERFTTQIRGLNQ 65

Query: 65  RLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESF 124
            + +         T++  L SM   +Q +    V         +        +R      
Sbjct: 66  AMRNAQDGISLAQTAEGALGSMTGNLQRIRQLAVQAANATLSASDRGAIDREVRQLLAEN 125

Query: 125 VTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLE 184
              A  T          +                       ++        S  +G+   
Sbjct: 126 DRIATQTTFNGRSLLDGSMGTAFFQIGPNAGQTLAIDLGDSMRNRFVGAIASAYSGELEA 185

Query: 185 VSSMNAQQMTDF--------------IKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTE 230
             + +  ++                                    +     +    +   
Sbjct: 186 AFASDPLEVDQDFFIRVGERDPVEIPAGHYRTPQELTAAIDRALGSTGRAVLTDDGRLNL 245

Query: 231 GIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAV 290
               +  ++     D + +        S N  D          LS +   L  +  +R+ 
Sbjct: 246 IARETLTISGETAIDTLGLPATTETGGSLNDVDLTTRQGASDALSRLDAALDAVNARRSQ 305

Query: 291 LGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            G  +         L   ++ +    S+ +  +      +L       +    +  +   
Sbjct: 306 FGAIQNRFESTITNLGITSDNLAAARSRILDADYAAEVTRLVRAQILQQAGVAVLVQANA 365

Query: 351 L 351
           L
Sbjct: 366 L 366


>gi|299536008|ref|ZP_07049327.1| flagellar hook-associated protein 3 [Lysinibacillus fusiformis ZC1]
 gi|298728613|gb|EFI69169.1| flagellar hook-associated protein 3 [Lysinibacillus fusiformis ZC1]
          Length = 331

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 32/354 (9%), Positives = 117/354 (33%), Gaps = 24/354 (6%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++ + +   M +          KL +++ +G+               + + ++   + 
Sbjct: 1   MRVTQTMLSNNMLLNLNRSYGRMSKLQDQLNSGKKITRPSDDPVIAVKGMGYRRDLGRVE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + + V   + T+   L+ + + ++ +   ++         ++       +    + 
Sbjct: 61  QYTRNMNEVNNWIDTTDESLNQVGEQMKRVRELVIQAANDTNTPDERAKIKKEIDQIRQQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               +N     +Y+FSG N+ +         ++   K  +   Q +   N  S  A +  
Sbjct: 121 IQDVSNTKIGDRYIFSGTNTDKPLFVDANPPNADGSKIINADYQLYDGTNIISTAADKLT 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
             ++    ++ D I+   +    D +   +                             I
Sbjct: 181 APNADVQIEVYDGIQLQVNAPGADLFGNIDSLMG------------------------KI 216

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
            +++    +     S+ ++       +      +    + I+E +A +G  +  +     
Sbjct: 217 SNLLDPERVPGPATSEEISKALGGFTSNSKSDDITNIHNKILETQADMGARQNRVELMEN 276

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L  +   +   +S +  V+   A  ++ T  +  + +  +  ++ + ++++++
Sbjct: 277 RLSLREISVTKQLSNNEDVDYSKAITEMVTSESIHQAALSVGARIIQQTLVDFI 330


>gi|260774946|ref|ZP_05883847.1| flagellin protein FlaC [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609201|gb|EEX35359.1| flagellin protein FlaC [Vibrio coralliilyticus ATCC BAA-450]
          Length = 379

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 37/370 (10%), Positives = 94/370 (25%), Gaps = 20/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           +   D     E + +GQ  +      A +        +   
Sbjct: 1   MTITVNTNVSAMTAQRYLNKATGDLNTSMERLSSGQKINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q +    +    G    ++       +    
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTSILQRIRDLSLQSANGTNSASERQALNEEVEALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +         +S +A Q
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGEASFQIGASSGEAIIMGLTSIRADDFRMGGQSFIAEQ 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D   +   K  +         +  D        + +   + A+V+  
Sbjct: 181 PKNKDWGVPPTAKDLKFEFTTKDGEAITLDIIAKDGDDIEELATYINGQTDKLKASVDEE 240

Query: 242 --------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
                               G+   + +        +    D       +  +  V   L
Sbjct: 241 GKLQIFAAEPNLEGNLNISGGLASELGLNGGPGLNTTVQNIDVNTVGGAQNAVGIVDAAL 300

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +  QRA LG  +  ++     L N    ++   S+    +       ++      +  
Sbjct: 301 RYVDSQRADLGAKQNRLSHSINNLANIQENVEASNSRIRDTDFAKETTAMTKAQILQQAG 360

Query: 342 YMITTKLQKL 351
             I  + ++L
Sbjct: 361 TSILAQAKQL 370


>gi|15616182|ref|NP_244487.1| flagellar hook-associated protein 3 (HAP3) [Bacillus halodurans
           C-125]
 gi|10176244|dbj|BAB07339.1| flagellar hook-associated protein 3 (HAP3) [Bacillus halodurans
           C-125]
          Length = 395

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 34/394 (8%), Positives = 102/394 (25%), Gaps = 40/394 (10%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++   +         +      +L +++ TG+      Q        + +  +   + 
Sbjct: 1   MRVTQGMLAGNSLRHISQGYMRLGELQDQLSTGKRITRASQDPVVAMKGIRYRTQVAEVE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +   V   + T+ A L      +  +            +  +    A  +R  YE 
Sbjct: 61  QFKRNLREVYNWMDTADAALGEATDALARIHELATQAANDTYEETQRANIAKEIRQLYEH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPL--------------------------NGYFTKDSL 157
             + AN  + G+Y+F+G N++  P+                              T   +
Sbjct: 121 LQSIANTKNSGKYIFNGTNTTNPPIVAPERMDLGFAHLLEPGTDLQTVEIVYDGQTYHYV 180

Query: 158 AKKSFDQMLQGFLEENSKSLLAGQHLEVSS--------------MNAQQMTDFIKQLEDK 203
            + +   ++   + + +         +  +              + + Q        E K
Sbjct: 181 GENADGHLVFQDVRQMNSLPFDETDSDEFNEKAFQLVIDPDLGRITSSQPNVNTGAAETK 240

Query: 204 FSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTD 263
                        A   N +    +                    +              
Sbjct: 241 NVRLNDVVVADREAVSFNTQRVEIELLKGVKIPVNTNPTNVFNNALFGDILRLEKALEDP 300

Query: 264 GARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVE 323
                     +    + +  +  +RA LG     +      +  +       +S +  V+
Sbjct: 301 SVSGAELTAYIDNFTKHIDQVTAERAELGARVNRVEMLESRILQQEITAKRIMSDNEDVD 360

Query: 324 QHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
                  L+   +    +  +  ++ + +++++L
Sbjct: 361 LEKVIIDLTIQESVHRAALAVGARIMQPTLMDFL 394


>gi|126668565|ref|ZP_01739519.1| Flagellin and related hook-associated protein [Marinobacter sp.
           ELB17]
 gi|126626970|gb|EAZ97613.1| Flagellin and related hook-associated protein [Marinobacter sp.
           ELB17]
          Length = 402

 Score =  160 bits (404), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 48/402 (11%), Positives = 107/402 (26%), Gaps = 47/402 (11%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              IS+  IF       ++L+    K  E++ TG+  +           IL+ +QE   I
Sbjct: 1   MIRISSQQIFSGGINRLQDLSAQLNKTDEQIATGKRVNRPSDDPVAAARILKLDQEVKRI 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
                +  L   RL   ++ +SS   I+Q +    V    G    +     +  + +  +
Sbjct: 61  ETYERNAQLANNRLGQEESAISSSLDILQRVRELTVQAGNGSLSASDRLSISSEMNERLQ 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                AN  D              P       +   +    Q +    +  + ++     
Sbjct: 121 QLAQTANTQDASGEYIFSGFQGGSPAYAKEAGEWTYQGDEGQRMLEIDDGVTVAISDNGK 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEY--------------------------------- 209
                + A         L       +                                  
Sbjct: 181 GIFDRIPATASGGLTGPLPLPVPPPDGRINSISVINRSDLQAGGLASLELTISAPNQLQY 240

Query: 210 --------------WANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTE 255
                               N     +   + +      +             ++ +   
Sbjct: 241 VDKDGVTQSVAFEPGEPVTVNGVQFTLTDAVVNDVFTIETGEKQSVFKTIENLISGLDNL 300

Query: 256 FLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTY 315
             S +    A N L    L+ +       I ++  LG    ++   + FL++        
Sbjct: 301 SKSGSAGSDAYNDLIASSLANLDNAQESFILKQTELGGRMNSVESTQAFLEDSALYSKEI 360

Query: 316 ISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            S+   ++   A + LS     ++ +     ++ +LS+ + L
Sbjct: 361 RSQLQDIDYAEAISTLSFQSFVLQAAQQSFARVSQLSLFDRL 402


>gi|253990088|ref|YP_003041444.1| flagellin [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253781538|emb|CAQ84701.1| flagellin (flic) [Photorhabdus asymbiotica]
          Length = 357

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 30/349 (8%), Positives = 83/349 (23%), Gaps = 3/349 (0%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+         +         E + +G   +      A       +      
Sbjct: 1   MAQVINTNSLSLLTQNNLTKSQGTLGNAIERLSSGLRINSAKDDAAGQAIANRFTANVRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q +    V         +        +    
Sbjct: 61  LTQAARNANDGISIAQTTEGALNEINTNLQRIRELTVQAQNESNSESDIKSIQEEVTQRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  T          ++      G    + +         +    E         
Sbjct: 121 DEIDRISEQTQFNGVRVLREDNKMTIQVGANDNEVINIDLKKIDREALKLEKFTLSAEVP 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
           H +  +          K   D  +D            +     +   +   D    +   
Sbjct: 181 HGDAVTEVDDGKGAGTKSKIDYSAD---VKVKDLKNVNVYHAVKDDGSVDPDKYVVIGKD 237

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
                        +              +K+ L  +   L+ +   R+ LG  +  +   
Sbjct: 238 NDGKTKSFQATIAKDGKLTAGKDITAEASKEPLKALDSALAQVDSLRSSLGAIQNRLEST 297

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              L N  N + +  S+    +  T  + +S      +    +  +  +
Sbjct: 298 VNNLNNTVNNLSSARSRIEDADYATEVSNMSRGQILQQAGTAVLAQANQ 346


>gi|17366580|sp|Q60246|FLAA_VIBAN RecName: Full=Flagellin A
 gi|974706|gb|AAB05995.1| flagellin A [Listonella anguillarum serovar O1]
          Length = 379

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 36/370 (9%), Positives = 95/370 (25%), Gaps = 20/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           +   +     E + +G   +      A +        +   
Sbjct: 1   MTITVNTNVSAMTAQRYLNKATGELNTSMERLSSGNKINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTSILQRMRDLALQSANGTNSASERQALDEESTALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +         +S LA Q
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGEASFQIGASSGEAIIMGLTSIRADDFRMGGQSFLAEQ 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D   +   +  +         +  D        + +   + A+V+  
Sbjct: 181 GKDKDWGVPAGARDLKFEFTTQAGELVTLDVLAKDGDDIEELATYINGQTDKLKASVDQD 240

Query: 242 --------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
                               G+   + +        +    D      ++  +  +   L
Sbjct: 241 GKLQIFAAEPNLQGDLAISGGLATELGLNGGPGVKTTVQDIDITSVGGSQNAVGVLDAAL 300

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +  QRA LG  +  ++     L N    ++   S+    +      Q++      +  
Sbjct: 301 RYVDSQRAELGAKQNRLSHSINNLANIQENVEASNSRIKDTDFAKETTQMTKAQILQQAG 360

Query: 342 YMITTKLQKL 351
             I  + ++L
Sbjct: 361 TSILAQAKQL 370


>gi|89895773|ref|YP_519260.1| hypothetical protein DSY3027 [Desulfitobacterium hafniense Y51]
 gi|89335221|dbj|BAE84816.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 329

 Score =  159 bits (401), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 40/355 (11%), Positives = 110/355 (30%), Gaps = 28/355 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IS + +   + +          KL  ++ TGQ  +          + L ++   +++ 
Sbjct: 1   MRISNNMLSRNLLLNLWAAQGRIDKLQNQLSTGQKINRPSDDPVGTENSLRFKSNISYLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEG-KTDNNKFPINAGMLRDSYE 122
           +   +       + T+   +  M  ++Q      +  +     ++      A  +    E
Sbjct: 61  QLKANAKEGIAYMDTTDDTMGEMTSMIQRAKELAIRAMNTSTVNDEDRKKIAIEIDQIRE 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
             +  AN     +Y+F G  + E    G     +   +  D   +  +  +    ++   
Sbjct: 121 HVIELANTKVGSKYIFGGTANVEPFPKG-----ATEWQGSDDTKKFQVGGDLSIEVSVNG 175

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
            ++     +     I    D  + +    +    A    +    K     +++   +  G
Sbjct: 176 HDLFGAGWEYAEVTIPAPTDPPTYEYKKGSGSGIAMFDTLAQLSKALNESNINGVDDGTG 235

Query: 243 IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEER 302
                                       + +LS ++     I + RA LG  +  ++   
Sbjct: 236 TE----------------------EDGVQVLLSKLELQADHISDVRAQLGARQNRMDSVY 273

Query: 303 VFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             L + +  +   +S  +  +         T  +  + +  + TK+ + S+ ++L
Sbjct: 274 TQLDSTSANLGDSLSTVLYADIAETLVNFKTQDSIYQAALSVGTKIIQPSLADFL 328


>gi|138896698|ref|YP_001127151.1| flagellar hook-associated protein FlgL [Geobacillus
           thermodenitrificans NG80-2]
 gi|134268211|gb|ABO68406.1| Flagellar-hook associated protein 3 [Geobacillus
           thermodenitrificans NG80-2]
          Length = 301

 Score =  159 bits (400), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 34/354 (9%), Positives = 90/354 (25%), Gaps = 54/354 (15%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++ S +   M         +  K  E++ TG+  +            + +      + 
Sbjct: 1   MRVTQSMLANNMLKHLSASYANLGKYQEQLSTGKKINRPSDDPVVAMKGMAYRTNLTEVE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + S     +  S A L    + +Q +   +V       +  +    +  ++   E 
Sbjct: 61  QLKRNFSEAYNWIENSDAALDKATQALQRIRELIVQASNDTYEETQRQAISQEIKQLTEH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            VT AN     +Y+F                                             
Sbjct: 121 LVTIANTKVGDKYIF--------------------------------------------- 135

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
                N         Q+ +                   I   +          + + +G 
Sbjct: 136 -----NGTNTLQPPVQIVNGSITTSNNVEEVKIELAKGIYIGVNVDPTKVFHYDASQKGK 190

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                +        +             + L  + Q ++ ++  RA LG     +     
Sbjct: 191 GLFSDL----QSLANDLDDPTKTGKDINEYLGYIDQHITNLLGVRAELGARMNRVELMED 246

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            +  +  I    +S +  V+       L    +    +  +  ++ + +++++L
Sbjct: 247 RINQQEVIAKKVLSDNEDVDMERVITDLKVQESVHRAALAVGARIIQPTLVDFL 300


>gi|150020412|ref|YP_001305766.1| flagellin domain-containing protein [Thermosipho melanesiensis
           BI429]
 gi|149792933|gb|ABR30381.1| flagellin domain protein [Thermosipho melanesiensis BI429]
          Length = 386

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 32/375 (8%), Positives = 83/375 (22%), Gaps = 29/375 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +           + N    K  E + +G   +      A +    +   +   I 
Sbjct: 1   MRINHNISALNAWRSIGQTNMSMSKTLERLSSGLRINRAGDDAAGLAISEKMRGQIKGIN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
             + ++      + T++  L+ +  I+Q M    V        +         L    E 
Sbjct: 61  MAIKNSQDAISLIQTAEGALTEVHSILQRMRELAVQASSDTNTDVDRNQIQAELDQLREE 120

Query: 124 FVTFANMTDEGQYLFSGIN-----------------------------SSEKPLNGYFTK 154
               A  T+                                            +      
Sbjct: 121 IDRIARTTEFNTKKLLDGKLESFRSTEDIKVVTGGNIAINASAAGTVTEGTYIVEVGQFN 180

Query: 155 DSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNW 214
                +    +       +  +        +  ++    T         F          
Sbjct: 181 TDTTLEVKVTLFTAGGSNSVTTTYTNGEATIGGVSITWDTTVFDVNFADFGGALPSGEVV 240

Query: 215 SNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKML 274
            +A            + I    +     +   +     G   ++    D       ++ +
Sbjct: 241 DSAVARVEAINTAANQLIFQIGSNEGHNMLTGIDDMSAGALGITTTSLDVTTQDAAERAI 300

Query: 275 STVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTL 334
             V   +  +  QRA LG  +  +      L      +    S+    +      + +  
Sbjct: 301 MVVDAAIHKVSSQRAALGAVQNRLEHTISNLGVAAENLTAAESRVRDADMAKEMMEFTKQ 360

Query: 335 INKIEMSYMITTKLQ 349
              ++ S  +  +  
Sbjct: 361 QILLQSSMGMLAQAN 375


>gi|56964842|ref|YP_176573.1| flagellar hook-associated protein 3 FlgL [Bacillus clausii KSM-K16]
 gi|56911085|dbj|BAD65612.1| flagellar hook-associated protein 3 FlgL [Bacillus clausii KSM-K16]
          Length = 353

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 37/354 (10%), Positives = 99/354 (27%), Gaps = 2/354 (0%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++   +       ++   +    L++++   +      Q        ++  Q    + 
Sbjct: 1   MRVTQGMMMTNSLRYSQSSYQRLSTLYDQISAQKKITRFSQDPVVAAKSMQHRQSLAQME 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + +     L+     L  +  I++ +    +          +    A  L +    
Sbjct: 61  QYKRNVNEAQSWLNQGDTSLKEVSSILKRVRELAITGSTDGYGEEERKNIAHELEELRNH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +T AN    G+Y+F+G ++   P+       S         ++           A    
Sbjct: 121 LITVANSNVNGKYIFNGSDTDNTPVQ--ELSPSKLNGEKLDNVKITYGGQIYDYDADAGH 178

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
            V+      +    + +E    D     +        N K    + +             
Sbjct: 179 FVARGGEDTLVLNGENIETGTGDVVAEKDMLIMRISTNQKDVSFELQKGVEIQVNTDARK 238

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                +      F    L          + +S +   L    +    LG     ++    
Sbjct: 239 LFSDELYSDFFMFEQALLDPETSAEDLGEFISKIDAHLRNAADVHGQLGARMNRVDLMED 298

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L  +   +    S +  ++   A  +L         +  +T ++ + S+L++L
Sbjct: 299 RLGQQEYFVKETKSMNEDLDVSEAIMKLLVAEGVHNAALAVTARIIQPSLLDFL 352


>gi|196249401|ref|ZP_03148099.1| flagellar hook-associated protein 3 [Geobacillus sp. G11MC16]
 gi|196211158|gb|EDY05919.1| flagellar hook-associated protein 3 [Geobacillus sp. G11MC16]
          Length = 297

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 36/354 (10%), Positives = 100/354 (28%), Gaps = 58/354 (16%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ S +   M        +   +   ++ TG+      +        + +      + 
Sbjct: 1   MRITQSMLANNMLKQITRSYEKLDQYQTQLSTGKKITRPSEDPVVAMKGIAYRSNLAEVE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + S     +  S + L    + +Q +   +V       +  +    A  +R   E 
Sbjct: 61  QFKRNFSEAYNWVENSDSALDKATQALQRIRELVVQASNDTYEETQRQAIAKEVRQLTEH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            VT AN     +Y+F+G  ++E P+                                 + 
Sbjct: 121 LVTIANTKVGDKYIFNGAQTTEPPV-------------------------------TVNA 149

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           + +   +        +L            + +  + + +   ++D      + +     +
Sbjct: 150 DGTIAVSTNDQQLNIELAKGVYIPVNIPPSTAFGAGNGLFSDLQDLAASLENPSTTGDEL 209

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
              +                             +   L+ ++  RA LG     I     
Sbjct: 210 TGYL---------------------------DKLDNHLTHLLGVRAELGARMNRIELMED 242

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            +  +  I    +S +  V+       L T  +    +  +  ++ + +++++L
Sbjct: 243 RIDGQQVIAQKVLSDNEDVDLEKVIIDLKTQESVHRAALAVGARIIQPTLVDFL 296


>gi|302871569|ref|YP_003840205.1| flagellar hook-associated protein 3 [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302574428|gb|ADL42219.1| flagellar hook-associated protein 3 [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 315

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 42/354 (11%), Positives = 103/354 (29%), Gaps = 41/354 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + +     I   +  K    +  +M  G+   Y           L    + + I 
Sbjct: 1   MRITNNMMVNNFLINLNKNLKRLDDIQYKMAIGKKIRYPSDDPVITARSLRLRTDVSEIE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T+++ L+ + + +Q +    V    G          A  +    + 
Sbjct: 61  QLQKNVDDAVSWVDTTESALADINESLQRVRELAVRGANGTNTKEDMAQIAKEVAQIKQH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +   N    G+Y+FSG  +   P+N   +                   ++    +    
Sbjct: 121 IIQVGNTNYAGRYIFSGFKTDTAPINSDGSF-----------------SDTGDFSSSGGY 163

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
            +       +  F     +  + ++     +                          +G 
Sbjct: 164 SIDLSTGNNIIQFELMKANYININKTANQVFYI------------------------QGE 199

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
            D     +        N            +LS + + +  ++ QR  +G  +  +   + 
Sbjct: 200 TDENKGNLFKVLDNLINALQNGDATTVNSLLSDIDRHIDNVVAQRGDVGALQNRLELIKN 259

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L + N    T +S +  V+      QL T  N    +     ++   ++L++L
Sbjct: 260 RLSDDNVNFTTLLSNNEDVDMAEIIMQLKTAENVYRAALQTGAQILPPTLLDFL 313


>gi|160903242|ref|YP_001568823.1| flagellin domain-containing protein [Petrotoga mobilis SJ95]
 gi|160360886|gb|ABX32500.1| flagellin domain protein [Petrotoga mobilis SJ95]
          Length = 388

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/379 (8%), Positives = 85/379 (22%), Gaps = 35/379 (9%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +           ++N+   K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINHNISALNAWRSMDQVNQSMGKTLEKLSSGLRINRAGDDAAGLAISEKMRGQIKGLD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
             + +       + T++  L+    I+Q M    V        N         L    E 
Sbjct: 61  TAVKNAQDSISLIQTAEGALTETHSILQRMRELSVQAASDTNTNVDRNQIQLELDQLREE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               +  T+                 G      +   + +          +        +
Sbjct: 121 IDRISRTTEFNTMKLLDGKIE--SFRGSEDIKVVTGGNINVEAGLISGSTAVEGTYVVEV 178

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
              S       D                   + A+         ++    +S        
Sbjct: 179 GQLSGTETTALDVKITQITAGGQTSTIVTLGAGAATIGGISFKWESSTFAISDFGGSLPK 238

Query: 244 RDIMFVAVIGTEFLSKNLTD---------------------------------GARNVLT 270
            +I+  AV+  E  +                                             
Sbjct: 239 NEIVDSAVVRVEAANTAANQLVLQIGANEGHNIVLGIDDMSSKALGLTEDSLKATDQDSA 298

Query: 271 KKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQ 330
           ++ +  V   +  +   RA LG  +  +      L   +  +    S+    +       
Sbjct: 299 ERSIMVVDAAIHKVSTARASLGAVQNRLEHTISNLGVASENLTAAESRIRDADMAKEMMD 358

Query: 331 LSTLINKIEMSYMITTKLQ 349
            +     ++ S  +  +  
Sbjct: 359 FTKQQILLQASNAMLAQAN 377


>gi|37199425|dbj|BAC95256.1| polar flagellin FlaB [Vibrio vulnificus YJ016]
          Length = 396

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 46/367 (12%), Positives = 98/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 20  MAVNVNTNVAAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 79

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 80  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALN 139

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K +            S   M    +     S  A +
Sbjct: 140 DELNRIAETTSFGGNKLLNGTYGTKAMQIGADNGEAVMLSLKDMRSDNVMMGGVSYQAEE 199

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +   A    D    L D F +++    N     D        + +   V A+V   
Sbjct: 200 GKDKNWNVAAGDNDLTIALTDSFGNEQEIEINAKAGDDIEELATYINGQTDLVKASVGEG 259

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I                          + ++ +  D       ++ ++ V   L  
Sbjct: 260 GKLQIFAGNNKVQGEISFSGSLAGELGLGEGKNVTVDTIDVTTVQGAQESVAIVDAALKY 319

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +      QL+      + S  
Sbjct: 320 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTQLTKTQILSQASSS 379

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 380 ILAQAKQ 386


>gi|217077418|ref|YP_002335136.1| flagellin [Thermosipho africanus TCF52B]
 gi|217037273|gb|ACJ75795.1| flagellin [Thermosipho africanus TCF52B]
          Length = 387

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 29/376 (7%), Positives = 83/376 (22%), Gaps = 30/376 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +           + N    K  E + +G   +      A +    +   +   + 
Sbjct: 1   MRINHNISALNAWRSIGQTNMSMTKTLERLSSGLRINRAGDDAAGLAISEKMRGQIKGLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
             + ++      + T++  L+ +  I+Q M    V        +         L    E 
Sbjct: 61  MAIKNSQDAISLIQTAEGALTEVHSILQRMRELSVQASSDTNTDVDRNQIQAELDQLREE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A  T+                       +    +               ++     
Sbjct: 121 IDRIARTTEFNTKKLLDGKLESFRSEVDAKVVTGGNINLTLGAVNTNASEGTYIVEVGQF 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGID---------- 233
             +  +A  +   +                 ++      K+     +  D          
Sbjct: 181 NGNETSALDVKITLITAGGTSDTSNTLGAASASLGSIKFKWDSTVFDINDFGGALPKGEV 240

Query: 234 ----------VSANVNMRGIRDIMFVAVIGTEFLSKNLT----------DGARNVLTKKM 273
                      + + N    +            +               D       ++ 
Sbjct: 241 VDSAVVRVEATNTSANQLIFQIGSNEGHNMIAGIDDMSAGALGITTTSLDVTTQDAAERS 300

Query: 274 LSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLST 333
           +  +   +  +  QRA LG  +  +      L      +    S+    +      + + 
Sbjct: 301 IMVIDAAIHKVSSQRAALGAVQNRLEHTISNLGVAAENLTAAESRVRDADMAKEMMEFTK 360

Query: 334 LINKIEMSYMITTKLQ 349
               ++ S  +  +  
Sbjct: 361 QQILLQSSMGMLAQAN 376


>gi|219670202|ref|YP_002460637.1| flagellar hook-associated protein 3 [Desulfitobacterium hafniense
           DCB-2]
 gi|219540462|gb|ACL22201.1| flagellar hook-associated protein 3 [Desulfitobacterium hafniense
           DCB-2]
          Length = 327

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 42/355 (11%), Positives = 103/355 (29%), Gaps = 30/355 (8%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IS + +   + +          KL  +M TGQ  +          + L ++   +++ 
Sbjct: 1   MRISNNMLSRNLLLNLWAAQGRMDKLQNQMSTGQKINRPSDDPVGTENSLRFKSNISYLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEG-KTDNNKFPINAGMLRDSYE 122
           +   +       + T+   +  M  ++Q      V  +     ++      A  +    E
Sbjct: 61  QLKANAKEGIAYMDTTDDVMGEMSLMIQRAKELAVHAMNTSTVNDEDRKKIAIEIDQIRE 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
             +  AN     +Y+F G  + E    G                 G+   +         
Sbjct: 121 HVIELANTKVGTKYIFGGTANVEPFPKG---------------ATGWQGSDDTKKFQVGG 165

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
                ++      F    E            +           + DT             
Sbjct: 166 DLSIEVSVNGHDLFGAGWEYTPKTPATDPPTYEYQETGASGIAMFDT------------- 212

Query: 243 IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEER 302
               +  A+  +     +   G      + +LS ++     I + RA LG  +  ++   
Sbjct: 213 -LAQLSKALNESNINGVDDGTGTEEDGVEVLLSKLELQADHISDVRAQLGARQNRMDSVY 271

Query: 303 VFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             L + +  +   ++  +  +         T  +  + +  + TK+ + S+ ++L
Sbjct: 272 TQLDSTSANLGDSLANVLYADIAETLVNFKTQDSIYQAALSVGTKIIQPSLADFL 326


>gi|209695754|ref|YP_002263684.1| flagellin [Aliivibrio salmonicida LFI1238]
 gi|208009707|emb|CAQ80011.1| flagellin subunit A [Aliivibrio salmonicida LFI1238]
          Length = 379

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 37/370 (10%), Positives = 88/370 (23%), Gaps = 20/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+               D     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRYLNNATNDLNNSMERLSSGTKINSAKDDAAGLQISNRLTAQTRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G   N         +    
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTNILQRMRDLSLQAANGSNSNQDRSSIQEEVHALS 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G          E                   +         +  ++  
Sbjct: 121 DELNRIAETTSFGGRRLLNGQFGESAFQIGANSGEAILIKLPSVRSDDDSMGGQRFVSEN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D   +   K  +      N     D        + +   +SA+V   
Sbjct: 181 GKTAEWNVETGKNDLKLEFTTKKGEAVSININAKAGDDIEELATYINGQSDKISASVGDE 240

Query: 242 G--------------------IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
           G                    +   + +A       + +  D       +  +  +   L
Sbjct: 241 GKLQLFVAEPSIEGELAVSGNLASELGLAGGVGTKATVDKLDVTSVGDAQVSIGVIDSAL 300

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
           + I  +RA LG  +  +      L N    +    S+    +       ++      + S
Sbjct: 301 AYIDRERADLGAKQNRLGHSINNLSNIQENVSASNSRIKDTDFAKETTNMTKAQILQQSS 360

Query: 342 YMITTKLQKL 351
             I  + ++L
Sbjct: 361 TSILAQAKQL 370


>gi|154250154|ref|YP_001410979.1| flagellin domain-containing protein [Fervidobacterium nodosum
           Rt17-B1]
 gi|154154090|gb|ABS61322.1| flagellin domain protein [Fervidobacterium nodosum Rt17-B1]
          Length = 389

 Score =  157 bits (396), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 36/378 (9%), Positives = 83/378 (21%), Gaps = 32/378 (8%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +             N D  K  E + +G   +      A +    +   +   + 
Sbjct: 1   MRINHNVNALNSWRNISMTNMDMSKTLERLSSGLRINRAGDDAAGLAISEKMRGQIKGLD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
             + ++      + T++  L+ +  I+Q M    V        N         L    E 
Sbjct: 61  MAIKNSQDAISLIQTAEGALTEVHSILQRMRELAVQAASDTNTNVDRNQIQAELDQLREE 120

Query: 124 FVTFANMT-DEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
               A  T    + L  G     +                              ++    
Sbjct: 121 IDRIARTTEFNTKKLLDGKLEGFRSSADAKVVTGGNINVTVGGYSKTGATEGTYVIEVGQ 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR- 241
              +  +   +            D         +A+  N+  + +    I          
Sbjct: 181 FNGAVTSQLDVKITQIGNNGTVLDSTTVTIGALSAALGNVTIKWQRVFTISDFGGALPTN 240

Query: 242 ------------------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTK 271
                                          +   +         LS +          +
Sbjct: 241 EVIDSAVIRVEARYTANNQLVFQIGANEGHNMIAGIDDMSAKALGLSTSTLKVTDQNSAE 300

Query: 272 KMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQL 331
           K +  V   +  +   RA LG  +  +      L      +    S+    +      Q 
Sbjct: 301 KTIMVVDAAIHRVSTARAALGAVQNRLEHTIANLGVAAENLTAAESRIRDADMAKEMMQF 360

Query: 332 STLINKIEMSYMITTKLQ 349
           +     ++ S  +  +  
Sbjct: 361 TKQQILLQSSMSMLAQAN 378


>gi|59712473|ref|YP_205249.1| flagellin [Vibrio fischeri ES114]
 gi|197335711|ref|YP_002156692.1| A-type flagellin [Vibrio fischeri MJ11]
 gi|46394804|gb|AAS91569.1| flagellin subunit A [Vibrio fischeri ES114]
 gi|59480574|gb|AAW86361.1| Flagellin FlaA [Vibrio fischeri ES114]
 gi|197317201|gb|ACH66648.1| A-type flagellin [Vibrio fischeri MJ11]
          Length = 379

 Score =  157 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 35/370 (9%), Positives = 88/370 (23%), Gaps = 20/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+               D     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNATNDLNNSMERLSSGTKINSAKDDAAGLQISNRLTAQTRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G   +         +    
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTNILQRMRDLSLQAANGSNSDQDRASIQEEVHALS 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G          E                   +         +  ++  
Sbjct: 121 DELNRIAETTSFGGRRLLNGQFGESAFQIGANAGEAILIKLPSVRADDDSMGGQRFVSEN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
               S        D   +   K  +      +     D        + +   +SA+V   
Sbjct: 181 GKSASWNVEPGKNDMKLEFTTKKGEAVSIDISAKAGDDIEELATYINGQSDKISASVGDE 240

Query: 242 G--------------------IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
           G                    +   + +        + +  D       +  +  +   L
Sbjct: 241 GKLQLFVAEPSIEGELSITGNLATELGLESGLGSKATVDKLDVTSVGDAQVSIGVIDSAL 300

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
           + I  +RA LG  +  +      L N    +    S+    +       ++      + S
Sbjct: 301 AYIDRERADLGAKQNRLGHSINNLSNIQENVSASNSRIKDTDFAKETTNMTKAQILQQSS 360

Query: 342 YMITTKLQKL 351
             I  + ++L
Sbjct: 361 TSILAQAKQL 370


>gi|307546961|ref|YP_003899440.1| flagellar hook-associated protein FlgL [Halomonas elongata DSM
           2581]
 gi|307218985|emb|CBV44255.1| flagellar hook-associated protein FlgL [Halomonas elongata DSM
           2581]
          Length = 405

 Score =  157 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 52/405 (12%), Positives = 116/405 (28%), Gaps = 51/405 (12%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST ++FE+          D + + +++ +G+            +  +   Q K    
Sbjct: 1   MRISTVTMFEQSVSSMNRQQSDFLDVSQQIASGRRVVNPSDDPQAASRAVGVGQAKAVTE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   S       LS  ++ L+S+   V      LV        +      A  LR  YE+
Sbjct: 61  QYGDSRVSARNALSQGESVLNSVSDAVTSAKTLLVQASSDTLSDADRESVASELRGVYET 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V  AN TD       G      P         +      ++ +  ++ +    ++    
Sbjct: 121 LVGQANATDGNGRYLFGGYEDGSPPFVENGDGHMEYVGSTEVRRQRIDASRVMEVSDSGQ 180

Query: 184 EV--SSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRI---KDTEGIDVSANV 238
           E+  S  +            D     +      ++A D+  ++ I   +D   +  S + 
Sbjct: 181 EIFRSVPSGAGYVAEAAAGNDGSLTFKGPQTLDADADDYGKRFEISFAEDGGTLSYSVSA 240

Query: 239 NM----------------------------------------------RGIRDIMFVAVI 252
           +                                                  + +     +
Sbjct: 241 DGAPVAGMQDVAYQAGDSLRFGGLSMELKGEPADGDSLTVGPAESMDPDLFQTLEKAIGV 300

Query: 253 GTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNII 312
                  +    AR       +  +   L  ++  RA +G     ++       N+    
Sbjct: 301 LENPAETSREKAARGNTLNTAMRELDHSLDNVLTVRASMGARLNELDVVDSVSDNRMLNY 360

Query: 313 DTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +  +S  + ++   A ++ S     ++ S      L+ +S+  YL
Sbjct: 361 EQTLSDLVDLDYAEAISEYSLRQIGMQASQKTFADLKGMSLFQYL 405


>gi|262166274|ref|ZP_06034011.1| flagellin protein FlaC [Vibrio mimicus VM223]
 gi|262025990|gb|EEY44658.1| flagellin protein FlaC [Vibrio mimicus VM223]
          Length = 351

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/342 (9%), Positives = 85/342 (24%), Gaps = 20/342 (5%)

Query: 30  HEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLVTKRLSTSQAHLSSMQKI 89
            E + +G   +      A +        +   +   + + +       T++  ++    I
Sbjct: 1   MERLSSGNRINSAKDDAAGLQISNRLTAQSRGLDVAMRNANDGISIAQTAEGAMNESTSI 60

Query: 90  VQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANMTDEGQYLFSGINSSEKPLN 149
           +Q +    +    G     +            +     A  T  G       +  E    
Sbjct: 61  LQRIRDLALQSANGTNSTAERQALNEEATALQDELNRIAETTSFGGRKLLNGSFGEASFQ 120

Query: 150 GYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEY 209
              +           +         +S +A Q             D   +   K  +   
Sbjct: 121 IGSSSGEAIIMGLTSVRADDFRMGGQSFVAEQAKTKEWGVPPTARDLKFEFTKKDGEAVV 180

Query: 210 WANNWSNASDHNIKYRIKDTEGIDVSANVNMR--------------------GIRDIMFV 249
                 +  D        + +     A+V+                      G+   + +
Sbjct: 181 LDIMAKDGDDIEELATYINGQTDLFKASVDQDGKLQVFVAEPNIQGNFNISGGLATELGL 240

Query: 250 AVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKN 309
                   +    D      ++  +  +   L  +  QRA LG  +  ++     L N  
Sbjct: 241 NGGPGVKTTVKDIDITSVGGSQNAVGIIDAALKYVDSQRADLGAKQNRLSHSISNLSNIQ 300

Query: 310 NIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKL 351
             ++   S+    +      QL+      +    I  + ++L
Sbjct: 301 ENVEASKSRIKDTDFAKETTQLTKSQILQQAGTSILAQAKQL 342


>gi|258626166|ref|ZP_05721014.1| flagellin FlaE [Vibrio mimicus VM603]
 gi|258581521|gb|EEW06422.1| flagellin FlaE [Vibrio mimicus VM603]
          Length = 378

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 104/367 (28%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             ++   +  E + +G   +      A +      E +   
Sbjct: 1   MAMTVNTNVSALVAQRHLNSASEMLSQSLERLSSGNRINSAKDDAAGLQISNRLETQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           ++  + + +     + T++  +    +++Q M    +    G   + +       +    
Sbjct: 61  LSIAVRNANDGISIMQTAEGAMQETTQLLQRMRDLSLQSANGSNSSAERTALQEEMAALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T          +  +       +     + S   M    L+    S +A  
Sbjct: 121 DELNRIAETTSFAGRKLLNGHFEKASFQIGASSGEAVQLSLRNMRSDSLDMGGFSYVAAT 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +     A+          +   ++E          D        + +   VSA+VN +
Sbjct: 181 MADKKWQVAKGKQQLNISYVNALGENENIQLQAKEGDDIEELATYINGQTDKVSASVNEK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +          LS + +                  D +     ++ +S +   L  
Sbjct: 241 GQLQLYIAGKETAGTLSFSGSLANELQLNLLGYEAVDNLDISSVGGAQRAVSVIDTALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   R+ LG  +   +     L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDGHRSELGALQNRFHHAISNLDNVHENLAASNSRIKDADYAKETTQMIKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKR 367


>gi|150020437|ref|YP_001305791.1| flagellin domain-containing protein [Thermosipho melanesiensis
           BI429]
 gi|149792958|gb|ABR30406.1| flagellin domain protein [Thermosipho melanesiensis BI429]
          Length = 387

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 35/376 (9%), Positives = 88/376 (23%), Gaps = 30/376 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +           + N    K  E + +G   +      A +    +   +   I 
Sbjct: 1   MRINHNISALNAWRSIGQTNMSMSKTLERLSSGLRINRAGDDAAGLAISEKMRGQIKGIN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
             + ++      + T++  L+ +  I+Q M    V        +         L    E 
Sbjct: 61  MAIKNSQDAISLIQTAEGALTEVHSILQRMRELAVQASSDTNTDVDRNQIQAELDQLREE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A  T+                +      +    +               ++    L
Sbjct: 121 IDRIARTTEFNTKKLLDGKLESFRADVDAKVVTGGNINLQLGDVSSAATEGTYIVEVGQL 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKY------------------- 224
             S  +A  +   +       S       N ++  +    +                   
Sbjct: 181 NGSETSALDVKITLITAGGTSSTVVTLGANSASLGNITFTWDSSVFSLSDFGGALPSGEV 240

Query: 225 -----------RIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKM 273
                           + I    +     +   +     G   ++    D       +K 
Sbjct: 241 VDSAVVRVEAVNTAANQLIFQIGSNEGHNMLTGIDDMSAGALGITTTSLDVTTQDAAEKA 300

Query: 274 LSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLST 333
           +  V   +  +  QRA LG  +  +      L      +    S+    +      + + 
Sbjct: 301 IMVVDAAIHKVSSQRAALGAVQNRLEHTIANLGVAAENLTAAESRVRDADMAKEMMEFTK 360

Query: 334 LINKIEMSYMITTKLQ 349
               ++ S  +  +  
Sbjct: 361 QQILLQSSMGMLAQAN 376


>gi|312882651|ref|ZP_07742388.1| flagellin [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309369612|gb|EFP97127.1| flagellin [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 381

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 32/371 (8%), Positives = 96/371 (25%), Gaps = 21/371 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           +   +     E + +GQ  +      A +        +   
Sbjct: 1   MTINVNTNVSALTAQRYLNKSTDELTTSMERLSSGQRINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++   +++Q +    +    G    ++       +    
Sbjct: 61  LDVAMRNANDGISISQTAEGAMNESTQLLQRIRDLALQSANGTNSLSERVALNEEVMALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGF--LEENSKSLLA 179
           +     A  T  G          E       +       +   +      +         
Sbjct: 121 DELNRIAETTSFGGRRLLNGQFGEAAFQIGASSGEAILMTLTSVRADEPRMGGQLFIADP 180

Query: 180 GQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVN 239
               +++    +   D   + + K  +D           D        + +   + A+V+
Sbjct: 181 LNAKDMNWSVPEPGNDIKFEFKTKDGEDVVVDLKAKKGDDIEELATYINGQTDKLEASVD 240

Query: 240 MRGIRDIMFVAVIGTE-------------------FLSKNLTDGARNVLTKKMLSTVQQG 280
              ++       +                        +    D       ++ ++ V   
Sbjct: 241 AGRLQIFAAGPNLQGNLTISGALAGELGLTGGPGALTTPQNIDVTTAGGAQRGVAIVDAA 300

Query: 281 LSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEM 340
           L  +  QRA LG  +  ++     L N    +    S+    +       ++      + 
Sbjct: 301 LKYVDSQRADLGAKQNRLSHSISNLANIQENVQASNSRIRDTDFAKETTAMTKAQILQQA 360

Query: 341 SYMITTKLQKL 351
              I  + ++L
Sbjct: 361 GTSILAQAKQL 371


>gi|91223533|ref|ZP_01258798.1| flagellin [Vibrio alginolyticus 12G01]
 gi|269967562|ref|ZP_06181614.1| flagellin FlaE [Vibrio alginolyticus 40B]
 gi|91191619|gb|EAS77883.1| flagellin [Vibrio alginolyticus 12G01]
 gi|269827800|gb|EEZ82082.1| flagellin FlaE [Vibrio alginolyticus 40B]
          Length = 379

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 40/371 (10%), Positives = 98/371 (26%), Gaps = 24/371 (6%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G+  +      A +      + +   
Sbjct: 1   MAITVNTNVAALVAQRHLTSATDMLNQSMERLSSGKRINSAKDDAAGLQISNRLQSQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  ++ +  I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIMQTAEGAMNEVTNIMQRMRDLSLQSANGSNSKAERTALQEEVSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G                  T     +     M    L   S S     
Sbjct: 121 DELSRIAETTSFGGRKLLNGTFGTSSFQIGATAGEAVQIGLRTMQPESLGSFSMSSYQRV 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +  N     + +    D   +++          D        + +   V A+VN  
Sbjct: 181 SSDWTVQNGNN--EIVISYRDNNFEEQEIRIEAKAGDDIEELATYINGQTDKVKASVNEE 238

Query: 242 ----------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQ 279
                                 G+ D + +    T   + +  D +     +  +  +  
Sbjct: 239 GQLQLLMSHKDAIKYPGPTFSGGLADELELGKYVTVNRTVDSIDISTVGGAQMAVGILDD 298

Query: 280 GLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIE 339
            L  +   RA LG  +   N     L N +  +    S+    +      Q+       +
Sbjct: 299 ALKTVDGSRAELGAYQNRFNHAINNLDNIHENLAASNSRIQDTDYAKETTQMVKQQILQQ 358

Query: 340 MSYMITTKLQK 350
           +S  I  + ++
Sbjct: 359 VSTSILAQAKQ 369


>gi|225374926|ref|ZP_03752147.1| hypothetical protein ROSEINA2194_00549 [Roseburia inulinivorans DSM
           16841]
 gi|225213247|gb|EEG95601.1| hypothetical protein ROSEINA2194_00549 [Roseburia inulinivorans DSM
           16841]
          Length = 430

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 33/383 (8%), Positives = 87/383 (22%), Gaps = 32/383 (8%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
           K   +  +      N +         K  E++ +G   +      A +T   +  ++   
Sbjct: 40  KIMVVQHNMQAMNANRMLNVTTGQQAKSTEKLSSGYRINRAADDAAGLTISEKMRKQIRG 99

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   +       + T++  L+ +  ++Q M    V    G    +        +    
Sbjct: 100 LDQASTNAQDGVSAVQTAEGALTEVHSMLQRMNELAVQSANGTNAQSDRDAIQAEITQLT 159

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 +  T   +      ++       + T     K +         + +  +L    
Sbjct: 160 TEINRVSETTKFNETYLLKGDTKGTKDVYFGTSRYGIKDNVTLYDANKTQLDENTLKDTL 219

Query: 182 HLEV-----SSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSA 236
                     +               KF D      +   A+             I +S 
Sbjct: 220 AKGGKVYKDQNATQLAKKGVDYAYVTKFYDANGKEVSAEKAATGGAAVYGDKNAQIKISD 279

Query: 237 NVNMRGIRDIMFVAVIGTEF---------------------------LSKNLTDGARNVL 269
           +         +    +  +                            L            
Sbjct: 280 DGTDLVTNKYVTKDSVNDDLVFNLHVGADSEINNKISVTIEEMSSKGLGVEGLKVDTEDD 339

Query: 270 TKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHA 329
               + T+   +  +  QR+ LG  +  +      L N         S+    +      
Sbjct: 340 ATVSIDTISAAIQKVSSQRSALGAVQNRLEHTIDNLDNVVENTTAAESRIRDTDMAEEMV 399

Query: 330 QLSTLINKIEMSYMITTKLQKLS 352
             S      +    +  +  + +
Sbjct: 400 NYSKNNILAQAGQSMLAQANQST 422


>gi|239996707|ref|ZP_04717231.1| flagellar hook-associated protein FlgL [Alteromonas macleodii ATCC
           27126]
          Length = 407

 Score =  156 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 44/407 (10%), Positives = 92/407 (22%), Gaps = 53/407 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST+ I+++      +   D  K  E++ +G+              +L   +E + + 
Sbjct: 1   MRISTNQIYDQNMRSIMQNQGDLAKTQEQLASGKRIITPSDDPVGAAKVLRLTEEIDELT 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +N LVT  L   +A L+++   V      ++    G  D+         L      
Sbjct: 61  QFQRNNDLVTGSLEQQEAVLTNITNSVNRARTLVIQAGSGALDSPDRKAIGAELEQIKLE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKS------- 176
                N  D           S      Y    +    +F         + S S       
Sbjct: 121 IFDLMNTQDAEGSYLYAGFQSGNQAFEYNPTATDKAITFTGDAGVSFVQLSNSSKIQSTS 180

Query: 177 -------------------LLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNA 217
                                     E S         F  +  D  +           A
Sbjct: 181 NGYEVFENVLSRYKFSTDPASTAVVSEASVKQQGTFDTFFDKNYDPVNTGNNDYRINFLA 240

Query: 218 SDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLST- 276
           S             ++  A  + +                                 +  
Sbjct: 241 SGQAELVNQGTGVIVESVAYTSGQPFTIKGMEFEATAVPGDSIDLSLDAPEKKSMAQTLH 300

Query: 277 --------------------------VQQGLSGIIEQRAVLGISEKNINEERVFLQNKNN 310
                                     +  GL  +  + A +G              +   
Sbjct: 301 EIQAVLNDSSIDSFELQESISDALVGLDNGLEKLSLEHASIGSRLNIAESIYESNLDMEI 360

Query: 311 IIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
                 S     +   A  + +     +  +     ++ +LS+ N++
Sbjct: 361 AAKASRSSIQDTDYAEASTEFAKQETALSAALATFPQVTELSLFNFI 407


>gi|163801834|ref|ZP_02195731.1| flagellin [Vibrio sp. AND4]
 gi|159174342|gb|EDP59146.1| flagellin [Vibrio sp. AND4]
          Length = 377

 Score =  156 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 100/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G+  +      A +      + +   
Sbjct: 1   MAITVNTNVAALVAQRHLTSATDMLNQSMERLSSGKRINSAKDDAAGLQISNRLQSQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  ++ +  I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIMQTAEGAMNEVTNIMQRMRDLSLQSANGSNSKAERTALQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  +             +     M    +E    S +A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGQSAFQIGAASGEAVQVELKSMRSDGIEMGGFSYIANG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                    +  +       D+F + E    N     D        + +   ++A+VN  
Sbjct: 181 RASSDWQVKEGASSLNMSFTDRFGETETIEINAKAGDDIEELATYINGQTDKITASVNEE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  LS +                    D       ++ ++ +   +  
Sbjct: 241 GQLQLFMAGEETSGALSFSGDLASELGLQLKGYDAVDNIDITSVGGAQQAVAVLDTAMKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   +     L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDSHRAELGAYQNRFDHAINNLDNIHENLAASNSRIQDTDYAKETTQMVKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|269960650|ref|ZP_06175022.1| flagellin FlaE [Vibrio harveyi 1DA3]
 gi|269834727|gb|EEZ88814.1| flagellin FlaE [Vibrio harveyi 1DA3]
          Length = 377

 Score =  155 bits (392), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 39/367 (10%), Positives = 99/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G+  +      A +      + +   
Sbjct: 1   MAITVNTNVAALVAQRHLTSATDMLNQSMERLSSGKRINSAKDDAAGLQISNRLQSQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  ++ +  I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIMQTAEGAMNEVTNIMQRMRDLSLQSANGSNSKAERTALQEEVSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  +             +     M    ++    S +A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGKSAFQIGAASGESVQVELKSMRSDGIDMGGFSYIANG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D      ++F + E    N     D        + +   V+A+VN  
Sbjct: 181 RASSDWKVKDGANDLSMSFTNRFGETETIQINAKAGDDIEELATYINGQTDKVTASVNEE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  LS +                    D       ++ ++ +   +  
Sbjct: 241 GQLQLFMAGEETSGTLSFSGDLASELGLQLKGYDAVDNIDITSVGGAQQAVAVLDTAMKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDSHRAELGAYQNRFNHAINNLDNIHENLAASNSRIQDTDYAKETTQMVKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|197285479|ref|YP_002151351.1| flagellin 1 [Proteus mirabilis HI4320]
 gi|227355970|ref|ZP_03840362.1| flagellin 1 [Proteus mirabilis ATCC 29906]
 gi|194682966|emb|CAR43381.1| flagellin 1 [Proteus mirabilis HI4320]
 gi|227163958|gb|EEI48860.1| flagellin 1 [Proteus mirabilis ATCC 29906]
          Length = 363

 Score =  155 bits (392), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 38/353 (10%), Positives = 95/353 (26%), Gaps = 4/353 (1%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+ +         +         E + +G   +      A       +    N 
Sbjct: 1   MAQVINTNYLSLVTQNNLNKSQGTLGSAIERLSSGLRINSAKDDAAGQAIANRFTSNVNG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q +    V    G   N+        +++  
Sbjct: 61  LTQASRNANDGISIAQTTEGALNEINNNLQRIRELTVQAKNGTNSNSDITSIQNEVKERL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  T            SE  +      +   K + D++    L   S  L   +
Sbjct: 121 DEINRISEQTQFNGVKVLSGEKSEMVIQVGTNDNETIKFNLDKVDNDTLGVASDKLFDAK 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +     A    D         +  +                ++   +G          
Sbjct: 181 TEKKGVTEAGAAIDAKDIGVAGATSYDSGTVKEYKVDGVVSADKVIFNDGTKDYLVNKSD 240

Query: 242 GIRDIMFVAVIGTEFLSKNLTDG----ARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKN 297
              +    A       ++   D         +    L+T+ + ++ I E R+ LG  +  
Sbjct: 241 FALEGADKAKFTGAKTTEFTADAGKDVKTLNVKDDALATLDKAINTIDESRSKLGAIQNR 300

Query: 298 INEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
                  L N  N +    S+ +  +  T  + +S      +    +  +  +
Sbjct: 301 FESTINNLNNTVNNLSASRSRILDADYATEVSNMSRGQILQQAGTSVLAQANQ 353


>gi|323498412|ref|ZP_08103408.1| flagellin [Vibrio sinaloensis DSM 21326]
 gi|323316485|gb|EGA69500.1| flagellin [Vibrio sinaloensis DSM 21326]
          Length = 379

 Score =  155 bits (392), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 38/370 (10%), Positives = 94/370 (25%), Gaps = 20/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           +   D     E + +GQ  +      A +        +   
Sbjct: 1   MTITVNTNVSAMTAQRYLNKATGDLNTSMERLSSGQQINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G   +++       +    
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTAILQRMRDLSLQSANGTNSDSERTAINEEVSALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G          E       +           +         +S ++ Q
Sbjct: 121 DELNRIAETTSFGGRKLLNGTFGEASFQIGASSGEAIIMGLTSIRADDFRMGGQSFISEQ 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D   +   K  D         +  D        + +   V A+V+  
Sbjct: 181 GKGKDWGVPANARDLKLEFTGKDGDLVTIDILAKDGDDIEELATYINGQTDLVKASVDQE 240

Query: 242 --------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
                               G+   + +        +    D       +  +  +   L
Sbjct: 241 GKLQIFASQAELKSDLSISGGLAGELGLNGGPGVQTTVQSIDVRSVGGAQNAVGIIDSAL 300

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +  QRA LG  +  ++     L N    ++   S+    +       ++      +  
Sbjct: 301 QYVDSQRADLGAKQNRLSHSINNLANIQENVEASNSRIRDTDFAKETTAMTKAQILQQAG 360

Query: 342 YMITTKLQKL 351
             I  + ++L
Sbjct: 361 TSILAQAKQL 370


>gi|261253606|ref|ZP_05946179.1| flagellin protein FlaC [Vibrio orientalis CIP 102891]
 gi|260936997|gb|EEX92986.1| flagellin protein FlaC [Vibrio orientalis CIP 102891]
          Length = 381

 Score =  155 bits (392), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 34/372 (9%), Positives = 96/372 (25%), Gaps = 22/372 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           +   D     E + +GQ  +      A +        +   
Sbjct: 1   MTITVNTNVSAMTAQRYLNKATGDLNTSMERLSSGQQINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q +    +    G    ++       +    
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTSILQRIRDLSLQSANGTNSASERQALHEEVAALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG- 180
           +     A  T  G       +  E       +           +         +S ++  
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGEASFQIGASSGEAIIMGLTSVRADDFRMGGQSFISAP 180

Query: 181 ---------------------QHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASD 219
                                   +  ++    +      +E+  +      +    + D
Sbjct: 181 ENAKDKDWGVPPTAKDLKFEFTTKDGEAVTLDIIAKEGDDIEEVATYINGQTDKLKASVD 240

Query: 220 HNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQ 279
            + + +I   E           G+   + +        +    D       +  +  V  
Sbjct: 241 EDGRLQIFAAEPNLEGNLNISGGLAGELGLTGGAGVNTTVQNIDVNTVGGAQNAVGIVDA 300

Query: 280 GLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIE 339
            L  +  QRA LG  +  ++     L N    ++   S+    +       ++      +
Sbjct: 301 ALKYVDSQRADLGAKQNRLSHSINNLANIQENVEASNSRIRDTDFAKETTAMTKAQILQQ 360

Query: 340 MSYMITTKLQKL 351
               I  + ++L
Sbjct: 361 AGTSILAQAKQL 372


>gi|262166246|ref|ZP_06033983.1| flagellin protein FlaF [Vibrio mimicus VM223]
 gi|262025962|gb|EEY44630.1| flagellin protein FlaF [Vibrio mimicus VM223]
          Length = 378

 Score =  155 bits (392), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 105/367 (28%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             ++   +  E + +G   +      A +      E +   
Sbjct: 1   MAMTVNTNVSALVAQRHLNSASEMLSQSLERLSSGNRINSAKDDAAGLQISNRLETQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           ++  + + +     + T++  +    +++Q M    +    G   + +       +    
Sbjct: 61  LSIAVRNANDGISIMQTAEGAMQETTQLLQRMRDLSLQSANGSNSSAERTALQEEMAALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T          +  +       +     + S   M    L+    S +A  
Sbjct: 121 DELNRIAETTSFAGRKLLNGHFEKASFQIGSSSGEAVQLSLRNMRSDSLDMGGFSYVAAA 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +     A+          +   ++E          D        + +   VSA+VN +
Sbjct: 181 MADKKWQVAKGKQQLNISYVNALGENENIQIQAKEGDDIEELATYINGQTDKVSASVNEK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  LS + +                  D +     ++ +S +   L  
Sbjct: 241 GQLQLYIAGKETSGTLSFSGSLANELQLNLLGYEAVDNLDISSAGGAQRAVSVIDTALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   R+ LG  +   +     L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDGHRSELGALQNRFHHAISNLDNVHENLAASNSRIKDADYAKETTQMIKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKR 367


>gi|332140553|ref|YP_004426291.1| flagellar hook-associated protein FlgL [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327550575|gb|AEA97293.1| flagellar hook-associated protein FlgL [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 404

 Score =  155 bits (392), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 39/404 (9%), Positives = 101/404 (25%), Gaps = 50/404 (12%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST+ I+++          D     E++ +G+               L   +E + + 
Sbjct: 1   MRISTNQIYDQNIRSILNNQSDLANTQEQLASGKKLLKPSDDPVGAAKALRLTEELDSLT 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +N LVT  L   +  L+++   +       +    G   +      +  L+     
Sbjct: 61  QYQRNNDLVTGSLELQETVLTNVTNSINRARTLAIQAGNGAYSSADRAAISSELKQIKLE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +   N  D           S K    +    +    SF+        + S S       
Sbjct: 121 ILDLMNTKDANGNYLYSGYQSGKQAFEFEPSSNGNAVSFNGDQGVNFVQLSDSAKIQSTS 180

Query: 184 EV------------SSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEG 231
                          +++   +            + + +     +A++++ +     +  
Sbjct: 181 SGFEVFENVQSRYKFTVDPASVVVPTVSEIANQDNFDNFFKANYDATNNDFRVNFLASGQ 240

Query: 232 IDVSANVNMRGIRDIMFVAVIGTEFLSKN------------------------------- 260
            ++        +  + F   +                                       
Sbjct: 241 AELVNQGTGAVLDSVDFSFGVPFTLQGMKFEANASPGDSFDFSLDAPQNKSMAQTLHELE 300

Query: 261 -------LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIID 313
                   ++          L  +  GL  I  +RA +G              +      
Sbjct: 301 TLLSNSSASNDLLEEGIADALIGLDNGLEIISLERASIGGRLNIAESISKSNFDLEIAAQ 360

Query: 314 TYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
              S     +      + +     +  +     K+ +LS+ N++
Sbjct: 361 ASRSSIEDADFAKLSTEFAKQEAALNAALATFPKVSELSLFNFI 404


>gi|258621093|ref|ZP_05716127.1| flagellin FlaE [Vibrio mimicus VM573]
 gi|258586481|gb|EEW11196.1| flagellin FlaE [Vibrio mimicus VM573]
          Length = 378

 Score =  155 bits (391), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 105/367 (28%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             ++   +  E + +G   +      A +      E +   
Sbjct: 1   MAMTVNTNVSALVAQRHLNSASEMLSQSLERLSSGNRINSAKDDAAGLQISNRLETQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           ++  + + +     + T++  +    +++Q M    +    G   + +       +    
Sbjct: 61  LSIAVRNANDGISIMQTAEGAMQETTQLLQRMRDLSLQSANGSNSSAERTALQEEMAALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T          +  +       +     + S   M    L+    S +A  
Sbjct: 121 DELNRIAETTSFAGRKLLNGHFEKASFQIGASSGEAVQLSLRNMRSDSLDMGGFSYVAAA 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +     A+          +   ++E          D        + +   VSA+VN +
Sbjct: 181 MADKKWQVAKGKQQLNISYVNALGENENIQLQAKEGDDIEELATYINGQTDKVSASVNEK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  LS + +                  D +     ++ +S +   L  
Sbjct: 241 GQLQLYIAGKETSGTLSFSGSLANELQLNLLGYEAVDNLDISSAGGAQRAVSVIDTALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   R+ LG  +   +     L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDGHRSELGALQNRFHHAISNLDNVHENLAASNSRIKDADYAKETTQMIKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKR 367


>gi|194014229|ref|ZP_03052846.1| flagellin [Bacillus pumilus ATCC 7061]
 gi|194013255|gb|EDW22820.1| flagellin [Bacillus pumilus ATCC 7061]
          Length = 323

 Score =  155 bits (391), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 33/348 (9%), Positives = 82/348 (23%), Gaps = 36/348 (10%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +             N  S K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINHNIAALNTLNRLSANNGASQKNMEKLSSGLKINRAGDDAAGLAISEKMRGQIRGLK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLE-GKTDNNKFPINAGMLRDSYE 122
               +       + T++  L+    I+Q +   +V     G             +    E
Sbjct: 61  MASKNAQDGISLIQTAEGALTETHSILQRVRELVVQAGNTGTQQGEDLTAIKDEITALVE 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                +N T+                                               G  
Sbjct: 121 EVDGISNRTEFNGKKLLNG-----------------------------------TFNGVG 145

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
              +  N     D               A  +   ++   + ++   +    +  V    
Sbjct: 146 TPGTPANPPTDPDDPSTGTPAVPATPGDALVFQIGANATQQIKVNIQDMSAAALGVTDAD 205

Query: 243 IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEER 302
                  +V   +           +      L+ V   +  +  QRA LG  +  +    
Sbjct: 206 GAVETGKSVKDIDVSKFETIAADDDGGFDDQLAIVDGAIKQVSAQRAKLGAVQNRLEHTI 265

Query: 303 VFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
             L   +  +    S+   V+     ++ +      + S  +  +  +
Sbjct: 266 NNLGASSENLTAAESRIRDVDMAKEMSEFTKNNILSQASQAMLAQANQ 313


>gi|56421671|ref|YP_148989.1| flagellar hook-associated protein FlgL [Geobacillus kaustophilus
           HTA426]
 gi|56381513|dbj|BAD77421.1| flagellar hook-associated protein 3 [Geobacillus kaustophilus
           HTA426]
          Length = 297

 Score =  155 bits (391), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 35/354 (9%), Positives = 98/354 (27%), Gaps = 58/354 (16%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ S +   M        +   +   ++ TG+               + +      + 
Sbjct: 1   MRITQSMLANNMLKQITRSYEKLDQYQTQLSTGKKITRPSDDPVVAMKGIAYRSNLAEVE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + S     +  S + L    + +Q +   +V       +  +    A  +R   E 
Sbjct: 61  QFKRNFSEAYNWVENSDSALDKATQALQRIRELVVQASNDTYEETQRQSIAKEVRQLTEH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            VT AN     +Y+F+G  ++E P+                                   
Sbjct: 121 LVTIANTKVGDKYIFNGAKTTEPPVTVNP------------------------------- 149

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           + +   +        +L            + +  +   +   +++      + +     +
Sbjct: 150 DGTISVSTNSQQLNIELAKGIYIPVNIPPSTAFGAGSGLFSDLQNLAASLENPSTTGNDL 209

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
              +                                 L+ ++  RA LG     I     
Sbjct: 210 TGYLDKLDSH---------------------------LTNLLGVRAELGARMNRIELMED 242

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            + ++  I +  +S +  V+       L T  +    +  +  ++ + +++++L
Sbjct: 243 RIDSQQVIAEKMLSDNEDVDLEKVITDLKTQESVHRAALAVGARVIQPTLVDFL 296


>gi|88704299|ref|ZP_01102013.1| flagellar hook associated protein type 3 FlgL [Congregibacter
           litoralis KT71]
 gi|88701350|gb|EAQ98455.1| flagellar hook associated protein type 3 FlgL [Congregibacter
           litoralis KT71]
          Length = 402

 Score =  155 bits (391), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 56/402 (13%), Positives = 127/402 (31%), Gaps = 46/402 (11%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST  IF+       +   D  +  +E+ TG+         +    IL+ E++   
Sbjct: 1   MVDRLSTLQIFQSGISTILDKQADLARTQQELATGKRIQSPSDDPSGAVKILDLEEDIRL 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + SL   +L+  +  LS++  ++Q +    V               A  +    
Sbjct: 61  VDQYQRNASLAEGQLAVEETTLSAVNNVLQRVRELTVQANNATQSPETRASIAVEVNARI 120

Query: 122 ESFVTFANMTDEGQ-YLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
           E  V  AN  D    YLF+G  +  +P +      + +     + L            +G
Sbjct: 121 EELVALANTRDGNDEYLFAGFQAQTQPFSRQGGTVTYSGDDGQRFLDIAASAQVAVRDSG 180

Query: 181 QHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANN--------------------------- 213
             + ++        DF     +  +     ++                            
Sbjct: 181 SRVFLAVDAGNGSFDFAADPANTGTAVVAESSADGSFVRDDYTVTFSQATPADPVTYSVT 240

Query: 214 ------------------WSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTE 255
                               N +   I+   +D + I + +         +  +A     
Sbjct: 241 DSSAAVVATGNYTPGDAISFNGARLVIEGTPEDGDSITLDSAPKQSIFDTLQGIADALEN 300

Query: 256 FLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTY 315
                    A N      L+ + Q +  ++E ++ +G+    I  ++   ++ N  + T 
Sbjct: 301 SAGTPSGSAAVNNALASGLNNLDQAIGNVLEVQSDVGVRLNRIESQQSINEDFNLQLQTT 360

Query: 316 ISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +S    V+   A ++L+  +  ++ +       Q L++ NYL
Sbjct: 361 LSDVQDVDFAEAISKLNLQLVALQAAQQTYVTTQGLTLFNYL 402


>gi|254516996|ref|ZP_05129054.1| flagellar hook-associated protein 3 [gamma proteobacterium NOR5-3]
 gi|219674501|gb|EED30869.1| flagellar hook-associated protein 3 [gamma proteobacterium NOR5-3]
          Length = 402

 Score =  155 bits (391), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 54/402 (13%), Positives = 123/402 (30%), Gaps = 46/402 (11%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST  I++       E   D  +   E+ TG+         +    IL+ E++   
Sbjct: 1   MVDRLSTLQIYQSGISTILEKQADLARTQLELATGKRIQSPSDDPSGAVKILDLEEDIRL 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + SL   +L+  ++ L+ +  ++Q +    V               A  ++   
Sbjct: 61  VDQYQRNASLAQGQLAVEESTLTGVNNVLQRVRELTVQANNATQSPETRASIAVEVKARL 120

Query: 122 ESFVTFANMTDEGQ-YLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
           E  V  AN  D    YLF+G  +  +P          +     + L            +G
Sbjct: 121 EELVALANTRDGNDEYLFAGFQAQTQPFTQQGGTVVYSGDDGQRFLDIAASAQVAVRDSG 180

Query: 181 QHLEVSSMNAQQMTDFIKQLEDKFSDDEY------------------------------- 209
             + ++        DF     +  +                                   
Sbjct: 181 SRVFLAVDAGNGSFDFSAAATNSGTAVVSESSADNSFVRDDYTVTFSQLTPADPITYSVT 240

Query: 210 --------------WANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTE 255
                               N +   I+   +D + I++ +         +  +      
Sbjct: 241 DSGAAVVATGNYTPGEAISFNGARLVIEGTPEDGDSINIDSAPKQSIFETLQGIVDALEN 300

Query: 256 FLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTY 315
             S      A N      L+ + Q +  ++E ++ +G+    I  ++   +  N  + T 
Sbjct: 301 SSSSPSGGAAVNNALASGLNNLDQAIGNVLEVQSDVGVRLNRIESQQSINEEFNLQLQTT 360

Query: 316 ISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +S    V+   A ++L+  +  ++ +       Q L++ NY+
Sbjct: 361 LSDVQDVDFAEAISKLNLQLVALQAAQQTYVTTQGLTLFNYI 402


>gi|262170869|ref|ZP_06038547.1| flagellin protein FlaF [Vibrio mimicus MB-451]
 gi|261891945|gb|EEY37931.1| flagellin protein FlaF [Vibrio mimicus MB-451]
          Length = 378

 Score =  155 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 105/367 (28%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             ++   +  E + +G   +      A +      E +   
Sbjct: 1   MAMTVNTNVSALVAQRHLNSASEMLSQSLERLSSGNRINSAKDDAAGLQISNRLETQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           ++  + + +     + T++  +    +++Q M    +    G   + +       +    
Sbjct: 61  LSIAVRNANDGISIMQTAEGAMQETTQLLQRMRDLSLQSANGSNSSAERTALQEEMAALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T          +  +       +     + S   M    L+    S +A  
Sbjct: 121 DELNRIAETTSFAGRKLLNGHFEKASFQIGASSGEAVQLSLRNMRSDSLDMGGFSYVAAA 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +     A+          +   ++E          D        + +   VSA+VN +
Sbjct: 181 MADKKWQVAKGKQQLNISYVNALGENENIQLQAKEGDDIEELATYINGQTDKVSASVNEK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   I          LS + +                  D +     ++ +S +   L  
Sbjct: 241 GQLQIYIAGKETAGTLSFSGSLANELQLNLLGYEAVDNLDISSAGGAQRAVSVIDTALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   R+ LG  +   +     L N +  + T  S+    +      Q+       ++S  
Sbjct: 301 VDGHRSELGALQNRFHHAISNLDNVHENLATSNSRIKDADYAKETTQMIKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKR 367


>gi|118443899|ref|YP_877946.1| flagellar hook-associated protein 3 [Clostridium novyi NT]
 gi|118134355|gb|ABK61399.1| flagellar hook-associated protein 3, putative [Clostridium novyi
           NT]
          Length = 325

 Score =  155 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 41/354 (11%), Positives = 104/354 (29%), Gaps = 30/354 (8%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++   +        K   ++  K+ ++  +G+           V   ++   + N   
Sbjct: 1   MRVTNKMLSNNFLADMKTNLENINKIQQQNTSGKKFRKPSDDPFAVARSMQLHTDINTNK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + + V+  L T+   L     ++Q +   L+    G    ++       + +    
Sbjct: 61  QYSKNITDVSNWLDTTDTALGQAGNVLQRVRELLISSGNGGYTKSERRAIKDEINEKIGE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N    G Y+F G  S+ KP+       +       +      +   +        
Sbjct: 121 MSQILNTNFGGNYIFGGSRSTTKPMEVDKANGNTILIYNKKEGGKLDKTKDQDEYTQIAS 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           ++    +Q +T           +                                N  G 
Sbjct: 181 KLKIEVSQGVTMDYNVTATDVLE------------------------------FKNEAGA 210

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
              +   +        +      N L  + L+ +   +S +++ RA +G  +  I     
Sbjct: 211 PKDLRDILSKITSHLDSEKPEEINKLIGQDLTNITDAISNVLKIRAEIGAKQNRIEGAND 270

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             ++    +   +SK   V         +T++     S   + K+ + S+++YL
Sbjct: 271 RNKDATFNMTKILSKHEDVNYTENMTDYATMLTVYMASLQTSAKIIQPSLMDYL 324


>gi|260772282|ref|ZP_05881198.1| flagellin protein FlaC [Vibrio metschnikovii CIP 69.14]
 gi|260611421|gb|EEX36624.1| flagellin protein FlaC [Vibrio metschnikovii CIP 69.14]
          Length = 351

 Score =  155 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 38/342 (11%), Positives = 88/342 (25%), Gaps = 20/342 (5%)

Query: 30  HEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLVTKRLSTSQAHLSSMQKI 89
            E + +G   +      A +        +   +   + + +       T++  ++    I
Sbjct: 1   MERLSSGNRINSAKDDAAGLQISNRLIAQSRGLDVAMRNANDGISIAQTAEGAMNESTSI 60

Query: 90  VQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANMTDEGQYLFSGINSSEKPLN 149
           +Q M    +    G   + +            +     A  T  G       +  E    
Sbjct: 61  LQRMRDLALQSANGTNSDAERQALNEESVALQDELNRIAETTSFGGRRLLNGSFGEASFQ 120

Query: 150 GYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEY 209
              +           +         +S +A +             D   +   K   +  
Sbjct: 121 IGSSSGEAIIMGLTSIRADDYRMGGQSFIATEGKNKDWGVDPTANDLKLEFTKKDGQEVT 180

Query: 210 WANNWSNASDHNIKYRIKDTEGIDVSANVNMR--------------------GIRDIMFV 249
                    D        + +   + A+V+                      G+   + +
Sbjct: 181 LDILAKTGDDIEELATYINGQTDLLKASVDEDGKLQIFVAEPHIEGDLTISGGLATELGL 240

Query: 250 AVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKN 309
           A    E  +    D      ++  +  +   L  I  QRA LG  +  +N     L N  
Sbjct: 241 AGGPGEKTTVQNIDMRTVGGSQNAVGILDAALKYIDSQRADLGAKQNRLNHSINNLANIQ 300

Query: 310 NIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKL 351
             ++   S+    +      QL+      +    I  + ++L
Sbjct: 301 ENVEASKSRIKDTDFAKETTQLTKSQILQQAGTSILAQAKQL 342


>gi|156975443|ref|YP_001446350.1| flagellin [Vibrio harveyi ATCC BAA-1116]
 gi|156527037|gb|ABU72123.1| hypothetical protein VIBHAR_03174 [Vibrio harveyi ATCC BAA-1116]
          Length = 377

 Score =  155 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 99/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G+  +      A +      + +   
Sbjct: 1   MAITVNTNVAALVAQRHLTSATDMLNQSMERLSSGKRINSAKDDAAGLQISNRLQSQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  ++ +  I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIMQTAEGAMNEVTNIMQRMRDLSLQSANGSNSKAERTALQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  +             +     M    ++    S +A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGKSAFQIGAASGEAVQVELKSMRSDGIDMGGFSYVANG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D      ++F + E    N     D        + +   V+A+V+  
Sbjct: 181 RANSDWQVKDGANDLSMSFTNRFGETETIQINAKAGDDIEELTTYINGQTDKVTASVDEE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  LS +                    D       ++ ++ +   +  
Sbjct: 241 GQLQLFMAGEETSGTLSFSGDLASELGLQLKGYDAVDNIDITSVGGAQQAVAVLDTAMKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDSHRAELGAYQNRFNHAINNLDNIHENLAASNSRIQDTDYAKETTQMVKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|1169696|sp|P42272|FLIC1_PROMI RecName: Full=Flagellin 1
 gi|150886|gb|AAA62396.1| FlaA [Proteus mirabilis]
          Length = 365

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 44/355 (12%), Positives = 102/355 (28%), Gaps = 6/355 (1%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+ +         +         E + +G   +      A       +    N 
Sbjct: 1   MAQVINTNYLSLVTQNNLNKSQGTLGSAIERLSSGLRINSAKDDAAGQAIANRFTSNVNG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q +    V    G   N+        +++  
Sbjct: 61  LTQASRNANDGISIAQTTEGALNEINNNLQRIRELTVQAKNGTNSNSDITSIQNEVKNVL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  T            SE  +      +   K + D++    L   S  L   +
Sbjct: 121 DEINRISEQTQFNGVKVLSGEKSEMVIQVGTNDNETIKFNLDKVDNDTLGVASDKLFDTK 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDD------EYWANNWSNASDHNIKYRIKDTEGIDVS 235
             +     A       K++    + D      + +  +    +D  I  +         S
Sbjct: 181 TEKKGVTAAGAGVTDAKKINAAATLDMMVSLVKEFNLDGKPVTDKFIVTKGGKDYVATKS 240

Query: 236 ANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISE 295
                     +   A   TEF      D     +    L+T+ + ++ I E R+ LG  +
Sbjct: 241 DFELDATGTKLGLKASATTEFKVDAGKDVKTLNVKDDALATLDKAINTIDESRSKLGAIQ 300

Query: 296 KNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
                    L N  N +    S+ +  +  T  + +S      +    +  +  +
Sbjct: 301 NRFESTINNLNNTVNNLSASRSRILDADYATEVSNMSRGQILQQAGTSVLAQANQ 355


>gi|153836942|ref|ZP_01989609.1| polar flagellin B/D [Vibrio parahaemolyticus AQ3810]
 gi|149749715|gb|EDM60460.1| polar flagellin B/D [Vibrio parahaemolyticus AQ3810]
          Length = 397

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 43/368 (11%), Positives = 91/368 (24%), Gaps = 19/368 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 20  MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 79

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +       +    
Sbjct: 80  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 139

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K                  M          S  A  
Sbjct: 140 DELNRIAETTSFGGNKLLNGTHGAKSFQIGADNGEAVMLELKDMRSDNKMMGGVSYQAES 199

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   AQ   D    L D F  ++    N     D        + +   V A+V+  
Sbjct: 200 GKGKDWNVAQGKNDLKISLTDSFGQEQEININAKAGDDIEELATYINGQTDLVKASVDQD 259

Query: 242 GIRDIMFVAV-------------------IGTEFLSKNLTDGARNVLTKKMLSTVQQGLS 282
           G   I                           + ++ +  D       ++ ++ +   L 
Sbjct: 260 GKLQIFAGNNKVEGEVSFSGGLSGELGLGDDKKNVTVDTIDVTSVGGAQESVAIIDAALK 319

Query: 283 GIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSY 342
            +   RA LG  +   N     L N N  ++   S+    +       ++      + S 
Sbjct: 320 YVDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTAMTKSQILSQASS 379

Query: 343 MITTKLQK 350
            I  + ++
Sbjct: 380 SILAQAKQ 387


>gi|298346039|ref|YP_003718726.1| flagellin family protein [Mobiluncus curtisii ATCC 43063]
 gi|298236100|gb|ADI67232.1| flagellin family protein [Mobiluncus curtisii ATCC 43063]
          Length = 317

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 22/346 (6%), Positives = 76/346 (21%), Gaps = 42/346 (12%)

Query: 5   GISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAE 64
            I+ + +             +  K  E++ +G   +      + +        +     +
Sbjct: 4   SINQNIMAMNSYRNLSLTQSNLGKSLEKLSSGFRINRAADDSSGLAISEGLRSQVRGNKQ 63

Query: 65  RLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESF 124
            + +       + T++  L+ +  ++Q M    V       D+         +       
Sbjct: 64  AVKNAQDGISVVQTAEGALNEVHDMLQRMRELAVKGANDTNDSKARAFIEQEMGQLKMEL 123

Query: 125 VTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLE 184
           V     T+                                                    
Sbjct: 124 VRVGASTNFDGRKLLW------------------------------------------NG 141

Query: 185 VSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIR 244
                   +T     + +    D+      S            D +  D+S  +      
Sbjct: 142 AKVDKDTVVTGSDFAIAETAGKDQAEWWGKSKGVLAFQVGANGDAQVDDISVQLEDLVTT 201

Query: 245 DIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVF 304
            +  +    +   ++       +      +  +   +  + + R+  G  +         
Sbjct: 202 TLKSLDTKYSVKGTEADIAIKDHKGYMAEIGKIDTAIHAVSKLRSDFGSVQNRFEHTINN 261

Query: 305 LQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
           L      +    ++    +  +   Q +      +    +  +  +
Sbjct: 262 LNVAVENLSASEARIRDTDMASEMMQFTRGQILQQAGTSMLAQANQ 307


>gi|157363124|ref|YP_001469891.1| flagellin domain-containing protein [Thermotoga lettingae TMO]
 gi|157313728|gb|ABV32827.1| flagellin domain protein [Thermotoga lettingae TMO]
          Length = 387

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 29/376 (7%), Positives = 81/376 (21%), Gaps = 30/376 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +           +      K  E++ +G   +      A +    +   + + + 
Sbjct: 1   MRINHNISALNAWRSMDQTQYSMSKTLEKLSSGLRINRAGDDAAGLAISEKMRGQISGLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
             + +       + T++  L+ +  I+Q M    V        +         L    E 
Sbjct: 61  MAVKNAQDAISLIQTAEGALTEVHSILQRMRELAVQAASDTNTDVDRNQVQAELDQLREE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A  T+                +      +    +               ++    L
Sbjct: 121 IDRIARTTEFNTMKLLDGKIESFRASPDAKVVTAGNINLQLGSVSSAAVEGTYVVEVGQL 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVS-------- 235
             +  +A  +   +       S         +   +    +        D          
Sbjct: 181 NGTETSALDVKITLFTAGGSNSVIANITAGGAAIGNITFTWDTNVISLADFGGALPVGEV 240

Query: 236 ------------ANVNMRGIRDIMFVAVIGTEFLSKN----------LTDGARNVLTKKM 273
                          +    +            +               D       ++ 
Sbjct: 241 VDSAVARVEAAVTTASQLVFQIGANEGHNMVSGIDDMRAAALGLTSTSLDVKDQDNAERT 300

Query: 274 LSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLST 333
           +  +   +  +   RA LG  +  +      L      +    S+    +      Q + 
Sbjct: 301 VMVIDAAIHKVSSARAQLGAVQNRLEHTISNLGVAAENLTAAESRIRDADMAKEMMQFTK 360

Query: 334 LINKIEMSYMITTKLQ 349
               I+ S  +  +  
Sbjct: 361 QQILIQSSMAMLAQAN 376


>gi|254508448|ref|ZP_05120568.1| flagellin A [Vibrio parahaemolyticus 16]
 gi|219548658|gb|EED25663.1| flagellin A [Vibrio parahaemolyticus 16]
          Length = 368

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 36/359 (10%), Positives = 89/359 (24%), Gaps = 20/359 (5%)

Query: 13  ERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLV 72
                   +   D     E + +GQ  +      A +        +   +   + + +  
Sbjct: 1   MTAQRYLNKATGDLNTSMERLSSGQQINSAKDDAAGLQISNRLTAQSRGLDVAMRNANDG 60

Query: 73  TKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANMTD 132
                T++  ++    I+Q M    +    G   +++       +    +     A  T 
Sbjct: 61  ISIAQTAEGAMNESTAILQRMRDLSLQSANGTNSDSERTAINEEVSALQDELNRIAETTS 120

Query: 133 EGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQ 192
            G          E       +           +         +S ++ Q           
Sbjct: 121 FGGRKLLNGTFGEASFQIGASSGEAIIMGLTSIRADDFRMGGQSFISEQGKGKDWGVPAN 180

Query: 193 MTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR----------- 241
             D   +   K  D         +  D        + +   V A+V+             
Sbjct: 181 ARDLKLEFTGKDGDLVTIDILAKDGDDIEELATYINGQTDLVKASVDEEGKLQLFASQAE 240

Query: 242 ---------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLG 292
                    G+   + +        +    D       +  +  +   L  +  QRA LG
Sbjct: 241 LKSDLSISGGLAGELGLNGGPGVQTTVQSIDVRSVGGAQNAVGIIDSALQYVDSQRADLG 300

Query: 293 ISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKL 351
             +  ++     L N    ++   S+    +       ++      +    I  + ++L
Sbjct: 301 AKQNRLSHSINNLANIQENVEASNSRIRDTDFAKETTAMTKAQILQQAGTSILAQAKQL 359


>gi|323340178|ref|ZP_08080442.1| flagellin family protein [Lactobacillus ruminis ATCC 25644]
 gi|323092369|gb|EFZ34977.1| flagellin family protein [Lactobacillus ruminis ATCC 25644]
          Length = 393

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 34/348 (9%), Positives = 85/348 (24%), Gaps = 13/348 (3%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
           +  I+T+    R        N    K    + +G+  +      A     ++   + + +
Sbjct: 41  SMRINTNVDAMRAYSNYATWNAAKSKSLLRISSGKRINSFADDPAGACIAVKMGVQVSGL 100

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
                +       + T++  L+    I+  M    V    G              +   +
Sbjct: 101 KVAKRNAQDGISLIQTAEGALNETHSILGRMRDLAVQAANGTLTYEDRAAIDKEFQALRQ 160

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                 N +          + ++  L                M                 
Sbjct: 161 EIDRIGNSSQFNTINLLDGSRNKITLQVGANAGQTMDVELSDMR-------------FDA 207

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
           +  ++     +TD   Q  D               +D    Y           A      
Sbjct: 208 IFKTTNGKLSVTDANGQTVDVEMGLCGSQETIKKYNDAKDAYNAAANSLALAKAKGQNTS 267

Query: 243 IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEER 302
             +    A            +         +++ V + +S +  QRA LG ++  +    
Sbjct: 268 ALEQEVAAKKAAFEKVGQDLNREGQNYATIVMNQVDKAISTVSLQRAGLGATQNALQHTI 327

Query: 303 VFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            +L+N    +    S+    +        +      +++  +  +   
Sbjct: 328 NYLENSAINLSDAQSRIEDCDIAEEMMNFTKANLMSQVAAAMLAQANS 375


>gi|168187527|ref|ZP_02622162.1| flagellar hook-associated protein 3 [Clostridium botulinum C str.
           Eklund]
 gi|169294602|gb|EDS76735.1| flagellar hook-associated protein 3 [Clostridium botulinum C str.
           Eklund]
          Length = 327

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 44/354 (12%), Positives = 109/354 (30%), Gaps = 28/354 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++   +        +   ++  K+ ++  +G+           V   ++   + N   
Sbjct: 1   MRVTNKMLSNNFLADMRTNLENINKIQQQNTSGKKFRKPSDDPFAVARSMQLHTDINTNK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + + V+  L T+   L     ++Q +   L+    G    ++       + +    
Sbjct: 61  QYSKNITDVSNWLDTTDTALGQAGNVLQRVRELLISSGNGGYTKSERRAIKDEINEKIGE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N    G Y+FSG  S+ KP+     K +   K      +                
Sbjct: 121 MSQILNTNFGGNYIFSGSRSTTKPMEVEVDKTTGNTKLIYNKKE-------------GGE 167

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
              +++  +      +L+ + S       N +                       N  G 
Sbjct: 168 LDKTVDKDEYNQIASKLKIEVSQGVTMDYNVTATDVLE---------------FKNETGD 212

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
              +   +        +      N L  + L+ +   +S +++ RA +G  +  I     
Sbjct: 213 DKNLREILSNIVTHLDSEDPDEINKLIGEDLTNITDSISNVLKIRAEVGAKQNRIEGADD 272

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             ++    +   +SK   V         +T++     S   + K+ + S+++YL
Sbjct: 273 RNKDGTFNMTKILSKHEDVNYTENMTDYATMLTVYMASLQTSAKIIQPSLMDYL 326


>gi|261420581|ref|YP_003254263.1| flagellar hook-associated protein FlgL [Geobacillus sp. Y412MC61]
 gi|319768251|ref|YP_004133752.1| flagellar hook-associated protein 3 [Geobacillus sp. Y412MC52]
 gi|261377038|gb|ACX79781.1| flagellar hook-associated protein 3 [Geobacillus sp. Y412MC61]
 gi|317113117|gb|ADU95609.1| flagellar hook-associated protein 3 [Geobacillus sp. Y412MC52]
          Length = 297

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 35/354 (9%), Positives = 97/354 (27%), Gaps = 58/354 (16%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ S +             +  K   ++ TG+               + +      + 
Sbjct: 1   MRITQSMLANNTLKQITRSYANLDKYQTQLSTGKKITRPSDDPVVAMKGIAYRSNLAEVE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + S     +  S + L    + +Q +   +V       +  +    A  +R   E 
Sbjct: 61  QFKRNFSEAYNWVENSDSALDKATQALQRIRELVVQASNDTYEETQRQSIAKEVRQLTEH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            VT AN     +Y+F+G  ++E P+                                   
Sbjct: 121 LVTIANTKVGDKYIFNGAKTTEPPVTVNP------------------------------- 149

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           + +   +        +L            + +  +   +   +++      + +     +
Sbjct: 150 DGTISVSTNSQQLNIELAKGIYIPVNIPPSTAFGAGSGLFSDLQNLAASLENPSTTGNDL 209

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
              +                                 L+ ++  RA LG     I     
Sbjct: 210 TGYLDKLDSH---------------------------LTNLLGVRAELGARMNRIELMED 242

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            + ++  I +  +S +  V+       L T  +    +  +  ++ + +++++L
Sbjct: 243 RIDSQQVIAEKMLSDNEDVDLEKVITDLKTQESVHRAALAVGARVIQPTLVDFL 296


>gi|323495369|ref|ZP_08100446.1| flagellin [Vibrio brasiliensis LMG 20546]
 gi|323310292|gb|EGA63479.1| flagellin [Vibrio brasiliensis LMG 20546]
          Length = 381

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 33/372 (8%), Positives = 97/372 (26%), Gaps = 22/372 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           +   D     E + +GQ  +      A +        +   
Sbjct: 1   MTITVNTNVSAMTAQRYLNKATGDLNTSMERLSSGQQINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q +    +    G    ++       +    
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTSILQRIRDLSLQSANGTNSASERQALHEEVSALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG- 180
           +     A  T  G       +  E       +           +         ++ ++  
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGEASFQIGASSGEAIIMGLTSVRADDFRMGGQTFISDA 180

Query: 181 ---------------------QHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASD 219
                                   +  ++    +      +E+  +      + +  + D
Sbjct: 181 EKAKDKDWGVPTAAKDLKFEFTTKDGEAITLDIIAKEGDDIEELATYINGQTDKFKASVD 240

Query: 220 HNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQ 279
            + + +I   E           G+   + +        +    D       +  +  V  
Sbjct: 241 QDGRLQIFAAEPNLEGNLNISGGLASELGLNGGPGVQTTVQNIDVRSVGGAQNAVGIVDA 300

Query: 280 GLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIE 339
            L  +  QRA LG  +  ++     L N    ++   S+    +       ++      +
Sbjct: 301 ALKYVDSQRADLGAKQNRLSHSINNLANIQENVEASNSRIRDTDFAKETTAMTKAQILQQ 360

Query: 340 MSYMITTKLQKL 351
               I  + ++L
Sbjct: 361 AGTSILAQAKQL 372


>gi|153834131|ref|ZP_01986798.1| flagellin [Vibrio harveyi HY01]
 gi|148869501|gb|EDL68499.1| flagellin [Vibrio harveyi HY01]
          Length = 377

 Score =  154 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 99/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G+  +      A +      + +   
Sbjct: 1   MAITVNTNVAALVAQRHLTSATDMLNQSMERLSSGKRINSAKDDAAGLQISNRLQSQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  ++ +  I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIMQTAEGAMNEVTNIMQRMRDLSLQSANGSNSKAERTALQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  +             +     M    ++    S +A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGKSAFQIGAASGEAVQVELKSMRSDGIDMGGFSYIANG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        +      ++F + E    N     D        + +   V+A+VN  
Sbjct: 181 RANSDWQVKDGANELSMSFTNRFGETETIQINAKAGDDIEELATYINGQTDKVTASVNED 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  LS +                    D       ++ ++ +   +  
Sbjct: 241 GQLQLFMAGEETSGTLSFSGDLASELGLQLKGYDAVDNIDITSVGGAQQAVAVLDTAMKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDSHRAELGAYQNRFNHAINNLDNIHENLAASNSRIQDTDYAKETTQMVKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|262404490|ref|ZP_06081045.1| flagellin protein FlaF [Vibrio sp. RC586]
 gi|262349522|gb|EEY98660.1| flagellin protein FlaF [Vibrio sp. RC586]
          Length = 378

 Score =  154 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 103/367 (28%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             ++   +  E + +G   +      A +      E +   
Sbjct: 1   MAMTVNTNVSALVAQRHLNSASEMLNQSLERLSSGNRINSAKDDAAGLQISNRLETQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           ++  + + +     + T++  +    +++Q M    +    G     +       +    
Sbjct: 61  LSIAVRNANDGISIMQTAEGAMQETTQLLQRMRDLSLQSANGSNSAAERTALQEEMAALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T          +  +       +     + S   M    L+    S +A  
Sbjct: 121 DELNRIAETTSFAGRKLLNGHFEKASFQIGASSGEAVQLSLRNMRSDSLDMGGFSYVASA 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +     A+          +   ++E          D        + +   VSA+VN +
Sbjct: 181 MADKKWQVAKGKQQLNINYVNAQGENENIQLQAKEGDDIEELATYINGQTDKVSASVNEK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +          LS + +                  D +     ++ +S +   L  
Sbjct: 241 GQLQLYIAGKETAGTLSFSGSLANELQINLLGYEAVDNLDISSAGGAQRAVSVIDTALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   R+ LG  +   +     L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDGHRSELGAMQNRFHHAISNLDNVHENLAASNSRIKDADYAKETTQMIKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKR 367


>gi|254228429|ref|ZP_04921855.1| bacterial flagellin N-terminus domain protein [Vibrio sp. Ex25]
 gi|262393577|ref|YP_003285431.1| flagellin protein FlaF [Vibrio sp. Ex25]
 gi|151939017|gb|EDN57849.1| bacterial flagellin N-terminus domain protein [Vibrio sp. Ex25]
 gi|262337171|gb|ACY50966.1| flagellin protein FlaF [Vibrio sp. Ex25]
          Length = 377

 Score =  154 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 39/367 (10%), Positives = 99/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G+  +      A +      + +   
Sbjct: 1   MAITVNTNVAALVAQRHLTSATDMLNQSMERLSSGKRINSAKDDAAGLQISNRLQSQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  ++ +  I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIMQTAEGAMNEVTNIMQRMRDLSLQSANGSNSKAERTALQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  +             +     M    ++    S +A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGKSAFQIGAASGEAVQVELKSMRSDGIDMGGFSYIANG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D      ++F + E    N     D        + +   V+A+VN  
Sbjct: 181 RASSDWKVKDGANDLSMSFTNRFGETETIQINAKAGDDIEELATYINGQTDKVTASVNEE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  LS +                    D       ++ ++ +   +  
Sbjct: 241 GQLQLFMAGEETSGTLSFSGDLASELGLQLKGYDAVDNIDITSVGGAQQAVAVLDTAMKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDSHRAELGAYQTRFNHAINNLDNIHENLAASNSRIQDTDYAKETTQMVKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|326202858|ref|ZP_08192725.1| flagellar hook-associated protein 3 [Clostridium papyrosolvens DSM
           2782]
 gi|325986935|gb|EGD47764.1| flagellar hook-associated protein 3 [Clostridium papyrosolvens DSM
           2782]
          Length = 309

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 39/354 (11%), Positives = 96/354 (27%), Gaps = 46/354 (12%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + +   M            K   ++ TG+               L+   + + I 
Sbjct: 1   MRITNNMLISNMLTALGNNESRMSKYQNQLYTGKKIQLPSDDPIVAARALKLRTDVSKIE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       +  + A L+ +  I++           G   +++       ++     
Sbjct: 61  QYQKNLGDAQSWVDATDAALAQIGNILKRAKELSTQAANGTNSSSETGDIGQEMKQLKVQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V  AN T  G+Y+FSG  + +K +    T     K      +     +         ++
Sbjct: 121 LVHIANSTYSGRYMFSGFQTDQKLIEDDETSTDFGKFKIGVNIVPEKIQFEIGEGDNINI 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
            V+                                                    +    
Sbjct: 181 NVTG----------------------------------------------GDVFNSGSNA 194

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                 ++I          D   N   +  L    + +  ++  RA +G  +  I+    
Sbjct: 195 VYGNEPSMIALFTNVIADLDSGNNTGVRNQLDKFDEQVDNLLRVRADIGARQNRIDLSAD 254

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            + N    +   +SK+   +       L    N  + S     ++ + +++++L
Sbjct: 255 RMSNDLVNMTDLMSKNEDADPAETIMNLKMEENVYQASLAGGARIIQQTLVDFL 308


>gi|197285478|ref|YP_002151350.1| flagellin 2 [Proteus mirabilis HI4320]
 gi|194682965|emb|CAR43379.1| flagellin 2 [Proteus mirabilis HI4320]
          Length = 367

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 36/357 (10%), Positives = 90/357 (25%), Gaps = 8/357 (2%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+ +                   E + +G   +      A       +    N 
Sbjct: 1   MAQVINTNYLSLVTQNNLNRSQSALGNAIERLSSGMRINSAKDDAAGQAIANRFTSNING 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q +    V    G   N+        +    
Sbjct: 61  LTQASRNANDGISVSQTTEGALNEINNNLQRIRELTVQAKNGTNSNSDITSIQNEVNQRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  T            S+  +      + + + + D++    L   S +L   +
Sbjct: 121 DEINRVSEQTQFNGVKVLSGEKSKMTIQVGTNDNEVIEFNLDKIDNDTLGVASDNLFDAK 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D         +      +      D  +       +       V+  
Sbjct: 181 TEKKGVKATGDAIDANALGISGGTKYATGVSVKEYKVDGKVSANKVVLKDGSDEYVVSKS 240

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVL--------TKKMLSTVQQGLSGIIEQRAVLGI 293
                        EF          +              L+T+   +S + E R+ LG 
Sbjct: 241 DFTLKSGTTTGEIEFTGSKTIKFKADAGKDVKVLNVKDDALATLDNAISKVDESRSKLGA 300

Query: 294 SEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            +         L N  N +    S+ +  +  T  + +S      +    +  +  +
Sbjct: 301 IQNRFQSTINNLNNTVNNLSASRSRILDADYATEVSNMSKNQILQQAGTAVLAQANQ 357


>gi|254228430|ref|ZP_04921856.1| bacterial flagellin N-terminus domain protein [Vibrio sp. Ex25]
 gi|262393578|ref|YP_003285432.1| flagellin protein FlaD [Vibrio sp. Ex25]
 gi|262394930|ref|YP_003286784.1| flagellin protein FlaD [Vibrio sp. Ex25]
 gi|151939018|gb|EDN57850.1| bacterial flagellin N-terminus domain protein [Vibrio sp. Ex25]
 gi|262337172|gb|ACY50967.1| flagellin protein FlaD [Vibrio sp. Ex25]
 gi|262338524|gb|ACY52319.1| flagellin protein FlaD [Vibrio sp. Ex25]
          Length = 377

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 93/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K                  M          S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTHGAKSFQIGADNGEAVMLELKDMRSDNKMMGGVSYQAES 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   A+   D    L D +  ++    +     D        + +   V A+V+  
Sbjct: 181 GKGKDWNVAEGKNDLKINLTDSYGQEQEINISAKAGDDIEELATYINGQTDLVKASVDQD 240

Query: 242 GIRDIMFVAV------------------IGTEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I                          + ++ +  D       ++ ++ +   L  
Sbjct: 241 GKLQIFAGNNKVEGEVEFSGGLSGELGLGEGKKVTVDTIDVTSVGGAQESVAIIDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +      Q++      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTQMTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|297531375|ref|YP_003672650.1| flagellar hook-associated protein 3 [Geobacillus sp. C56-T3]
 gi|297254627|gb|ADI28073.1| flagellar hook-associated protein 3 [Geobacillus sp. C56-T3]
          Length = 297

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 34/354 (9%), Positives = 96/354 (27%), Gaps = 58/354 (16%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ S +             +  K   ++ TG+               + +      + 
Sbjct: 1   MRITQSMLANNTLKQITRSYANLDKYQTQLSTGKKITRPSDDPVVAMKGIAYRSNLAEVE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + S     +  S + L    + +Q +    V       +  +    A  +R   E 
Sbjct: 61  QFKRNFSEAYNWVENSDSALDKATQALQRIRELTVQASNDTYEETQRQAIAKEVRQLTEH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            VT AN     +Y+F+G  +++ P+                                   
Sbjct: 121 LVTIANTKVGDKYIFNGAKTTDPPVTVNP------------------------------- 149

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           + +   +        +L            + +  +   +   +++      + +     +
Sbjct: 150 DGTISVSTNSQQVNIELAKGIYIPVNIPPSTAFGAGSGLFSDLQNLAASLENPSTTGDDV 209

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
              +                                 L+ ++  RA LG     I     
Sbjct: 210 TGYLDKLDSH---------------------------LTNLLGVRAELGARMNRIELMED 242

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            + ++  I +  +S +  V+       L T  +    +  +  ++ + +++++L
Sbjct: 243 RIDSQQVIAEKMLSDNEDVDLEKVITDLKTQESVHRAALAVGARVIQPTLVDFL 296


>gi|37680677|ref|NP_935286.1| flagellin [Vibrio vulnificus YJ016]
 gi|37199426|dbj|BAC95257.1| polar flagellin FlaF [Vibrio vulnificus YJ016]
          Length = 377

 Score =  153 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 100/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G+  +      A +      + +   
Sbjct: 1   MAITVNTNVAALVAQRHLTSATDMLNQSLERLSSGKRINSAKDDAAGLQISNRLQSQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  ++    I+Q M    +    G   + +       +    
Sbjct: 61  LDIAVRNANDGISIMQTAEGAMNETTNILQRMRDLSLQSANGSNSHAERIALQEEMTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +                +     M    ++    S +A +
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGSAAFQIGGASGEAVQVQLKSMRSDGIDMGGFSYIANE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                    +          ++F + E    N     D        + +   V+A+VN  
Sbjct: 181 RARSDWQVKEGANALSMSFTNRFGETETIQINAKAGDDIEELATYINGQTDKVTASVNEE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  LS +                    D       ++ ++ +   +  
Sbjct: 241 GQLQLFMAGEETSGTLSFSGDLASELGLQLKGYDAVDNIDITSVGGAQQAVAVLDTAMKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   +     L N +  + T  S+    +      ++       ++S  
Sbjct: 301 VDSHRAELGAYQNRFSHAINNLDNIHENLATSNSRIQDTDYAKETTRMVKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           I  + +K
Sbjct: 361 ILAQAKK 367


>gi|260772313|ref|ZP_05881229.1| flagellin protein FlaF [Vibrio metschnikovii CIP 69.14]
 gi|260611452|gb|EEX36655.1| flagellin protein FlaF [Vibrio metschnikovii CIP 69.14]
          Length = 380

 Score =  153 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 35/379 (9%), Positives = 97/379 (25%), Gaps = 25/379 (6%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  ++T+           + +    +  E + +G+  +      A +      E +   
Sbjct: 1   MSLSVNTNVSVLVAQRHLNQASVALQQSLERLSSGKRINRAKDDVAGLQISNRLETQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +     + +     + T++  +     ++Q M    +    G     +       +    
Sbjct: 61  LGVAARNANDGISIMQTAEGGMQETTTLLQRMRDLSLQSANGSNSQAERQALQEEMSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQ-------------- 167
           +     A  T                           +     M                
Sbjct: 121 DEINRIAETTSFAGRKLLNGRFGSASFQIGAASGEAVQVGLKSMRSDQLLMGGFKYVSLP 180

Query: 168 -----GFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNI 222
                   + N +  ++  +    +            +E   +      +  S + + N 
Sbjct: 181 KDPDWQVEQGNHQLSISFMNRAGITETVDIQAKVGDNIESLATYINGQTDKLSASVNENG 240

Query: 223 KYRIKDTEGIDVSANVNMRGIRDIMFVAV-IGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
           + +I          +        +         ++ + N  D       +  ++ +   L
Sbjct: 241 QLQIYFENQHSHFIHGQPYFSGGLADQLQLTFGKYETVNDLDITSVGGAQSAVAVIDTAL 300

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +   RA LG  +         L N +  +    S+    +      Q+       ++S
Sbjct: 301 QYVDSHRAKLGALQNRFYHAINNLDNMHEHLAASNSRIKDTDFAKETTQMVKQQILQQVS 360

Query: 342 YMITTKLQK-----LSILN 355
             I ++ +K     LS+LN
Sbjct: 361 TSILSQAKKQPHLALSLLN 379


>gi|89092143|ref|ZP_01165098.1| Flagellin-like [Oceanospirillum sp. MED92]
 gi|89083878|gb|EAR63095.1| Flagellin-like [Oceanospirillum sp. MED92]
          Length = 415

 Score =  153 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 37/414 (8%), Positives = 94/414 (22%), Gaps = 60/414 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST  +F        + + D  K  +++ TG+              I ++++E     
Sbjct: 1   MRISTQQVFLNNIDNISKTSADVFKTQQQLSTGKKVLQPSDDPLASAQIQKFKKEIARTE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +  +  +RL   +  +  +      +    +    G  ++      A  +    +S
Sbjct: 61  QYNSNIEVSERRLQLEENTIEQINNQSIRLRELTIQGKTGTLNDTDRAAIASEVDQIIKS 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N  D         N           +      + D   +         + +    
Sbjct: 121 LDGLMNTKDVQGEFLFSGNKGFTEPYTIDPRTGRYVFNGDDGQRFLQVGPETKVASTDSG 180

Query: 184 EVSSMN-------------------------AQQMTDFIKQLEDKFSDDEYWANNWSNAS 218
                                               D                    + +
Sbjct: 181 FDIFETVPKVSGYVIADINQTSQQIASNEIKDADAFDAFTVERGALQITFNDGAGTFSVT 240

Query: 219 DHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQ 278
           D     +   ++        N+      +         +     D    V      + + 
Sbjct: 241 DSQTPPQPVSSDDTPPVVLTNVAFNDGDVIKVAGTELTVGNITADSTITVDAISQHNILN 300

Query: 279 QGLSGIIE-----------------------------------QRAVLGISEKNINEERV 303
             L    E                                    RA +G     + ++  
Sbjct: 301 TALDLKAELENADFTTQEGKDKFNERMDHILENLSGIEELNVGTRANIGGRLNTLEQQMS 360

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
              +        +S    ++ + A +Q       ++ +Y    ++Q L++ N+L
Sbjct: 361 VNTDYELFTTESLSAFEDLDYNEAISQFQLQQTVLQAAYSSFARVQDLNLFNFL 414


>gi|269965415|ref|ZP_06179534.1| Flagellin D [Vibrio alginolyticus 40B]
 gi|269829894|gb|EEZ84124.1| Flagellin D [Vibrio alginolyticus 40B]
          Length = 377

 Score =  153 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 92/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K                  M          S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTHGAKSFQIGADNGEAVMLELKDMRSDNKMMGGVSYQAES 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   A+   D    L D +  ++    +     D        + +   V A+V+  
Sbjct: 181 GKGKDWNVAEGKNDLKINLTDSYGQEQEINISAKAGDDIEELATYINGQTDLVKASVDQD 240

Query: 242 GIRDIMFVAV------------------IGTEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I                          + ++ +  D       ++ ++ +   L  
Sbjct: 241 GKLQIFAGNNKVEGEVEFSGGLSGELGLGEGKKVTVDTIDVTSVGGAQESVAIIDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +      Q++      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTQMTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|261344107|ref|ZP_05971751.1| flagellin 1 [Providencia rustigianii DSM 4541]
 gi|282567698|gb|EFB73233.1| flagellin 1 [Providencia rustigianii DSM 4541]
          Length = 368

 Score =  153 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 41/358 (11%), Positives = 95/358 (26%), Gaps = 9/358 (2%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+ +                   E + +G   +      A       +      
Sbjct: 1   MAQVINTNILSLTTQNNLNRSQGVLGSAIERLSSGSRINSAKDDAAGQAIANRFTANIKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +++   + +       T++  L+ +   +Q +    V    G   N+        + +  
Sbjct: 61  LSQASRNANDGISIAQTTEGALNEINDNLQRIRELTVQAKNGSNSNSDISSIQNEVTERL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 +  T            +E  +        + K S D+     L  +S  L    
Sbjct: 121 AEINRISEQTQFNGVKVLSGEKTEMSIQVGTNDKEVIKFSLDKTDNDTLGVSSDKLFEAT 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDE---------YWANNWSNASDHNIKYRIKDTEGI 232
              +  + A+   D                      Y  +  + A  +      KD    
Sbjct: 181 PAGIKGVTAKGTADVTADKVGVTGGTTYKTGLTVKEYTVDGVAVAGKYIASEGGKDYLVS 240

Query: 233 DVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLG 292
           +    V+      +   A       S      A   +    L+T+ + ++ + E R+ LG
Sbjct: 241 NSDFEVDGTTATQVNLKAGAKEFTPSAGKDMPAGLEVKDDALATLDKAINTVDESRSKLG 300

Query: 293 ISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
             +         L N  N +    S+    +  T  + +S      +    +  +  +
Sbjct: 301 AIQNRFQSTINNLNNSVNNLSAARSRIQDADFATEVSNMSRGQILQQAGTAVLAQANQ 358


>gi|28897562|ref|NP_797167.1| flagellin [Vibrio parahaemolyticus RIMD 2210633]
 gi|153840000|ref|ZP_01992667.1| polar flagellin C [Vibrio parahaemolyticus AQ3810]
 gi|260364619|ref|ZP_05777221.1| A-type flagellin [Vibrio parahaemolyticus K5030]
 gi|260878276|ref|ZP_05890631.1| A-type flagellin [Vibrio parahaemolyticus AN-5034]
 gi|260898106|ref|ZP_05906602.1| A-type flagellin [Vibrio parahaemolyticus Peru-466]
 gi|260901962|ref|ZP_05910357.1| A-type flagellin [Vibrio parahaemolyticus AQ4037]
 gi|29611967|sp|Q56712|FLAC_VIBPA RecName: Full=Polar flagellin C
 gi|28805774|dbj|BAC59051.1| polar flagellin FlaC [Vibrio parahaemolyticus RIMD 2210633]
 gi|149746460|gb|EDM57469.1| polar flagellin C [Vibrio parahaemolyticus AQ3810]
 gi|308086103|gb|EFO35798.1| A-type flagellin [Vibrio parahaemolyticus Peru-466]
 gi|308090162|gb|EFO39857.1| A-type flagellin [Vibrio parahaemolyticus AN-5034]
 gi|308106764|gb|EFO44304.1| A-type flagellin [Vibrio parahaemolyticus AQ4037]
 gi|308115106|gb|EFO52646.1| A-type flagellin [Vibrio parahaemolyticus K5030]
 gi|328473445|gb|EGF44293.1| flagellin [Vibrio parahaemolyticus 10329]
          Length = 384

 Score =  153 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 40/375 (10%), Positives = 92/375 (24%), Gaps = 25/375 (6%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+           +   +     E + +G   +      A +        +   
Sbjct: 1   MAVTVSTNVSAMTAQRYLNKATNELNTSMERLSSGHKINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    ++Q M    +    G     +            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNEATSVMQRMRDLAIQSSNGTNSPAERQAINEESMALV 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +          +  +  
Sbjct: 121 DELNRIAETTSFGGRRLLNGSFGEAAFQIGASSGEAMIMGLTSIRADDTRMGGVTFFSEV 180

Query: 182 HLEVSSMNAQQMTD------FIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVS 235
                        D       + + ED   DD     N     D        + +   ++
Sbjct: 181 GKGKDWGVDPTKADLKITLPGMGEDEDGNVDDLEININAKAGDDIEELATYINGQSDMIN 240

Query: 236 ANVNMRGIRDIMFVAVIGTEF-------------------LSKNLTDGARNVLTKKMLST 276
           A+V+  G   I                              S    D      ++  +S 
Sbjct: 241 ASVSEDGKLQIFVAHPNVQGDISISGGLASELGLSDEPVRTSVQDIDMTTVQGSQNAISV 300

Query: 277 VQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLIN 336
           +   L  +  QRA LG  +  ++     L N    +D   S+    +      Q++    
Sbjct: 301 LDSALKYVDSQRADLGAKQNRLSHSINNLANIQENVDASNSRIKDTDFAKETTQMTKAQI 360

Query: 337 KIEMSYMITTKLQKL 351
             +    I  + ++L
Sbjct: 361 LQQAGTSILAQAKQL 375


>gi|261209880|ref|ZP_05924181.1| flagellin protein FlaF [Vibrio sp. RC341]
 gi|260841066|gb|EEX67591.1| flagellin protein FlaF [Vibrio sp. RC341]
          Length = 378

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 36/367 (9%), Positives = 100/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             ++   +    + +G   +      A +      E +   
Sbjct: 1   MAMTVNTNVSALVAQRHLNSASEMLNQSLGRLSSGNRINSAKDDAAGLQISNRLETQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           ++  + + +     + T++  +    +++Q M    +    G             +    
Sbjct: 61  LSIAVRNANDGISIMQTAEGAMQETTQLLQRMRDLSLQSANGSNSAADRTALQEEMAALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T             +       +     + S   M    L+    S +A  
Sbjct: 121 DELNRIAETTSFAGRKLLNGQFVKASFQIGASSGEAVQLSLRNMRSDSLDMGGFSYVAAA 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +     A+          +   ++E          D        + +   VSA+VN +
Sbjct: 181 MADKKWQVAKGKQQLNINYVNAQGENENIQIQAKEGDDIEELATYINGQTDKVSASVNEK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  L+   +                  D +     ++ +S +   L  
Sbjct: 241 GQLQLYIAGKETSGTLAFGGSLANELQLNLLGYEAVDNLDISSAGGAQRAVSVIDTALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   R+ LG  +   +     L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDGHRSELGAMQNRFHHAISNLDNVHENLAASNSRIKDADYAKETTQMIKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKR 367


>gi|88813661|ref|ZP_01128890.1| Flagellin-like protein [Nitrococcus mobilis Nb-231]
 gi|88789079|gb|EAR20217.1| Flagellin-like protein [Nitrococcus mobilis Nb-231]
          Length = 400

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 45/400 (11%), Positives = 97/400 (24%), Gaps = 46/400 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST+ I +       +      K+ +++ +G+         +     L        I 
Sbjct: 1   MRISTNQIQQLGLNALLDQQSRLTKVQQQIASGRRILTPADDPSGAARSLILAHSIGAIE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               S   +  R+    + L   Q ++Q +    V         +        +R ++  
Sbjct: 61  SYSRSADQIKPRMQLEDSTLEQTQNLIQRLRELAVQANNATQTADNRHQIGAEVRQTFIQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENS--------- 174
            V  AN TD           S              +    Q L                 
Sbjct: 121 LVQLANSTDGNGEYLFAGLQSRTQPFLRAGNTVTYQGDQGQRLAQTGSHQQLATTHSGYD 180

Query: 175 ------KSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKY---- 224
                            S      +   +   +        +A  +       + Y    
Sbjct: 181 VFMKIRTGDGQFTAEAASINTGSGIISPVTVTDPGALTGSSYAVTFDINGAGALTYTLSK 240

Query: 225 ---------------------------RIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFL 257
                                           +   +  +        +   A       
Sbjct: 241 DGTPTATQPYDSSTPIRFDGLSVTLDGTPAKGDQFTIQPSGFGSLFDTVDRFATALETAQ 300

Query: 258 SKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYIS 317
                  A   +  + L  + Q L  I+  RA +G     ++  +   +       T  S
Sbjct: 301 DGPTGRTAYQNVGNQTLQGLDQALDHILTIRAEVGSRLNALDSSQEANEAALLNFQTTKS 360

Query: 318 KSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
               ++   A  +LS  +  ++ +     ++Q+LS+ N+L
Sbjct: 361 ALDDLDYAKAITELSQRLLGLQAAQKSYAQIQELSLFNFL 400


>gi|320155653|ref|YP_004188032.1| flagellin protein FlaF [Vibrio vulnificus MO6-24/O]
 gi|319930965|gb|ADV85829.1| flagellin protein FlaF [Vibrio vulnificus MO6-24/O]
          Length = 377

 Score =  152 bits (384), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 99/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G+  +      A +      + +   
Sbjct: 1   MAITVNTNVAALVAQRHLTSATDMLNQSLERLSSGKRINSAKDDAAGLQISNRLQSQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  ++    I+Q M    +    G   + +       +    
Sbjct: 61  LDIAVRNANDGISIMQTAEGAMNETTNILQRMRDLSLQSANGSNSHAERIALQEEMTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +                +     M    ++    S +A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGSAAFQIGAASGEAVQVQLKSMRSDGIDMGGFSYIANG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                    +          ++F + E    N     D        + +   V+A+VN  
Sbjct: 181 RARSDWQVKEGANALSMSFTNRFGETETIQINAKAGDDIEELATYINGQTDKVTASVNEE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  LS +                    D       ++ ++ +   +  
Sbjct: 241 GQLQLFMAGEETSGTLSFSGDLASELGLQLKGYDAVDNIDITSVGGAQQAVAVLDTAMKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   +     L N +  + T  S+    +      ++       ++S  
Sbjct: 301 VDSHRAELGAYQNRFSHAINNLDNIHENLATSNSRIQDTDYAKETTRMVKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           I  + +K
Sbjct: 361 ILAQAKK 367


>gi|300114792|ref|YP_003761367.1| flagellar hook-associated protein 3 [Nitrosococcus watsonii C-113]
 gi|299540729|gb|ADJ29046.1| flagellar hook-associated protein 3 [Nitrosococcus watsonii C-113]
          Length = 400

 Score =  152 bits (384), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 56/400 (14%), Positives = 115/400 (28%), Gaps = 46/400 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ISTS   ++             K   ++ +G+              +LE  +     A
Sbjct: 1   MRISTSLFQQQSIEGMLRQQTQVSKTQRQIASGERMQTPADDPVAAARLLEVREASGRTA 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +  L T RLS  +  L+ +  ++Q +    V    G  +N    I A  +R     
Sbjct: 61  QFQTNADLATARLSQEENALAGVNNVLQGVRELAVQANNGAQNNENRAIIAQEVRQRLNE 120

Query: 124 FVTFANMTDEGQ-YLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
            V  AN  D    YLF+G     +P        S       +++            +G  
Sbjct: 121 LVGLANSQDASGEYLFAGAKGRTQPFIQAGGGVSYQGDQAQRLISIGPSAQVADSHSGSE 180

Query: 183 LEVSSMNAQQMTDFIKQLED---------------------------------------- 202
           + ++      +        +                                        
Sbjct: 181 VFLAIREGNGVFATEANPVNRGSGVIAPGSANGAFIPGNYTLQFSQATPDDPLTYQVLDS 240

Query: 203 -----KFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFL 257
                   D           +  +I     D +   + A+ +                 +
Sbjct: 241 QHTVVANGDFASGEEIAFGGAQASITGVPADGDSFTLRASAHRDMFTIAQHFIEALERPI 300

Query: 258 SKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYIS 317
           +   +    +    K L+ + Q +  ++E RA  G     ++ ER   +  +  +    S
Sbjct: 301 NDTTSQARFHNDMNKTLTDLDQAMGKVLEVRAETGARLNAVDRERQVNEETSLQLAREQS 360

Query: 318 KSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
               ++   A  +L+  +  +E +     +LQ LS+ N+L
Sbjct: 361 SLNDLDLAEAIGRLNQQLTGLEAAQRTYARLQGLSLFNFL 400


>gi|218708812|ref|YP_002416433.1| flagellin [Vibrio splendidus LGP32]
 gi|218321831|emb|CAV17803.1| Flagellin core protein A [Vibrio splendidus LGP32]
          Length = 399

 Score =  152 bits (384), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 36/390 (9%), Positives = 93/390 (23%), Gaps = 40/390 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+           + + +     E + +G   +      A +        +   
Sbjct: 1   MAINVSTNVSAMTAQRYLNKSSNELATSMERLSSGHKINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTNILQRMRDLAIQSSNGTNSPAERQALNEETMALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E               +   +          +     
Sbjct: 121 DELNRIAETTAFGGRRLLNGSFGEASFQIGSNSGEAMIMALTSIRADDFRMGGTTFDTEN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S     +  D   + + K  ++     +     D        + +   ++A+V   
Sbjct: 181 AKDKSWEVPLEAKDLKFEFKTKAGEEVAIDISAKAGDDIEELATYINGQSDLINASVTDE 240

Query: 242 G----------------------------------------IRDIMFVAVIGTEFLSKNL 261
           G                                            +  A           
Sbjct: 241 GRLQVFVAEPDLDGEMRISGGLASELGFKNDAPEGQETTTTADGKVVPAPAVGRTTLVQD 300

Query: 262 TDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIG 321
            D      ++  +S +   +  +  QRA LG  +  ++     L N    +D   S+   
Sbjct: 301 IDLNTVAGSQNAISVIDSAMQYVDSQRADLGAKQNRLSHSINNLANVQENVDASNSRIKD 360

Query: 322 VEQHTAHAQLSTLINKIEMSYMITTKLQKL 351
            +      Q++      +    I  + ++L
Sbjct: 361 TDFAKETTQMTKAQILQQAGTSILAQAKQL 390


>gi|269961608|ref|ZP_06175970.1| Flagellin D [Vibrio harveyi 1DA3]
 gi|269833649|gb|EEZ87746.1| Flagellin D [Vibrio harveyi 1DA3]
          Length = 377

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 39/367 (10%), Positives = 93/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +              +   M          S  A  
Sbjct: 121 DELNRIAETTSFGGNRLLNGTYGTQSFQIGADNGEAVMLNLKDMRSDNKMMGGVSYQAEN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +        D    L D F  ++    +     D        + +   V A+V+  
Sbjct: 181 GKDKNWNVEAGKNDLKISLTDSFGQEQEINISAKAGDDIEELATYINGQTDLVKASVDQD 240

Query: 242 GIRDIMFVAVIGTEF------------------LSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +                            ++ +  D       ++ ++ +   L  
Sbjct: 241 GKLQVFAGNNKVEGDVEFSGGLSGELGLSDGKKVTVDTIDVTSVGGAQESVAIIDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +      Q++      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTQMTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|27365270|ref|NP_760798.1| flagellin [Vibrio vulnificus CMCP6]
 gi|37679158|ref|NP_933767.1| flagellin [Vibrio vulnificus YJ016]
 gi|320155654|ref|YP_004188033.1| flagellin protein FlaD [Vibrio vulnificus MO6-24/O]
 gi|27361417|gb|AAO10325.1| Flagellin protein flaD [Vibrio vulnificus CMCP6]
 gi|37197900|dbj|BAC93738.1| polar flagellin FlaD [Vibrio vulnificus YJ016]
 gi|319930966|gb|ADV85830.1| flagellin protein FlaD [Vibrio vulnificus MO6-24/O]
          Length = 377

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 46/367 (12%), Positives = 98/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K +            S   M    +     S  A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYGTKAMQIGADNGEAVMLSLKDMRSDNVMMGGVSYQAEE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +   A    D    L D F +++    N     D        + +   V A+V   
Sbjct: 181 GKDKNWNVAAGDNDLTIALTDSFGNEQEIEINAKAGDDIEELATYINGQTDLVKASVGEG 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I                          + ++ +  D       ++ ++ V   L  
Sbjct: 241 GKLQIFAGNNKVQGEIAFSGSLAGELGLGEGKNVTVDTIDVTTVQGAQESVAIVDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +      QL+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTQLTKTQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|183598661|ref|ZP_02960154.1| hypothetical protein PROSTU_02068 [Providencia stuartii ATCC 25827]
 gi|188020847|gb|EDU58887.1| hypothetical protein PROSTU_02068 [Providencia stuartii ATCC 25827]
          Length = 360

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 31/350 (8%), Positives = 86/350 (24%), Gaps = 1/350 (0%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+ +                   E + +G   +      A       +      
Sbjct: 1   MAQVINTNILSLTTQNNLNRSQSVLGTAIERLSSGSRINSAKDDAAGQAIANRFTANIKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + S        ++  ++ + + +Q +    V    G   ++        ++   
Sbjct: 61  LTQASRNASDGISMAQVAEGAVNEINENLQRIRELTVQAANGSNSDSDITSIRDEVQQRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +        T+         ++    +     +    +     +    +++    +    
Sbjct: 121 DEIDRIYQHTEFNGTQILNGDTVSYQVGAKDGQTISMEMQKMDLDTLGIKDFKDKVEKVS 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                          I    D ++           A  +  K         D + N    
Sbjct: 181 AAAAGPKEPAGKGTAISVDADNYAVASAGGAKIGTAEIYADKADATKFYIKDTTDNKWYE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLTD-GARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINE 300
             +D    +          +T  G         L T+   L  +   R+ LG  +  +  
Sbjct: 241 ATKDTTTTSGKTEYVKGAEITGLGGGTAAKSDALDTLDTALKNVDSYRSKLGAFQNRMQS 300

Query: 301 ERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
               L N  N +    S+    +  T  + +S      +    +  +  +
Sbjct: 301 TINNLNNSVNNLSAARSRIQDADFATEVSNMSRGQILQQAGTSVLAQANQ 350


>gi|154250153|ref|YP_001410978.1| flagellin domain-containing protein [Fervidobacterium nodosum
           Rt17-B1]
 gi|154154089|gb|ABS61321.1| flagellin domain protein [Fervidobacterium nodosum Rt17-B1]
          Length = 372

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 34/360 (9%), Positives = 81/360 (22%), Gaps = 32/360 (8%)

Query: 22  LNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLVTKRLSTSQA 81
            N D  K  E + +G   +      A +    +   +   +   + ++      + T++ 
Sbjct: 2   TNMDMSKTLERLSSGLRINRAGDDAAGLAISEKMRGQIKGLDMAIKNSQDAISLIQTAEG 61

Query: 82  HLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANMT-DEGQYLFSG 140
            L+ +  I+Q M    V        N         L    E     A  T    + L  G
Sbjct: 62  ALTEVHSILQRMRELAVQAASDTNTNVDRNQIQAELDQLREEIDRIARTTEFNTKKLLDG 121

Query: 141 INSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQL 200
                K                              ++     + +  +   +       
Sbjct: 122 KLEGFKNTPDAKVVTGGNINVTVGGYSKTGATEGTYVIEVGQFKGAVTSQLDVKITQIGN 181

Query: 201 EDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANV---------------------- 238
                +         +A+  N+  + +    I    +                       
Sbjct: 182 NGTVLNSTTATIGALSAALGNVTIKWQRVFTISDFGDALPVNEVIDSAVVRVEARYTANN 241

Query: 239 ---------NMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRA 289
                        +   +         L  +          +K +  V   +  +   RA
Sbjct: 242 QLVFQIGANEGHNMIAGIDNMSAKALGLLTSTLKVTDQNSAEKTIMVVDAAIHRVSTARA 301

Query: 290 VLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQ 349
            LG  +  +      L      +    S+    +      Q +     ++ S  +  +  
Sbjct: 302 ALGAIQNRLEHTIANLGVAAENLTAAESRIRDADMAKEMMQFTKQQILLQSSMSMLAQAN 361


>gi|161486613|ref|NP_935285.2| flagellin [Vibrio vulnificus YJ016]
          Length = 377

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 46/367 (12%), Positives = 98/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K +            S   M    +     S  A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYGTKAMQIGADNGEAVMLSLKDMRSDNVMMGGVSYQAEE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +   A    D    L D F +++    N     D        + +   V A+V   
Sbjct: 181 GKDKNWNVAAGDNDLTIALTDSFGNEQEIEINAKAGDDIEELATYINGQTDLVKASVGEG 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I                          + ++ +  D       ++ ++ V   L  
Sbjct: 241 GKLQIFAGNNKVQGEISFSGSLAGELGLGEGKNVTVDTIDVTTVQGAQESVAIVDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +      QL+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTQLTKTQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|27363696|ref|NP_759224.1| flagellin [Vibrio vulnificus CMCP6]
 gi|320157098|ref|YP_004189477.1| flagellin protein FlaD [Vibrio vulnificus MO6-24/O]
 gi|27359812|gb|AAO08751.1| Flagellin protein flaD [Vibrio vulnificus CMCP6]
 gi|319932410|gb|ADV87274.1| flagellin protein FlaD [Vibrio vulnificus MO6-24/O]
          Length = 377

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 46/367 (12%), Positives = 98/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K +            S   M    +     S  A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYGTKAMQIGADNGEAVMLSLKDMRSDNVMMGGVSYQAEE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +   A    D    L D F +++    N     D        + +   V A+V   
Sbjct: 181 GKDKNWNVAAGDNDLTIALTDSFGNEQEIEINAKAGDDIEELATYINGQTDLVKASVGEG 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I                          + ++ +  D       ++ ++ V   L  
Sbjct: 241 GKLQIFAGNNKVQGEIAFSGSLAGELGLGEGKNVTVDTIDVTTVQGAQESVAIVDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +      QL+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTQLTKTQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|218710260|ref|YP_002417881.1| flagellin [Vibrio splendidus LGP32]
 gi|218323279|emb|CAV19456.1| polar flagellin [Vibrio splendidus LGP32]
          Length = 407

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 36/378 (9%), Positives = 90/378 (23%), Gaps = 29/378 (7%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 20  MAVNVNTNVSAMTAQRYLNSANSAQQTSMERLSSGSKINSAKDDAAGLQISNRLNVQSRG 79

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    +        +    
Sbjct: 80  LDVAVRNANDGISIAQTAEGAMNETSNILQRMRDLSLQSTNGSNTKSDRVAIQEEVTALN 139

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K                  M     +    S    +
Sbjct: 140 DELNRIAETTSFGGNKLLNGTHGTKSFQIGADNGEAVMLQLKDMRSDNDQMGGSSYQFTE 199

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D    L+D F D      +     D        + +   V A+++  
Sbjct: 200 AKGKDWGVKAGANDLTMSLKDSFGDQREINISAKAGDDIEELATYINGQQDLVKASIDEE 259

Query: 242 G-----------------------------IRDIMFVAVIGTEFLSKNLTDGARNVLTKK 272
           G                                      +  + ++ +  D       ++
Sbjct: 260 GKLQIFAGNNKVDGEIAFSGALSDELGMQAGAKPEDPKTLEGKQVTVDTIDVTSVGGAQE 319

Query: 273 MLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLS 332
            ++ +   L  +   R+ LG  +   +     L N N  ++   S+    +       ++
Sbjct: 320 SVAVIDAALKYVDSHRSELGAFQNRFDHAINNLDNINENVNASKSRIKDTDFAKETTNMT 379

Query: 333 TLINKIEMSYMITTKLQK 350
                 + S  I  + ++
Sbjct: 380 KSQILSQASSSILAQAKQ 397


>gi|183222557|ref|YP_001840553.1| flagellar hook-associated protein FlgL [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|189912592|ref|YP_001964147.1| flagellar hook-associated protein FlgL [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167777268|gb|ABZ95569.1| Endoflagellar hook-filament protein [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167780979|gb|ABZ99277.1| Flagellar hook-associated protein 3 (HAP3) [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
          Length = 422

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 44/421 (10%), Positives = 109/421 (25%), Gaps = 66/421 (15%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              I+       +            +   ++ TG             T+ + +    N +
Sbjct: 1   MIRITNMMQNNSLVRNLNRHQVAMDETQTQLGTGLKIRKPSDDPGAATNQMYFRSRLNEL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKF----PINAGMLR 118
           ++   +     +RL      L  M +I Q +    V    G    +K           + 
Sbjct: 61  SQYEENIGDGYQRLQQVDGVLDKMGEIFQRVRVLTVQAGNGIYQGDKGFELEVAIGKEID 120

Query: 119 DSYESFVTFANMTDEGQYLFSGINSSEKP------------------------------- 147
               + V  AN  D       G +  E+P                               
Sbjct: 121 QHLRAIVDLANARDATGQPLFGGHVIERPPFEPIESKIKGLQGLELKNQYVGVEYRGDIG 180

Query: 148 ---------------LNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQ 192
                          + G             ++     +  S        +E+       
Sbjct: 181 EQLREIEKGEYIPITIPGNKVFWGTNVSVTSKVDNSAFQATSDQKFKIDGVEIHISVGDT 240

Query: 193 MTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVI 252
           + D I ++ +   + +       N S  +        E +D    +   G+ +       
Sbjct: 241 IDDVIDKINNAPLEVKASKLAQDNISISSTAPHQIWLEDVDGGTVLRDIGLIEPSASEPP 300

Query: 253 GTEFLSKNLTDGARNVLTKKMLS----------------TVQQGLSGIIEQRAVLGISEK 296
                S  +T  +   +  ++ +                 +   L  I+  RA +G    
Sbjct: 301 NNFSKSATVTGLSVFDVLIQLRNDLIQKDQERIGGRDLGDLDLALENILRHRATIGARMN 360

Query: 297 NINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNY 356
            + +    +      +   ++K+ G++       +  L      +  + +K+ K +++++
Sbjct: 361 RLEQHEERVSYDKMYMTELLAKNEGIDFPETIMNMKWLETIHSYALNVGSKIIKPTLMDF 420

Query: 357 L 357
           L
Sbjct: 421 L 421


>gi|269960651|ref|ZP_06175023.1| Flagellin D [Vibrio harveyi 1DA3]
 gi|269834728|gb|EEZ88815.1| Flagellin D [Vibrio harveyi 1DA3]
          Length = 377

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 39/367 (10%), Positives = 93/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +              +   M          S  A  
Sbjct: 121 DELNRIAETTSFGGNRLLNGTYGTQSFQIGADNGEAVMLNLKDMRSDNKMMGGVSYQADN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +        D    L D F  ++    +     D        + +   V A+V+  
Sbjct: 181 GKDKNWNVEAGKNDLKISLTDSFGQEQEINISAKAGDDIEELATYINGQTDLVKASVDQD 240

Query: 242 GIRDIMFVAVIGTEF------------------LSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +                            ++ +  D       ++ ++ +   L  
Sbjct: 241 GKLQVFAGNNKVEGDVEFSGGLSGELGLSDGKKVTVDTIDVTSVGGAQESVAIIDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +      Q++      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTQMTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|91223534|ref|ZP_01258799.1| flagellin [Vibrio alginolyticus 12G01]
 gi|91191620|gb|EAS77884.1| flagellin [Vibrio alginolyticus 12G01]
 gi|222820584|gb|ACM67642.1| flagellin [Vibrio alginolyticus]
          Length = 377

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 91/367 (24%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K                  M          S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTHGAKSFQIGADNGEAVMLELKDMRSDNKMMGGVSYQAES 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   A+   D    L D +  ++    +     D        + +   V A+V+  
Sbjct: 181 GKGKDWNVAEGKNDLKINLTDSYGQEQEINISAKAGDDIEELATYINGQTDLVKASVDQD 240

Query: 242 GIRDIMFVAV------------------IGTEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I                          + ++ +  D       ++ ++ +   L  
Sbjct: 241 GKLQIFAGNNKVEGEVEFSGGLSGELGLGEGKKVTVDTIDVTSVGGAQESVAIIDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       ++      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTAMTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|2271026|gb|AAC01555.1| flagellin [Vibrio cholerae]
          Length = 378

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 100/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             ++   +  E + +G   +      A +      E +   
Sbjct: 1   MAMTVNTNVSALVAQRHLNSASEMLNQSLERLSSGNRINSAKDDAAGLQISNRLETQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  +    +++Q M    +    G     +       +    
Sbjct: 61  LGIAVRNANDGISIMQTAEGAMQETTQLLQRMRDLSLQSANGSNSAAERVALQEEMAALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T             +       +     + S   M    LE    S +A  
Sbjct: 121 DELNRIAETTSFAGRKLLNGQFMKASFQIGASSGEAVQLSLRNMRSDSLEMGGFSYVAAA 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +      +          +   ++E          D        + +   VSA+VN +
Sbjct: 181 LADKQWQVTKGKQQLNISYVNAQGENENIQIQAKEGDDIEELATYINGKTDKVSASVNEK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  LS + +                  D +     ++ +S +   L  
Sbjct: 241 GQLQLYIAGKETSGTLSFSGSLANELQMNLLGYEAVDNLDISSAGGAQRAVSVIDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   R+ LG  +         L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDGHRSELGAMQNRFQHAISNLDNVHENLAASNSRIKDADYAKETTQMIKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKR 367


>gi|148976402|ref|ZP_01813108.1| flagellin [Vibrionales bacterium SWAT-3]
 gi|145964225|gb|EDK29481.1| flagellin [Vibrionales bacterium SWAT-3]
          Length = 378

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 37/369 (10%), Positives = 92/369 (24%), Gaps = 19/369 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+           + + D     E + +G   +      A +        +   
Sbjct: 1   MAVNVSTNVSAMTAQRYLNKASNDLATSMERLSSGHKINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    ++Q M    +    G     +            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTNVLQRMRDLAIQSSNGTNSPAERTALNEESMALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E               +   +          +  +  
Sbjct: 121 DELNRIAETTSFGGRRLLNGSFGEASFQIGSNSGEAMIMALTSIRADDYRMGGTTFDSEN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +       +D   + + K  +D     N     D        + +   ++A+V   
Sbjct: 181 AKDKNWEVPPTASDLKFEFKTKAGEDIVLDINTKAGDDIEELATYINGQSDLLNASVTDD 240

Query: 242 -------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLS 282
                              G               S           ++  +S +   L 
Sbjct: 241 GRLQLFVAEPDLAGAMSISGGLASELGIKSEGRATSVQDISLTSVAGSQNAISVIDSALK 300

Query: 283 GIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSY 342
            +  QRA LG  +  ++     L N    +D   S+    +      Q++      +   
Sbjct: 301 YVDSQRADLGAKQNRLSHSINNLANVQENVDASNSRIKDTDFAKETTQMTKSQILQQAGT 360

Query: 343 MITTKLQKL 351
            I  + ++L
Sbjct: 361 SILAQAKQL 369


>gi|289208121|ref|YP_003460187.1| flagellar hook-associated protein 3 [Thioalkalivibrio sp. K90mix]
 gi|288943752|gb|ADC71451.1| flagellar hook-associated protein 3 [Thioalkalivibrio sp. K90mix]
          Length = 416

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 45/416 (10%), Positives = 122/416 (29%), Gaps = 62/416 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST+ IF+      +    +  +   ++ +G+         +  T I ++E+      
Sbjct: 1   MRISTTQIFQSGINQIQAGQGELNRTSLQLGSGKRILSPSDDPSGATQINQFERIIKATK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +      R+   ++ L+     +Q     +V               A  LR   + 
Sbjct: 61  QFQRNMENTQPRMQQQESLLAQGTDALQRARELVVTGNNDSQTRETRGYLADELRQIRDG 120

Query: 124 FVTFANMTDEGQ-YLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ- 181
            +  AN  D    Y+F+G  S  +P       +   + +        +  ++   +A   
Sbjct: 121 MLDIANTKDPNGEYIFAGTKSQNQPFRQDGDGEIRYEGASGAGSVREVAVSADRKIAVGH 180

Query: 182 ----------------HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYR 225
                             EV   N   + +          DD  ++  +    D  + Y 
Sbjct: 181 DGAAVFMDIPENDGRVGAEVLQNNGSLVLEKTGVTRVSDLDDREYSITFDENDDGELVYT 240

Query: 226 IKDTEGIDVSANVNMRG------------------------------------------- 242
           +   +       +   G                                           
Sbjct: 241 VTYIDEDGEVVGLEEDGDGEPIQYPYVPGESIEFAGRSVTISGMPEPGDGVVSRPAENFS 300

Query: 243 -IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
             + +  +                    +   L+ +   L    ++RA LG   K  +++
Sbjct: 301 VFQTLDRIIDALERSGDSASARADLASASNAALADLDAVLGNFGDKRADLGGKLKAFDQQ 360

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +   +++   +++ +S+   ++   A ++ +     ++ +    T++ +LS+ +++
Sbjct: 361 KDLNEDRLLDLESAVSQIRDLDYAEAISRFNQQQVALQAAQQTYTQVNRLSLFDFI 416


>gi|27365269|ref|NP_760797.1| flagellin [Vibrio vulnificus CMCP6]
 gi|27361416|gb|AAO10324.1| Flagellin protein flaF [Vibrio vulnificus CMCP6]
          Length = 377

 Score =  152 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 98/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G+  +      A +      + +   
Sbjct: 1   MAITVNTNVAALVAQRHLTSATDMLNQSLERLSSGKRINSAKDDAAGLQISNRLQSQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDIAVRNANDGISIMQTAEGAMNETTNILQRMRDLSLQSANGSNSYAERIALQEEMTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +                +     M    ++    S +A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGSAAFQIGAASGEAVQVQLKSMRSDGIDMGGFSYIANG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                    +          ++F + E    N     D        + +   V+A+VN  
Sbjct: 181 RARSDWQVKEGANALSMSFTNRFGETETIQINAKAGDDIEELATYINGQTDKVTASVNEE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  LS +                    D       ++ ++ +   +  
Sbjct: 241 GQLQLFMAGEETSGTLSFSGDLASELGLQLKGYDAVDNIDITSVGGAQQAVAVLDTAMKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   +     L N +  + T  S+    +      ++       ++S  
Sbjct: 301 VDSHRAELGAYQNRFSHAINNLDNIHENLATSNSRIQDTDYAKETTRMVKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           I  + +K
Sbjct: 361 ILAQAKK 367


>gi|1169697|sp|P42273|FLIC2_PROMI RecName: Full=Flagellin 2
 gi|150887|gb|AAA62397.1| FlaB [Proteus mirabilis]
          Length = 367

 Score =  152 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 38/357 (10%), Positives = 89/357 (24%), Gaps = 8/357 (2%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+ +                   E + +G   +      A       +    N 
Sbjct: 1   MAQVINTNYLSLVTQNNLNRSQSALGNAIERLSSGMRINSAKDDAAGQAIANRFTSNING 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q +    V    G   N+        +    
Sbjct: 61  LTQASRNANDGISVSQTTEGALNEINNNLQRIRELTVQAKNGTNSNSDINSIQNEVNQRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  T            S+  +      + + + + D++    L   S  L   +
Sbjct: 121 DEINRVSEQTQFNGVKVLSGEKSKMTIQVGTNDNEVIEFNLDKIDNDTLGVASDKLFDAK 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +     A    D                +      D  +               V+  
Sbjct: 181 TEKKGVTAAGDAIDANALGISGSKKYVTGISVKEYKVDGKVSSDKVVLNDGSDDYIVSKS 240

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVL--------TKKMLSTVQQGLSGIIEQRAVLGI 293
                        EF     T    +              L+T+   +S + E R+ LG 
Sbjct: 241 DFTLKSGTTTGEVEFTGSKTTKFTADAGKDVKVLNVKDDALATLDNAISKVDESRSKLGA 300

Query: 294 SEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            +         L N  N +    S+ +  +  T  + +S      +    +  +  +
Sbjct: 301 IQNRFQSTINNLNNTVNNLSASRSRILDADYATEVSNMSKNQILQQAGTAVLAQANQ 357


>gi|332994155|gb|AEF04210.1| flagellar hook-associated protein FlgL [Alteromonas sp. SN2]
          Length = 407

 Score =  152 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 49/407 (12%), Positives = 93/407 (22%), Gaps = 53/407 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ISTS ++++      E  +  VK  E++ TG+              +L   +E + + 
Sbjct: 1   MRISTSQVYDQSIRSIMENQEGLVKTQEQLATGKRIITPADDPVGAAKVLRLTEELDGLT 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +N LVT  L   +A L+++   +      +V    G  D+         L      
Sbjct: 61  QFQRNNDLVTGSLEQQEAVLTNITNSINRARTLVVQAGSGILDDPDKRAIGAELEQIKLE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGF-------------- 169
                N  D           S      Y    S    +F                     
Sbjct: 121 IFDLMNTQDADGNYMYAGYQSANQAFTYNPASSGNAITFSGDAGVSFIQLSSSSKIQSTS 180

Query: 170 ------------LEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNA 217
                        + +                      F  +  D  +           A
Sbjct: 181 NGYEVFENVLSRFDFSVTGSTVADLQNTVVKEQGTFDTFFNKNYDPVTSANNDYQVEFLA 240

Query: 218 SDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVI------------------------- 252
           S             +      +                                      
Sbjct: 241 SGEAQLTNTGTGAVVGTVGYTSGSPFTIKGMQFEASAAVGDTINFSLDAPEKKSMAQSLH 300

Query: 253 --GTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNN 310
              T  +   + D A        L  +  GL  I  +RA +G              +   
Sbjct: 301 EIQTILMDSTIDDSALQEAIADSLVGLDNGLEKISLERASIGSRLNIAESTYESNLDMEI 360

Query: 311 IIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
                 S    V+   A  + +     +  +     ++  LS+ N++
Sbjct: 361 AAKASRSSIQDVDYAEASTEFAKQETALNAALATFPQVSNLSLFNFI 407


>gi|322807048|emb|CBZ04622.1| flagellar hook-associated protein FlgL [Clostridium botulinum
           H04402 065]
          Length = 385

 Score =  152 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 40/384 (10%), Positives = 112/384 (29%), Gaps = 30/384 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + +            ++  ++++++ +G++        A V   ++     +   
Sbjct: 1   MRITNNMMANSFMSDMNNNLENLNRINQQLTSGKNFSKPSHDPAGVIRSMQLYTSIDANK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + S V   L  +   L  + K +  +   L           +       +     S
Sbjct: 61  QYNKNISNVINWLDVTDTALDQIGKQLGKIRDKLEEAGNPGFGETERKALKDEVNGIIAS 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N T +G+Y+FSG   + KP        +             L +++   ++    
Sbjct: 121 MSQTLNTTFDGKYIFSGTRVTSKPTGIEKNGKNNELVYLKNDQSVLLLDDTLKAISAAEK 180

Query: 184 EVSSMNA-----------------------------QQMTDFIKQLEDKFSDDEYWANNW 214
                                                +++          SD++      
Sbjct: 181 LSGKSINEIKDSELLDFKSLVNKDPSTLTPEEKIKVDKLSSEEIDALKNLSDEDLKHLGE 240

Query: 215 SNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTK-KM 273
            N  +  +K  I +   ++ +               ++          D         + 
Sbjct: 241 YNQMNAKLKAEISEGVVMEYNVTATEVLQGGGDLRQLLENIVKHLESDDPNEINKLYGED 300

Query: 274 LSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLST 333
           L  + + L  ++  RA +G  +  ++  +   +  N  +   +S    V     + + + 
Sbjct: 301 LGNIDKALDNVLRIRAEVGAKQNRMDAAKEMNKETNFNMTEILSNIEDVNLVEKNMEFAI 360

Query: 334 LINKIEMSYMITTKLQKLSILNYL 357
           L +    S   + K+ + ++++YL
Sbjct: 361 LQSVYISSLQTSAKVLQPTLMDYL 384


>gi|156973598|ref|YP_001444505.1| flagellin [Vibrio harveyi ATCC BAA-1116]
 gi|156525192|gb|ABU70278.1| hypothetical protein VIBHAR_01301 [Vibrio harveyi ATCC BAA-1116]
          Length = 377

 Score =  152 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 41/368 (11%), Positives = 92/368 (25%), Gaps = 19/368 (5%)

Query: 1   MKTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKN 60
           M    I T+             N       E + +G   +      A +        +  
Sbjct: 1   MAVNVI-TNVSAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSR 59

Query: 61  HIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDS 120
            +   + + +       T++  ++    I+Q M    +    G     +       +   
Sbjct: 60  GLDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKAERVAIQEEVTAL 119

Query: 121 YESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
            +     A  T  G           +              +   M          S  A 
Sbjct: 120 NDELNRIAETTSFGGNKLLNGTYGTQSFQIGADNGEAVMLNLKDMRSDNKMMGGVSYQAD 179

Query: 181 QHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNM 240
              + +        D    L D F  ++    +     D        + +   V A+V+ 
Sbjct: 180 NGKDKNWNVEAGKNDLKISLTDSFGQEQEINISAKAGDDIEELATYINGQTDLVKASVDQ 239

Query: 241 RGIRDIMFVAVIGTEF------------------LSKNLTDGARNVLTKKMLSTVQQGLS 282
            G   +                            ++ +  D       ++ ++ +   L 
Sbjct: 240 DGKLQVFAGNNKVEGDVEFSGGLSGELGLNDGKKVTVDTIDVTSVGGAQESVAIIDAALK 299

Query: 283 GIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSY 342
            +   RA LG  +   N     L N N  ++   S+    +      Q++      + S 
Sbjct: 300 YVDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTQMTKSQILSQASS 359

Query: 343 MITTKLQK 350
            I  + ++
Sbjct: 360 SILAQAKQ 367


>gi|294636859|ref|ZP_06715191.1| flagellin [Edwardsiella tarda ATCC 23685]
 gi|291089920|gb|EFE22481.1| flagellin [Edwardsiella tarda ATCC 23685]
          Length = 376

 Score =  152 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 34/351 (9%), Positives = 94/351 (26%), Gaps = 8/351 (2%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+         +         E + +G   +      A       +    N 
Sbjct: 26  MAQVINTNSLSLMAQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAISNRFTANING 85

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q++    V    G   ++        +    
Sbjct: 86  LTQASRNANDGISLAQTTEGALNEVNNNLQNIRRLSVQAQNGSNSSSDLQSIQDEITQRL 145

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 +  TD         +       G    +++     +   +    +       G 
Sbjct: 146 GEIDRISQQTDFNGVKVLSKDQKLTIQVGANDGETIDIDLKNINAKTLGLDKFDVTDPGT 205

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            +  +      +     +     +      +  S  S  +   +                
Sbjct: 206 KIGEAVATGATVKADSGKDIAVKAPTAVAGSTVSVVSGTDKDGKAGYYVKAVNDTTG--- 262

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
                       +      +T GA+    K  L+T+ + LS + + R+ LG  +   +  
Sbjct: 263 -----EVTYNKASIADDGAVTTGAKVTDIKTPLATLDKALSQVDQLRSGLGAVQNRFDSV 317

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLS 352
              L +  N +    S+    +  T  + +S      +    +  +  + +
Sbjct: 318 INNLNSTVNNLSASRSRIQDADYATEVSNMSRAQILQQAGTSVLAQANQST 368


>gi|315654624|ref|ZP_07907530.1| flagellar protein [Mobiluncus curtisii ATCC 51333]
 gi|315491088|gb|EFU80707.1| flagellar protein [Mobiluncus curtisii ATCC 51333]
          Length = 318

 Score =  152 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 20/346 (5%), Positives = 78/346 (22%), Gaps = 41/346 (11%)

Query: 5   GISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAE 64
            I+ + +             +  K  E++ +G   +      + +        +     +
Sbjct: 4   SINQNIMAMNSYRNLSLTQSNLGKSLEKLSSGFRINRAADDSSGLAISEGLRSQVRGNKQ 63

Query: 65  RLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESF 124
            + +       + T++  L+ +  ++Q M    V       D          +       
Sbjct: 64  AVKNAQDGISVVQTAEGALNEVHDMLQRMRELAVKGANDTNDAKARAFIEQEMGQLKMEL 123

Query: 125 VTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLE 184
           V     T+          +  +        D    ++  +    +  ++   +       
Sbjct: 124 VRVGASTNFDGRKLLWNGTKVEKDAVVTGSDFAIAETAGKTQADWWGKSGGKMAFQVGAN 183

Query: 185 VSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIR 244
                   +T  ++ L          +      ++ +I  +       ++          
Sbjct: 184 -GDAEVDDITVKLEDLMTVTLASLADSKYSVKGTEADITVKDHKGYMAEIG--------- 233

Query: 245 DIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVF 304
                                           +   +  + + R+  G  +         
Sbjct: 234 -------------------------------KIDTAIHAVSKLRSDFGSVQNRFEHTINN 262

Query: 305 LQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
           L      +    ++    +  +   Q +      +    +  +  +
Sbjct: 263 LNVAVENLSASEARIRDTDMASEMMQFTRGQILQQAGTSMLAQANQ 308


>gi|121997312|ref|YP_001002099.1| flagellar hook-associated protein 3 [Halorhodospira halophila SL1]
 gi|121588717|gb|ABM61297.1| flagellar hook-associated protein 3 [Halorhodospira halophila SL1]
          Length = 420

 Score =  152 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 41/420 (9%), Positives = 97/420 (23%), Gaps = 66/420 (15%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +STS +             +      ++ +G+               L+ ++    + 
Sbjct: 1   MRVSTSHMQNTAVQNMTGQQSEINDTQTQLSSGRRVLRPSDDPTSAARTLDLKRATESLE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               +  L   RLS S++ L      +Q +    V    G  D +     A  + + Y+ 
Sbjct: 61  RFNRNGDLARTRLSMSESALEQAGNELQRIRELTVQAANGTQDASTRSYIASEIEERYKQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V   N  D         + +        T   +         +  +    +  +     
Sbjct: 121 LVELGNSRDGNGEYLFSGSRTRTQPFNMGTDGHVTYHGDQNSREVRIGPGRQIGVDHSGF 180

Query: 184 EVSSMNAQQMTDFIK-QLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
           +           +   Q E           +    S    +YRI+  E  D +    ++ 
Sbjct: 181 DAFMKVPDGNGQYQAFQGEGNRGTGVVSVVDGKVRSPTAEQYRIRFAEDEDGNTRYAVQR 240

Query: 243 IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTV--------------------QQGLS 282
             +                     +    +  +T+                         
Sbjct: 241 TDNPEDENAWEWVGTEDGGPPAVEDAPLYEPGATIEVDDGVRVKIEGHPEPGEDGDGDFF 300

Query: 283 GIIEQRAV---------LGISE--------KNINEERVFLQNKNNII------------- 312
            I   R+          +G  +           +     L                    
Sbjct: 301 TITGSRSQSIFATVNELIGALKEGEGPDFRNAADRALGDLDLAMENTYRVRSEIGARLST 360

Query: 313 ---------------DTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
                              S    ++   A  + +  +  +E +     ++Q LS+ +Y+
Sbjct: 361 LDSEKASNEAAIIDLKQATSDERDLDYAEATGRFNQELTGLEAAQSTFGRVQNLSLFDYI 420


>gi|551519|gb|AAD10271.1| polar flagellin [Vibrio parahaemolyticus]
          Length = 384

 Score =  152 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 40/375 (10%), Positives = 92/375 (24%), Gaps = 25/375 (6%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+           +   +     E + +G   +      A +        +   
Sbjct: 1   MAVTVSTNVSAMTAQRYLNKATNELNTSMERLSSGHKINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    ++Q M    +    G     +            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNEATSVMQRMRDLAIQSSNGTNSPAERQAINEESMALV 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +          +  +  
Sbjct: 121 DELNRIAETTSFGGRRLLNGSFGEAAFQIGASSGEAMIMGLTSIRADDTRMGGVTFFSEV 180

Query: 182 HLEVSSMNAQQMTD------FIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVS 235
                        D       + + ED   DD     N     D        + +   ++
Sbjct: 181 GKGKDWGVDPTKADLKITLPGMGEDEDGNVDDLEININAKAGDDIEELATYINGQSDMIN 240

Query: 236 ANVNMRGIRDIMFVAVIGTEF-------------------LSKNLTDGARNVLTKKMLST 276
           A+V+  G   I                              S    D      ++  +S 
Sbjct: 241 ASVSEDGKLQIFVAHPNVQGDISISGGLASELGLSDQPVRTSVQDIDMTTVQGSQNAISV 300

Query: 277 VQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLIN 336
           +   L  +  QRA LG  +  ++     L N    +D   S+    +      Q++    
Sbjct: 301 LDSALKYVDSQRADLGAKQNRLSHSINNLANIQENVDASNSRIKDTDFAKETTQMTKAQI 360

Query: 337 KIEMSYMITTKLQKL 351
             +    I  + ++L
Sbjct: 361 LQQAGTSILAQAKQL 375


>gi|15642143|ref|NP_231775.1| flagellin [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121586820|ref|ZP_01676602.1| flagellin FlaE [Vibrio cholerae 2740-80]
 gi|121727212|ref|ZP_01680379.1| flagellin FlaE [Vibrio cholerae V52]
 gi|147675318|ref|YP_001217667.1| flagellin [Vibrio cholerae O395]
 gi|153818818|ref|ZP_01971485.1| flagellin FlaE [Vibrio cholerae NCTC 8457]
 gi|153822628|ref|ZP_01975295.1| flagellin FlaE [Vibrio cholerae B33]
 gi|227082269|ref|YP_002810820.1| flagellin FlaE [Vibrio cholerae M66-2]
 gi|229507771|ref|ZP_04397276.1| flagellin protein FlaF [Vibrio cholerae BX 330286]
 gi|229511992|ref|ZP_04401471.1| flagellin protein FlaF [Vibrio cholerae B33]
 gi|229519128|ref|ZP_04408571.1| flagellin protein FlaF [Vibrio cholerae RC9]
 gi|229607316|ref|YP_002877964.1| flagellin [Vibrio cholerae MJ-1236]
 gi|254849230|ref|ZP_05238580.1| flagellin FlaE [Vibrio cholerae MO10]
 gi|255745119|ref|ZP_05419068.1| flagellin protein FlaF [Vibrio cholera CIRS 101]
 gi|262153493|ref|ZP_06028623.1| flagellin protein FlaF [Vibrio cholerae INDRE 91/1]
 gi|262167503|ref|ZP_06035209.1| flagellin protein FlaF [Vibrio cholerae RC27]
 gi|298497834|ref|ZP_07007641.1| flagellin FlaE [Vibrio cholerae MAK 757]
 gi|172044519|sp|P0C6C7|FLAE_VIBCH RecName: Full=Flagellin E
 gi|172047631|sp|A5F6A9|FLAE_VIBC3 RecName: Full=Flagellin E
 gi|9656696|gb|AAF95289.1| flagellin FlaE [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121548987|gb|EAX59026.1| flagellin FlaE [Vibrio cholerae 2740-80]
 gi|121630457|gb|EAX62850.1| flagellin FlaE [Vibrio cholerae V52]
 gi|126510661|gb|EAZ73255.1| flagellin FlaE [Vibrio cholerae NCTC 8457]
 gi|126519876|gb|EAZ77099.1| flagellin FlaE [Vibrio cholerae B33]
 gi|146317201|gb|ABQ21740.1| flagellin FlaE [Vibrio cholerae O395]
 gi|227010157|gb|ACP06369.1| flagellin FlaE [Vibrio cholerae M66-2]
 gi|227014040|gb|ACP10250.1| flagellin FlaE [Vibrio cholerae O395]
 gi|229343817|gb|EEO08792.1| flagellin protein FlaF [Vibrio cholerae RC9]
 gi|229351957|gb|EEO16898.1| flagellin protein FlaF [Vibrio cholerae B33]
 gi|229355276|gb|EEO20197.1| flagellin protein FlaF [Vibrio cholerae BX 330286]
 gi|229369971|gb|ACQ60394.1| flagellin protein FlaF [Vibrio cholerae MJ-1236]
 gi|254844935|gb|EET23349.1| flagellin FlaE [Vibrio cholerae MO10]
 gi|255736949|gb|EET92345.1| flagellin protein FlaF [Vibrio cholera CIRS 101]
 gi|262024075|gb|EEY42770.1| flagellin protein FlaF [Vibrio cholerae RC27]
 gi|262030730|gb|EEY49364.1| flagellin protein FlaF [Vibrio cholerae INDRE 91/1]
 gi|297542167|gb|EFH78217.1| flagellin FlaE [Vibrio cholerae MAK 757]
          Length = 378

 Score =  152 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 100/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             ++   +  E + +G   +      A +      E +   
Sbjct: 1   MAMTVNTNVSALVAQRHLNSASEMLNQSLERLSSGNRINSAKDDAAGLQISNRLETQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  +    +++Q M    +    G     +       +    
Sbjct: 61  LGIAVRNANDGISIMQTAEGAMQETTQLLQRMRDLSLQSANGSNSAAERVALQEEMAALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T             +       +     + S   M    LE    S +A  
Sbjct: 121 DELNRIAETTSFAGRKLLNGQFMKASFQIGASSGEAVQLSLRNMRSDSLEMGGFSYVAAA 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +      +          +   ++E          D        + +   VSA+VN +
Sbjct: 181 LADKQWQVTKGKQQLNISYVNAQGENENIQIQAKEGDDIEELATYINGKTDKVSASVNEK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  LS + +                  D +     ++ +S +   L  
Sbjct: 241 GQLQLYIAGKETSGTLSFSGSLANELQMNLLGYEAVDNLDISSAGGAQRAVSVIDTALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   R+ LG  +         L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDGHRSELGAMQNRFQHAISNLDNVHENLAASNSRIKDADYAKETTQMIKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKR 367


>gi|306820967|ref|ZP_07454587.1| flagellin [Eubacterium yurii subsp. margaretiae ATCC 43715]
 gi|304551081|gb|EFM39052.1| flagellin [Eubacterium yurii subsp. margaretiae ATCC 43715]
          Length = 354

 Score =  152 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 27/348 (7%), Positives = 89/348 (25%), Gaps = 4/348 (1%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++++          +          +++ +G+  +      A      +   +   + 
Sbjct: 1   MRLNSNPYAMYTLRHLQNTGNMQSLAMQKLSSGKRINNAKDDAAGYAISEKMAMQIAGLQ 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               ++      + T++  L  +  ++Q M    V                  +      
Sbjct: 61  RASKNSLDGISMIQTAETALDEVHSMLQRMRELSVQAANDTNKLEDRESIQKEINQLTSE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                  T+  +      ++ +               + +Q++    +  S + L    +
Sbjct: 121 INRIGEATEFNKMKMFTADNEDGTAKSNMNIPVQLGANANQIMDVKFQTLSSTSLGISGV 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
                   +  D  K                +  +   +K           + ++  R  
Sbjct: 181 NQ----GGEAFDINKVYVGHTHGTTIDEQTGAPVTPQYVKGAKYRAVDELQNMSIKERVG 236

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                 A    E+  +   D          +      +S +   RA LG S+  +     
Sbjct: 237 NVPQKDANGNFEYKKEYALDVTTASSATAAIHVYDNAISRVSSMRASLGASQNRLEHTIK 296

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKL 351
            L +    +   +S+    +     ++ +      +    + ++  +L
Sbjct: 297 TLDSSAENVTQTMSRIQDTDIAEQMSEFTKYNILQQSGTSMLSQANQL 344


>gi|84388099|ref|ZP_00990995.1| flagellin [Vibrio splendidus 12B01]
 gi|84377166|gb|EAP94036.1| flagellin [Vibrio splendidus 12B01]
          Length = 378

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 38/369 (10%), Positives = 91/369 (24%), Gaps = 19/369 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+           + + D     E + +G   +      A +        +   
Sbjct: 1   MAINVSTNVSAMTAQRYLNKASNDLATSMERLSSGHKINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    ++Q M    +    G     +            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTNVLQRMRDLAIQSSNGTNSAAERTALNEESSALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +          +  +  
Sbjct: 121 DELNRIAETTSFGGRRLLNGSFGEASFQIGSSSGEAMIMGLTSVRADDFRMGGTTFDSEN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S       +D   +   K  +D     N     D        + +   V+A+V   
Sbjct: 181 GKDKSWEVPPTASDLKFEFRTKAGEDIVLDINTKAGDDIEELATYINGQSDLVNASVTDD 240

Query: 242 -------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLS 282
                              G               S           ++  +S +   + 
Sbjct: 241 GRIQLFVAEPDLDGAMSISGGLASELGIKSEGRATSVQDISLTSVAGSQNAISVIDSAMK 300

Query: 283 GIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSY 342
            +  QRA LG  +  ++     L N    +D   S+    +      Q++      +   
Sbjct: 301 YVDSQRADLGAKQNRLSHSINNLANVQENVDASNSRIKDTDFAKETTQMTKSQILQQAGT 360

Query: 343 MITTKLQKL 351
            I  + ++L
Sbjct: 361 SILAQAKQL 369


>gi|261252313|ref|ZP_05944886.1| flagellin B [Vibrio orientalis CIP 102891]
 gi|260935704|gb|EEX91693.1| flagellin B [Vibrio orientalis CIP 102891]
          Length = 377

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 42/367 (11%), Positives = 97/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNGAADGMQKSMERLSSGYKINSARDDAAGLQISNRLNSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDMAVKNANDGISIAQTAEGAMNETTNILQRMRDLALQSSNGSNSRGERIAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G          +K      +     +     M    ++   K+ +A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFGDKSFQIGASSGEAVQLGIGNMRSDTIDMGGKAYVATA 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +     A   TD      D   + +    N     D        + +  DV A+V   
Sbjct: 181 GKDADWGVAAGATDLTLGYTDVHGEAKNITINAKVGDDVEQLATYINGQSEDVKASVGEE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +   +      ++                      D      ++  +S +   L  
Sbjct: 241 GKLQLFAASNKVATDVTIGGGLGGEIGFGAAEDRTVADVDVTTVAGSQLAVSVIDGALKT 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +         L N N  ++   S+ +  +       ++      + S  
Sbjct: 301 VDSQRAELGAFQNRFGHAISNLDNINENVNASRSRIVDTDYAKETTAMTKSQILQQASTS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|86146147|ref|ZP_01064473.1| flagellin [Vibrio sp. MED222]
 gi|85836094|gb|EAQ54226.1| flagellin [Vibrio sp. MED222]
          Length = 399

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 36/390 (9%), Positives = 92/390 (23%), Gaps = 40/390 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+           + + +     E + +G   +      A +        +   
Sbjct: 1   MAINVSTNVSAMTAQRYLNKSSNELATSMERLSSGHKINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTNILQRMRDLAIQSSNGTNSPAERQALNEETMALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E               +   +          +     
Sbjct: 121 DELNRIAETTAFGGRRLLNGSFGEASFQIGSNSGEAMIMALTSIRADDFRMGGTTFDTEN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S        D   + + K  ++     +     D        + +   ++A+V   
Sbjct: 181 AKDKSWEVPVAAKDLKFEFKTKAGEEITLDISAKAGDDIEELATYINGQSDLINASVTDE 240

Query: 242 G----------------------------------------IRDIMFVAVIGTEFLSKNL 261
           G                                            +  A           
Sbjct: 241 GRIQVFVAEPDLDGEMRISGGLASELGFKNDAPEGQETTTTADGKVVPAPAVGRTTLVQD 300

Query: 262 TDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIG 321
            D      ++  +S +   +  +  QRA LG  +  ++     L N    +D   S+   
Sbjct: 301 VDLNTVAGSQNAISVIDSAMQYVDSQRADLGAKQNRLSHSINNLANVQENVDASNSRIKD 360

Query: 322 VEQHTAHAQLSTLINKIEMSYMITTKLQKL 351
            +      Q++      +    I  + ++L
Sbjct: 361 TDFAKETTQMTKAQILQQAGTSILAQAKQL 390


>gi|328473444|gb|EGF44292.1| flagellin [Vibrio parahaemolyticus 10329]
          Length = 378

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 43/368 (11%), Positives = 91/368 (24%), Gaps = 19/368 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K                  M          S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTHGAKSFQIGADNGEAVMLELKDMRSDNKMMGGVSYQAES 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   AQ   D    L D F  ++    N     D        + +   V A+V+  
Sbjct: 181 GKGKDWNVAQGKNDLKISLTDSFGQEQEININAKAGDDIEELATYINGKPDLVKASVDQD 240

Query: 242 GIRDIMFVAV-------------------IGTEFLSKNLTDGARNVLTKKMLSTVQQGLS 282
           G   I                           + ++ +  D       ++ ++ +   L 
Sbjct: 241 GKLQIFAGNNKVEGEVSFSGGLSGELGLGDNKKNVTVDTIDVTSVGGAQESVAIIDAALK 300

Query: 283 GIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSY 342
            +   RA LG  +   N     L N N  ++   S+    +       ++      + S 
Sbjct: 301 YVDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTAMTKSQILSQASS 360

Query: 343 MITTKLQK 350
            I  + ++
Sbjct: 361 SILAQAKQ 368


>gi|170757647|ref|YP_001782345.1| flagellar hook-associated protein 3 [Clostridium botulinum B1 str.
           Okra]
 gi|169122859|gb|ACA46695.1| flagellar hook-associated protein 3 [Clostridium botulinum B1 str.
           Okra]
          Length = 320

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 40/354 (11%), Positives = 105/354 (29%), Gaps = 35/354 (9%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + +            ++  ++ +++ +G++        A V   ++     +   
Sbjct: 1   MRITNNMMANSFMTDMNNNLENLDRIRQQLTSGKNFSKPSHDPAGVIRSMQLYSGIDANK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + S V   L  +   L  + K +  +   L           +       +     S
Sbjct: 61  QYNKNISNVINWLDVTDTALDQIGKQLGKIRDKLEEAGNPGFGETERKALKDEVNGIIAS 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N T +G+Y+FSG   + KP                                   +
Sbjct: 121 MSQSLNTTFDGKYIFSGTRVTGKP---------------------------------TGV 147

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           +          D++ +      D                       E    +  V   G 
Sbjct: 148 QKDGTTKNNSIDYVNRDGSMPLDPAGDEYKQMEGKLKAEISEGVVMEYNVTATEVLEGGG 207

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                +  I     S + ++ ++  L  + L  + + L  ++  RA +G  +  +   + 
Sbjct: 208 DLRKLLEDIVKHLDSDDQSEISK--LYGEDLGNIDKALDNVLRIRAEVGAKQNRMEAAKE 265

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             +  N  +   +S    ++    + + + L +    S   + K+ + ++++YL
Sbjct: 266 MNKETNFNLHEILSNIEDIDLVEKNMEYAILQSVYISSLQTSAKILQPTLMDYL 319


>gi|254230132|ref|ZP_04923527.1| flagellin [Vibrio sp. Ex25]
 gi|262394931|ref|YP_003286785.1| flagellin protein FlaC [Vibrio sp. Ex25]
 gi|151937325|gb|EDN56188.1| flagellin [Vibrio sp. Ex25]
 gi|262338525|gb|ACY52320.1| flagellin protein FlaC [Vibrio sp. Ex25]
          Length = 384

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 40/375 (10%), Positives = 95/375 (25%), Gaps = 25/375 (6%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+           +   +     E + +G   +      A +        +   
Sbjct: 1   MAVTVSTNVSAMTAQRYLNKATDELNTSMERLSSGHKINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    ++Q M    +    G     +            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNEATSVMQRMRDLAIQSSNGTNSPAERQAINEESMALI 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +          + L+  
Sbjct: 121 DELNRIAETTSFGGRRLLNGSFGEAAFQIGASSGEAMIMGLTSIRADDTRMGGVTFLSEN 180

Query: 182 HLEVSSMNAQQMTD------FIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVS 235
             +         +D       + + ED   DD     N     D        + +   ++
Sbjct: 181 GKDKDWGVDPAKSDLKITLPGMGEDEDGNVDDLEININAKAGDDIEELATYINGQSDMIN 240

Query: 236 ANVNMRGIRDIMFVAVIGTEF-------------------LSKNLTDGARNVLTKKMLST 276
           A+V+  G   +                              S    D      ++  +S 
Sbjct: 241 ASVSEDGKLQVFVAHPNVQGEISISGGLASELGLSDEPLRTSVQDIDMTTVQGSQNAISV 300

Query: 277 VQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLIN 336
           +   L  +  QRA LG  +  ++     L N    +D   S+    +      Q++    
Sbjct: 301 LDSALKYVDSQRADLGAKQNRLSHSINNLANIQENVDASNSRIKDTDFAKETTQMTKAQI 360

Query: 337 KIEMSYMITTKLQKL 351
             +    I  + ++L
Sbjct: 361 LQQAGTSILAQAKQL 375


>gi|317130314|ref|YP_004096596.1| flagellar hook-associated protein 3 [Bacillus cellulosilyticus DSM
           2522]
 gi|315475262|gb|ADU31865.1| flagellar hook-associated protein 3 [Bacillus cellulosilyticus DSM
           2522]
          Length = 394

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 30/393 (7%), Positives = 100/393 (25%), Gaps = 39/393 (9%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++ S +         +  +    +  ++ TG+      Q      + + +  +     
Sbjct: 1   MRVTQSMLTNSSLRHLSQSYQTLHDIQNQLATGKKISRASQDPVIAMNGMRYRTQVVETE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + + V   +  + A L  +   +  +    V       ++ +    +  +    E 
Sbjct: 61  QFNRNLTEVYNWMENADATLDQVTSTMHRIRELAVQASNDTYESTQRANISKEIEQLREH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
             + AN     +Y+F+G N++  PL+                       +          
Sbjct: 121 LQSLANTKANNKYIFNGTNTTNAPLDADQMNVGFNAIEEALADLPNFNADEAVPFTHVLT 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR-- 241
             S        +    +    ++         +   +   +    T   +    V     
Sbjct: 181 HNSGRYELVEKNDDGYIFQDVNNPNKSITVAVDGEGNPESFTHAHTYVNNAGETVTDTKD 240

Query: 242 -------------------------------------GIRDIMFVAVIGTEFLSKNLTDG 264
                                                             +         
Sbjct: 241 LKERQFVVSRLDSVSTNTQKVEIELLKGVNVATNINPSNVFSTDFFGDIYQLEKALNDPA 300

Query: 265 ARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQ 324
           A     +++++   + +  ++ +RA LG     +      ++ +  I    +S +   + 
Sbjct: 301 ATGKELEELIANFDRQIDKVVNERAELGARYNRVEMIDDRMKEQEVIARRILSNNEDADI 360

Query: 325 HTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
                 L +  N    +     ++ + +++++L
Sbjct: 361 EKVITNLLSSENVHRAALSSMGRIMQPTLMDFL 393


>gi|77165831|ref|YP_344356.1| flagellin-like [Nitrosococcus oceani ATCC 19707]
 gi|254433202|ref|ZP_05046710.1| flagellar hook-associated protein 3 [Nitrosococcus oceani AFC27]
 gi|76884145|gb|ABA58826.1| Flagellin-like protein [Nitrosococcus oceani ATCC 19707]
 gi|207089535|gb|EDZ66806.1| flagellar hook-associated protein 3 [Nitrosococcus oceani AFC27]
          Length = 400

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 54/400 (13%), Positives = 115/400 (28%), Gaps = 46/400 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ISTS   ++             K  +++ +G+              +LE  +     A
Sbjct: 1   MRISTSLFQQQSIDGMLRQQAQVSKTQQQIASGERMQTPADDPIAAARLLEVREASGRTA 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +    T RLS  +  L+ +  ++Q +    V    G  +N    I A  +R     
Sbjct: 61  QFQTNADRATARLSQEENALAGVNNVLQGVRELAVQANNGAQNNENRAIIAQEVRQRLNE 120

Query: 124 FVTFANMTDEGQ-YLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
            V  AN  D    YLF+G     +P        S       +++            +G  
Sbjct: 121 LVGLANSQDASGEYLFAGAKGRSQPFIQEGGSVSYQGDQAQRLISIGPSVQVADSHSGSE 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDD----------------------------------- 207
           + ++      +        +  S                                     
Sbjct: 181 VFLAIREGNGVFATEANPSNTGSGVIAPGSVNGAFIPDNYTLQFSQATPDDPLTYQVLDS 240

Query: 208 ----------EYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFL 257
                               +  +I     D +   + A+ +                 +
Sbjct: 241 QNTVVANGGFASGEEITFGGAQVSITGIPADGDSFTLHASAHRDMFTIAQHFIEALERPI 300

Query: 258 SKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYIS 317
           +   +    +    + L+ + Q +  I+E R  +G     ++ ER   +  +  +    S
Sbjct: 301 NDTASQARFHNDMNRALTDLDQAMGKILEVRTEVGTRLNAVDRERQVNEEASLQLAREQS 360

Query: 318 KSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
               ++   A  +L+  +  +E +     +LQ LS+ N+L
Sbjct: 361 SLNDLDLAEAIGRLNQQLTGLEAAQRTYARLQGLSLFNFL 400


>gi|156975442|ref|YP_001446349.1| flagellin [Vibrio harveyi ATCC BAA-1116]
 gi|156527036|gb|ABU72122.1| hypothetical protein VIBHAR_03173 [Vibrio harveyi ATCC BAA-1116]
          Length = 377

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 39/367 (10%), Positives = 92/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +              +   M          S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYGTQSFQIGADNGEAVMLNLKDMRSDNQMMGGVSYQADN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +        D    L D F  ++    +     D        + +   V A+V+  
Sbjct: 181 GKDKNWNVEAGKNDLKISLTDSFGQEQEINISAKAGDDIEELATYINGQTDLVKASVDQD 240

Query: 242 GIRDIMFVAVIGTEF------------------LSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +                            ++ +  D       ++ ++ +   L  
Sbjct: 241 GKLQVFAGNNKVEGDVEFSGGLSGELGLNDGKKVTVDTIDVTSVGGAQESVAIIDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +      Q++      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTQMTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|254519435|ref|ZP_05131491.1| flagellar hook-associated protein 3 [Clostridium sp. 7_2_43FAA]
 gi|226913184|gb|EEH98385.1| flagellar hook-associated protein 3 [Clostridium sp. 7_2_43FAA]
          Length = 331

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 36/361 (9%), Positives = 112/361 (31%), Gaps = 38/361 (10%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+   + +              KL++++ +G+          +V   ++  ++     
Sbjct: 1   MRITNQMMSKSFLRDLGRNQGYMKKLNDQLTSGKEIRRPSDNPFKVARSMQLHRDIGANT 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +    T  L T+   L  +    Q     +V        +++       + +    
Sbjct: 61  QYNENIKDTTNWLDTTDTALEQLGNSFQRFRELMVSAGNAAYGSDEKKAIKDEMNEKVNE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N + +G+Y+F G   + KP+                               G + 
Sbjct: 121 IAQILNSSFDGKYIFGGTKGNTKPI-------------------------------GTNK 149

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNM--- 240
           ++ + N             +  + +    N     +  +   +     +D +        
Sbjct: 150 DIVTGNNSIHLSGNDGEVLELDNLDESVQNQIGMINKKLTVEVSQGVTMDYNVCATDLLL 209

Query: 241 ----RGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEK 296
                G    +   +        +        +T + L T+ + ++ +++ RA +G  + 
Sbjct: 210 FKDKNGSDVNVMGLLKEITDNIGSEDASVSGKVTNENLKTMDETIANLLKIRAEVGAKQN 269

Query: 297 NINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNY 356
            +       + +N  +   +S++  ++    + + +   +    S  ++ K+ + S+L++
Sbjct: 270 RMESAGDQNEEQNFNLKDILSQTEDIDFAEKNIEATVAQSVYMASLQVSAKIIQPSLLDF 329

Query: 357 L 357
           L
Sbjct: 330 L 330


>gi|45441370|ref|NP_992909.1| flagellin [Yersinia pestis biovar Microtus str. 91001]
 gi|229896288|ref|ZP_04511458.1| thermoregulated motility protein [Yersinia pestis Pestoides A]
 gi|45436230|gb|AAS61786.1| thermoregulated motility protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|229701211|gb|EEO89240.1| thermoregulated motility protein [Yersinia pestis Pestoides A]
          Length = 369

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 39/369 (10%), Positives = 95/369 (25%), Gaps = 16/369 (4%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              I+T+S+         +         E + +G   +      A       +      +
Sbjct: 1   MAVINTNSLSLLTQNNLNKSQSSLGTAIERLSSGLRINSAKDDAAGQAIANRFTSNIKGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
            +   + +       T++  L+ +   +Q +    V    G   ++        +     
Sbjct: 61  TQAARNANDGISIAQTTEGSLNEINNNLQRVRELTVQAQNGSNSSSDLDSIQDEISLRLA 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                ++ T          N++     G    +++         +     +         
Sbjct: 121 EIDRVSDQTQFNGKKVLAENTTMSIQVGANDGETIDINLQKIDSKSLGLGSYSVSGVSGA 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
           L   +  +         L+                 D        D   I  +     +G
Sbjct: 181 LTSLTDTSVTGVTTTTALDFSDISTFAKGATVHGIGDVGTDGAYADGYVIRTTDGKQYKG 240

Query: 243 IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLS-----------TVQQGLSGIIEQRAVL 291
             D     V   +  + +  D A  +      S           T+   +  +   R+ L
Sbjct: 241 EVDATNGKVTFADDANGDPIDDATKLEAAAQFSPAGKATASPLETLDDAIKQVDGLRSSL 300

Query: 292 GISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK- 350
           G  +         L N    + +  S+   V+  T  + +S      +    + ++  + 
Sbjct: 301 GAVQNRFESAVTNLNNTVTNLTSARSRIEDVDYATEVSNMSRAQILQQAGTSVLSQANQV 360

Query: 351 ----LSILN 355
               LS+LN
Sbjct: 361 PQTVLSLLN 369


>gi|170760719|ref|YP_001788055.1| flagellar hook-associated protein 3 [Clostridium botulinum A3 str.
           Loch Maree]
 gi|169407708|gb|ACA56119.1| flagellar hook-associated protein 3 [Clostridium botulinum A3 str.
           Loch Maree]
          Length = 320

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 39/355 (10%), Positives = 107/355 (30%), Gaps = 37/355 (10%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+   +            ++  ++++++ +G++        A V   ++     +   
Sbjct: 1   MRITNKMMANSFMTDMNNNLENLNRINQQLTSGKNFSKPSHDPAGVIRSMQLYTGIDANK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + S V   L  +   L  + K +  +   L           +       +     S
Sbjct: 61  QYNKNISNVINWLDVTDTALDQIGKQLGKIRDKLEEAGNPGFGETERKALKDEVNGIIAS 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N T +G+Y+FSG   + KP                                   +
Sbjct: 121 MSQTLNTTFDGKYIFSGTRVTGKP---------------------------------TGI 147

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           +          D++ +      D            +  +K  I +   ++ +        
Sbjct: 148 QKDGTTKNNSIDYVNRDGSMPLDPAGDE---YKQMNGKLKAEISEGVVMEYNVTATEVLE 204

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTK-KMLSTVQQGLSGIIEQRAVLGISEKNINEER 302
            D+    ++       +  D +       + L  + + L  ++  RA +G  +  ++  +
Sbjct: 205 GDVDLRKLLENIVKHLDSNDQSEINKLYGEDLGNIDKALDNVLRIRAGVGAKQNRMDAAK 264

Query: 303 VFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
              +  N  +   +S    V+    + + + L      S   + K+ + ++++YL
Sbjct: 265 EMNKETNINMTEILSNIEDVDYAEKNMEFAVLQAVYISSLQTSAKVLQPTLMDYL 319


>gi|91225882|ref|ZP_01260851.1| flagellin [Vibrio alginolyticus 12G01]
 gi|91189532|gb|EAS75808.1| flagellin [Vibrio alginolyticus 12G01]
          Length = 377

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 91/367 (24%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K                  M          S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTHGAKSFQIGADNGEAVMLELKDMRSDNKMMGGVSYQAES 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   AQ   D    L D +  ++    +     D        + +   V A+V+  
Sbjct: 181 GKGKDWNVAQGKNDLKINLTDSYGQEQEINISAKAGDDIEELATYINGQTDLVKASVDQD 240

Query: 242 GIRDIMFVAV------------------IGTEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I                          + ++ +  D       ++ ++ +   L  
Sbjct: 241 GKLQIFAGNNKVEGEVEFSGGLSGELGLGEGKKVTVDTIDVTSVGGAQESVAIIDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       ++      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTAMTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|168183197|ref|ZP_02617861.1| flagellar hook-associated protein 3 [Clostridium botulinum Bf]
 gi|237796174|ref|YP_002863726.1| flagellar hook-associated protein 3 [Clostridium botulinum Ba4 str.
           657]
 gi|182673643|gb|EDT85604.1| flagellar hook-associated protein 3 [Clostridium botulinum Bf]
 gi|229261031|gb|ACQ52064.1| flagellar hook-associated protein 3 [Clostridium botulinum Ba4 str.
           657]
          Length = 320

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 42/355 (11%), Positives = 104/355 (29%), Gaps = 37/355 (10%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+   +            ++  +++++  +G++        A V   ++     +   
Sbjct: 1   MRITNKMMANSFMTDMNNNLENLNRINQQSSSGKNFSKPSHDPAGVIRSMQLHTGIDANK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + S V   L  +   L  + K +  +   L           +       +     S
Sbjct: 61  QYNKNISNVINWLDVTDTALDQIGKQLGKIRDKLEEAGNAGYGETERKALKDEVNGIIAS 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N   +G+Y+FSG   + KP                                   +
Sbjct: 121 MSQTLNTNFDGKYVFSGTRVTGKP---------------------------------TGI 147

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           +          D+I +      D            +  +K  I +   ++ +        
Sbjct: 148 QKDGTTKNNSIDYINKDGSMPLDPAGDE---YKQMNGKLKAEISEGVVMEYNVTATEVLQ 204

Query: 244 RDIMFVAVIGTEFLSKNLTDG-ARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEER 302
            D+    ++       +  D    N L  + L  + + L  ++  RA +G  +  +   +
Sbjct: 205 GDVDLRKLLENIVNHLDSDDPKEINKLYGEDLGNIDKALDNVLRIRAEVGAKQNRMEAAK 264

Query: 303 VFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
              +  N  +   +S    V     H + + L      S   + K+ + ++++YL
Sbjct: 265 EMNKETNFNMTEILSNIEDVNYAEKHMEFAVLQAVYISSLQTSAKILQPTLMDYL 319


>gi|153825600|ref|ZP_01978267.1| flagellin FlaE [Vibrio cholerae MZO-2]
 gi|153828605|ref|ZP_01981272.1| flagellin FlaE [Vibrio cholerae 623-39]
 gi|229513795|ref|ZP_04403257.1| flagellin protein FlaF [Vibrio cholerae TMA 21]
 gi|229522097|ref|ZP_04411514.1| flagellin protein FlaF [Vibrio cholerae TM 11079-80]
 gi|229524145|ref|ZP_04413550.1| flagellin protein FlaF [Vibrio cholerae bv. albensis VL426]
 gi|229528844|ref|ZP_04418234.1| flagellin protein FlaF [Vibrio cholerae 12129(1)]
 gi|254226372|ref|ZP_04919961.1| flagellin FlaE [Vibrio cholerae V51]
 gi|254291381|ref|ZP_04962174.1| flagellin FlaE [Vibrio cholerae AM-19226]
 gi|262192269|ref|ZP_06050426.1| flagellin protein FlaF [Vibrio cholerae CT 5369-93]
 gi|125621122|gb|EAZ49467.1| flagellin FlaE [Vibrio cholerae V51]
 gi|148875876|gb|EDL74011.1| flagellin FlaE [Vibrio cholerae 623-39]
 gi|149740751|gb|EDM54850.1| flagellin FlaE [Vibrio cholerae MZO-2]
 gi|150422711|gb|EDN14665.1| flagellin FlaE [Vibrio cholerae AM-19226]
 gi|229332618|gb|EEN98104.1| flagellin protein FlaF [Vibrio cholerae 12129(1)]
 gi|229337726|gb|EEO02743.1| flagellin protein FlaF [Vibrio cholerae bv. albensis VL426]
 gi|229341022|gb|EEO06027.1| flagellin protein FlaF [Vibrio cholerae TM 11079-80]
 gi|229348976|gb|EEO13933.1| flagellin protein FlaF [Vibrio cholerae TMA 21]
 gi|262031879|gb|EEY50460.1| flagellin protein FlaF [Vibrio cholerae CT 5369-93]
 gi|327484672|gb|AEA79079.1| Flagellin protein FlaF [Vibrio cholerae LMA3894-4]
          Length = 378

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 100/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             ++   +  E + +G   +      A +      E +   
Sbjct: 1   MAMTVNTNVSALVAQRHLNSASEMLNQSLERLSSGNRINSAKDDAAGLQISNRLETQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  +    +++Q M    +    G     +       +    
Sbjct: 61  LGIAVRNANDGISIMQTAEGAMQETTQLLQRMRDLSLQSANGSNSAAERVALQEEMAALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T             +       +     + S   M    LE    S +A  
Sbjct: 121 DELNRIAETTSFAGRKLLNGQFMKASFQIGASSGEAVQLSLRNMRSDSLEMGGFSYVAAA 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +      +          +   ++E          D        + +   VSA+VN +
Sbjct: 181 LADKQWQVTKGKQQLNISYVNAQGENENIQIQAKEGDDIEELATYINGQTDKVSASVNEK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  LS + +                  D +     ++ +S +   L  
Sbjct: 241 GQLQLYIAGKETSGTLSFSGSLANELQMNLLGYEAVDNLDISSAGGAQRAVSVIDTALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   R+ LG  +         L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDGHRSELGAMQNRFQHAISNLDNVHENLAASNSRIKDADYAKETTQMIKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKR 367


>gi|153213262|ref|ZP_01948674.1| flagellin FlaE [Vibrio cholerae 1587]
 gi|153801647|ref|ZP_01956233.1| flagellin FlaE [Vibrio cholerae MZO-3]
 gi|124116062|gb|EAY34882.1| flagellin FlaE [Vibrio cholerae 1587]
 gi|124122824|gb|EAY41567.1| flagellin FlaE [Vibrio cholerae MZO-3]
          Length = 378

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 100/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             ++   +  E + +G   +      A +      E +   
Sbjct: 1   MAMTVNTNVSALVAQRHLNSASEMLNQSLERLSSGNRINSAKDDAAGLQISNRLETQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  +    +++Q M    +    G     +       +    
Sbjct: 61  LGIAVRNANDGISIMQTAEGAMQETTQLLQRMRDLSLQSANGSNSAAERTALQEEMAALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T             +       +     + S   M    LE    S +A  
Sbjct: 121 DELNRIAETTSFAGRKLLNGQFMKASFQIGASSGEAVQLSLRNMRSDSLEMGGFSYVAAA 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +      +          +   ++E          D        + +   VSA+VN +
Sbjct: 181 LADKQWQVTKGKQQLNISYVNAQGENENIQIQAKEGDDIEELATYINGQTDKVSASVNEK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  LS + +                  D +     ++ +S +   L  
Sbjct: 241 GQLQLYIAGKETSGTLSFSGSLANELQMNLLGYEAVDNLDISSAGGAQRAVSVIDTALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   R+ LG  +         L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDGHRSELGAMQNRFQHAISNLDNVHENLAASNSRIKDADYAKETTQMIKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKR 367


>gi|220927555|ref|YP_002504464.1| flagellar hook-associated protein FlgL [Clostridium cellulolyticum
           H10]
 gi|219997883|gb|ACL74484.1| flagellar hook-associated protein 3 [Clostridium cellulolyticum
           H10]
          Length = 309

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 45/354 (12%), Positives = 102/354 (28%), Gaps = 46/354 (12%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + +   M            K   ++ TG+               L+   + + I 
Sbjct: 1   MRITNNMLISNMLTALGNNESRLSKYQNQLHTGKKIQLPSDDPIVAARALKLRTDVSKIE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       +  + A L+ +  I++           G     +       ++     
Sbjct: 61  QYQKNLGDAQSWVDATDAALAQIGDILKRAKELATQAANGTNSITETSDIGQEMKQLKVQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V  AN T  G+Y+FSG  + +K +    T  +  K   D                    
Sbjct: 121 LVHIANTTYSGRYMFSGFKTDQKLIEDDETSANFGKFEIDV------------------- 161

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
                                 +       +   +  NI   +   +  +   N    G 
Sbjct: 162 ----------------------NTVTEKIQFEIGAGDNININVAGGDIFNSGGNAVNGGE 199

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
             ++ +       L      G  + L     S   Q +  ++  RA +G  +  I+    
Sbjct: 200 PAMIALFTNVIADLDSGDNAGVSSQL-----SQFDQQIDNLLRVRADIGARQNRIDLSAD 254

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            + N    + + +SK+  V+       L    N  + S     ++ + +++++L
Sbjct: 255 RMSNDLVNMTSLMSKNEDVDPAETIMNLKNEENVYQASLAGGARIIQQTLVDFL 308


>gi|297582042|ref|ZP_06943961.1| flagellin FlaE [Vibrio cholerae RC385]
 gi|297533737|gb|EFH72579.1| flagellin FlaE [Vibrio cholerae RC385]
          Length = 378

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 37/367 (10%), Positives = 101/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             ++   +  E + +G   +      A +      E +   
Sbjct: 1   MAMTVNTNVSALVAQRHLNSASEMLNQSLERLSSGNRINSAKDDAAGLQISNRLETQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  +    +++Q M    +    G     +       +    
Sbjct: 61  LGIAVRNANDGISIMQTAEGAMQETTQLLQRMRDLSLQSANGSNSAAERVALQEEMAALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T             +       +     + S   M    L+    S +A  
Sbjct: 121 DELNRIAETTSFAGRKLLNGQFMKASFQIGASSGEAVQLSLRNMRSDSLDMGGFSYVAAA 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +      +          +   ++E       +  D        + +   VSA+VN +
Sbjct: 181 LADKQWQVTKGKQQLNISYVNAQGENENIQIQAKDGDDIEELATYINGQTDKVSASVNEK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  LS + +                  D +     ++ +S +   L  
Sbjct: 241 GQLQLYIAGKETSGTLSFSGSLANELQMNLLGYEAVDNLDISSAGGAQRAVSVIDTALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   R+ LG  +         L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDGHRSELGAMQNRFQHAISNLDNVHENLAASNSRIKDADYAKETTQMIKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKR 367


>gi|91225881|ref|ZP_01260850.1| flagellin [Vibrio alginolyticus 12G01]
 gi|269965416|ref|ZP_06179535.1| Flagellin A [Vibrio alginolyticus 40B]
 gi|91189531|gb|EAS75807.1| flagellin [Vibrio alginolyticus 12G01]
 gi|222820586|gb|ACM67643.1| flagellin [Vibrio alginolyticus]
 gi|269829895|gb|EEZ84125.1| Flagellin A [Vibrio alginolyticus 40B]
          Length = 384

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 40/375 (10%), Positives = 95/375 (25%), Gaps = 25/375 (6%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+           +   +     E + +G   +      A +        +   
Sbjct: 1   MAVTVSTNVSAMTAQRYLNKATDELNTSMERLSSGHKINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    ++Q M    +    G     +            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNEATSVMQRMRDLAIQSSNGTNSPAERQAINEESMALI 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +           +          + L+  
Sbjct: 121 DELNRIAETTSFGGRRLLNGSFGEAAFQIGASSGEAMIMGLTSIRADDTRMGGVTFLSEN 180

Query: 182 HLEVSSMNAQQMTD------FIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVS 235
             + +       +D       + + ED   DD     N     D        + +   ++
Sbjct: 181 GKDKNWSVDPAKSDLKITLPGMGEDEDGNVDDLEININAKAGDDIEELATYINGQSDMIN 240

Query: 236 ANVNMR-------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLST 276
           A+V+                     G               S    D      ++  +S 
Sbjct: 241 ASVSEDGKLQVFVAHPNVQGEISISGGLASELGLSDEPIRTSVQDIDMTTVQGSQNAISV 300

Query: 277 VQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLIN 336
           +   L  +  QRA LG  +  ++     L N    +D   S+    +      Q++    
Sbjct: 301 LDSALKYVDSQRADLGAKQNRLSHSINNLANIQENVDASNSRIKDTDFAKETTQMTKAQI 360

Query: 337 KIEMSYMITTKLQKL 351
             +    I  + ++L
Sbjct: 361 LQQAGTSILAQAKQL 375


>gi|168180855|ref|ZP_02615519.1| flagellar hook-associated protein 3 [Clostridium botulinum NCTC
           2916]
 gi|182668320|gb|EDT80299.1| flagellar hook-associated protein 3 [Clostridium botulinum NCTC
           2916]
          Length = 320

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 38/355 (10%), Positives = 107/355 (30%), Gaps = 37/355 (10%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+   +            ++  ++++++ +G++        A V   ++     +   
Sbjct: 1   MRITNKMMANSFMTDMNNNLENLNRINQQLTSGKNFSKPSHDPAGVIRSMQLYTGIDANK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + S V   L  +   L  + K +  +   L           +       +     S
Sbjct: 61  QYNKNISNVINWLDVTDTALDQIGKQLGKIRDKLEEAGNPGFGETERKALKDEVNGIIAS 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N T +G+Y+FSG   + KP                                   +
Sbjct: 121 MSQSLNTTFDGKYIFSGTRVTGKP---------------------------------TGI 147

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           +          D++ +      +            +  +K  I +   ++ +        
Sbjct: 148 QKDGTTKNNSIDYVNRDGSMPLNPAGDE---YKQMNGKLKAEISEGVVMEYNVTATEVLE 204

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTK-KMLSTVQQGLSGIIEQRAVLGISEKNINEER 302
            D+    ++       +  D +       + L  + + L  ++  RA +G  +  ++  +
Sbjct: 205 GDVDLRKLLENIVKHLDSNDQSEINKLYGEDLGNIDKALDNVLRIRAGVGAKQNRMDAAK 264

Query: 303 VFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
              +  N  +   +S    V+    + + + L      S   + K+ + ++++YL
Sbjct: 265 EMNKETNINMTEILSNIEDVDYAEKNMEFAVLQAVYISSLQTSAKVLQPTLMDYL 319


>gi|189339498|gb|ABD33775.2| flagellin [Bacillus thuringiensis serovar yosoo]
          Length = 401

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 33/359 (9%), Positives = 101/359 (28%), Gaps = 11/359 (3%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              I+T+    R     ++         + + +G+  +      A +         ++ +
Sbjct: 33  IMRINTNINSLRTQEYMRQNQSKMSNSMDRLSSGKRINNASDDAAGLAIATRMRARESGL 92

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
               ++       + T+ + ++S+  I+  M         G   ++          +  +
Sbjct: 93  NVAANNTQDGMSLIRTADSAMNSVSNILLRMRDIANQSANGTNTDSNKSALQKEFDELQK 152

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKK-----------SFDQMLQGFLE 171
                A+ T          +S  K      +                    D++  G + 
Sbjct: 153 QITYIADNTQFNDKNLLKEDSEVKIQTLDSSSSEQQIGINLKAVTLEKLGIDKISIGAVA 212

Query: 172 ENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEG 231
                       +      + + D  K  +D        A N    S    + +  +   
Sbjct: 213 GAGAGAGTKIEQKDIDAVTKGIADLTKDSKDADVTAIKDALNNIKGSMDATQVKGIEDAL 272

Query: 232 IDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVL 291
                         +  +       +    TD A      + +  + + L+ + + RA L
Sbjct: 273 KGFKTGAADDTAAGVDDIKDALKAAVLPKATDAAEKDNALEAVKAIDKALTTVADNRATL 332

Query: 292 GISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
           G +   ++     L++++  + +  S+    +     ++++      E    + ++  +
Sbjct: 333 GATLNRLDFNVDNLKSQSASMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQ 391


>gi|148380697|ref|YP_001255238.1| flagellar hook-associated protein 3 [Clostridium botulinum A str.
           ATCC 3502]
 gi|153933227|ref|YP_001384981.1| flagellar hook-associated protein 3 [Clostridium botulinum A str.
           ATCC 19397]
 gi|153936218|ref|YP_001388451.1| flagellar hook-associated protein 3 [Clostridium botulinum A str.
           Hall]
 gi|226950151|ref|YP_002805242.1| flagellar hook-associated protein 3 [Clostridium botulinum A2 str.
           Kyoto]
 gi|148290181|emb|CAL84300.1| flagellar hook-associated protein 3 [Clostridium botulinum A str.
           ATCC 3502]
 gi|152929271|gb|ABS34771.1| flagellar hook-associated protein 3 [Clostridium botulinum A str.
           ATCC 19397]
 gi|152932132|gb|ABS37631.1| flagellar hook-associated protein 3 [Clostridium botulinum A str.
           Hall]
 gi|226840871|gb|ACO83537.1| flagellar hook-associated protein 3 [Clostridium botulinum A2 str.
           Kyoto]
          Length = 320

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 42/355 (11%), Positives = 104/355 (29%), Gaps = 37/355 (10%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+   +            ++  +++++  +G++        A V   ++     +   
Sbjct: 1   MRITNKMMANSFMTDMNNNLENLNRINQQSSSGKNFSKPSHDPAGVIRSMQLHTGIDANK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + S V   L  +   L  + K +  +   L           +       +     S
Sbjct: 61  QYNKNISNVINWLDVTDTALDQIGKQLGKIRDKLEEAGNAGYGETERKALKDEVNGIIAS 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N   +G+Y+FSG   + KP                                   +
Sbjct: 121 MSQTLNTNFDGKYVFSGTRVTGKP---------------------------------TGI 147

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           +          D+I +      D            +  +K  I +   ++ +        
Sbjct: 148 QKDGTTKNNSIDYINKDGSMPLDPAGDE---YKQMNGKLKAEISEGVVMEYNVTAMEVLQ 204

Query: 244 RDIMFVAVIGTEFLSKNLTDG-ARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEER 302
            D+    ++       +  D    N L  + L  + + L  ++  RA +G  +  +   +
Sbjct: 205 GDVDLRKLLENIVNHLDSDDPKEINKLYGEDLGNIDKALDNVLRIRAEVGAKQNRMEAAK 264

Query: 303 VFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
              +  N  +   +S    V     H + + L      S   + K+ + ++++YL
Sbjct: 265 EMNKETNFNMTEILSNIEDVNYAEKHMEFAVLQAVYISSLQTSAKILQPTLMDYL 319


>gi|153938132|ref|YP_001392017.1| flagellar hook-associated protein 3 [Clostridium botulinum F str.
           Langeland]
 gi|152934028|gb|ABS39526.1| flagellar hook-associated protein 3 [Clostridium botulinum F str.
           Langeland]
 gi|295320032|gb|ADG00410.1| flagellar hook-associated protein 3 [Clostridium botulinum F str.
           230613]
          Length = 320

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 38/355 (10%), Positives = 107/355 (30%), Gaps = 37/355 (10%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+   +            ++  ++++++ +G++        A V   ++     +   
Sbjct: 1   MRITNKMMANSFMTDMNNNLENLNRINQQLTSGKNFSKPSHDPAGVIRSMQLYTGIDANK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + S V   L  +   L  + K +  +   L           +       +     S
Sbjct: 61  QYNKNISNVINWLDVTDTALDQIGKQLGKIRDKLEEAGNPGFGETERKALKDEVNGIIAS 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N T +G+Y+FSG   + KP                                   +
Sbjct: 121 MSQTLNTTFDGKYIFSGTRVTGKP---------------------------------TGI 147

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           +          D++ +      +            +  +K  I +   ++ +        
Sbjct: 148 QKDGTTKNNSIDYVNRDGSMPLNPAGDE---YKQMNGKLKAEISEGVVMEYNVTATEVLE 204

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTK-KMLSTVQQGLSGIIEQRAVLGISEKNINEER 302
            D+    ++       +  D +       + L  + + L  ++  RA +G  +  ++  +
Sbjct: 205 GDVDLRKLLENIVKHLDSNDQSEINKLYGEDLGNIDKALDNVLRIRAGVGAKQNRMDAAK 264

Query: 303 VFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
              +  N  +   +S    V+    + + + L      S   + K+ + ++++YL
Sbjct: 265 EMNKETNINMTEILSNIEDVDYAEKNMEFAVLQAVYISSLQTSAKVLQPTLMDYL 319


>gi|153834130|ref|ZP_01986797.1| polar flagellin [Vibrio harveyi HY01]
 gi|153834460|ref|ZP_01987127.1| polar flagellin [Vibrio harveyi HY01]
 gi|148869156|gb|EDL68188.1| polar flagellin [Vibrio harveyi HY01]
 gi|148869500|gb|EDL68498.1| polar flagellin [Vibrio harveyi HY01]
          Length = 377

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 39/367 (10%), Positives = 93/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +              +   M          S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYGTQSFQIGADNGEAVMLNLKDMRSDNQMMGGVSYQAEN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +    +   D    L D F  ++    +     D        + +   V A+V+  
Sbjct: 181 GKDKNWNVEEGKNDLKISLTDSFGQEQEINISAKAGDDIEELATYINGQTDLVKASVDQD 240

Query: 242 GIRDIMFVAV------------------IGTEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +                            ++ +  D       ++ ++ +   L  
Sbjct: 241 GKLQVFAGNNKVEGDVEFSGGLSGELGLSDGNNVTVDTIDVTSVGGAQESVAIIDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +      Q++      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTQMTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|22126348|ref|NP_669771.1| flagellin [Yersinia pestis KIM 10]
 gi|51596049|ref|YP_070240.1| flagellin [Yersinia pseudotuberculosis IP 32953]
 gi|108807214|ref|YP_651130.1| flagellin [Yersinia pestis Antiqua]
 gi|108812442|ref|YP_648209.1| flagellin [Yersinia pestis Nepal516]
 gi|145598572|ref|YP_001162648.1| flagellin [Yersinia pestis Pestoides F]
 gi|149366212|ref|ZP_01888247.1| thermoregulated motility protein [Yersinia pestis CA88-4125]
 gi|153950689|ref|YP_001401250.1| flagellin [Yersinia pseudotuberculosis IP 31758]
 gi|165925882|ref|ZP_02221714.1| flagellin [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165938669|ref|ZP_02227224.1| flagellin [Yersinia pestis biovar Orientalis str. IP275]
 gi|166010788|ref|ZP_02231686.1| flagellin [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166211003|ref|ZP_02237038.1| flagellin [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167401185|ref|ZP_02306688.1| flagellin [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167420335|ref|ZP_02312088.1| flagellin [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167425762|ref|ZP_02317515.1| flagellin [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|170024606|ref|YP_001721111.1| flagellin [Yersinia pseudotuberculosis YPIII]
 gi|186895154|ref|YP_001872266.1| flagellin [Yersinia pseudotuberculosis PB1/+]
 gi|218928961|ref|YP_002346836.1| flagellin [Yersinia pestis CO92]
 gi|229897225|ref|ZP_04512381.1| thermoregulated motility protein [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229897952|ref|ZP_04513103.1| thermoregulated motility protein [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229902817|ref|ZP_04517934.1| thermoregulated motility protein [Yersinia pestis Nepal516]
 gi|270486605|ref|ZP_06203679.1| bacterial flagellin N-terminal domain protein [Yersinia pestis KIM
           D27]
 gi|294503995|ref|YP_003568057.1| flagellin [Yersinia pestis Z176003]
 gi|21959331|gb|AAM86022.1|AE013850_4 putative flagellin [Yersinia pestis KIM 10]
 gi|51589331|emb|CAH20953.1| thermoregulated motility protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108776090|gb|ABG18609.1| thermoregulated motility protein [Yersinia pestis Nepal516]
 gi|108779127|gb|ABG13185.1| thermoregulated motility protein [Yersinia pestis Antiqua]
 gi|115347572|emb|CAL20482.1| thermoregulated motility protein [Yersinia pestis CO92]
 gi|145210268|gb|ABP39675.1| thermoregulated motility protein [Yersinia pestis Pestoides F]
 gi|149292625|gb|EDM42699.1| thermoregulated motility protein [Yersinia pestis CA88-4125]
 gi|152962184|gb|ABS49645.1| flagellin [Yersinia pseudotuberculosis IP 31758]
 gi|165913283|gb|EDR31905.1| flagellin [Yersinia pestis biovar Orientalis str. IP275]
 gi|165922086|gb|EDR39263.1| flagellin [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165990132|gb|EDR42433.1| flagellin [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166208183|gb|EDR52663.1| flagellin [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166962030|gb|EDR58051.1| flagellin [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167049574|gb|EDR60982.1| flagellin [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167055161|gb|EDR64958.1| flagellin [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|169751140|gb|ACA68658.1| flagellin domain protein [Yersinia pseudotuberculosis YPIII]
 gi|186698180|gb|ACC88809.1| flagellin domain protein [Yersinia pseudotuberculosis PB1/+]
 gi|229680264|gb|EEO76363.1| thermoregulated motility protein [Yersinia pestis Nepal516]
 gi|229688993|gb|EEO81058.1| thermoregulated motility protein [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229693562|gb|EEO83611.1| thermoregulated motility protein [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|262361820|gb|ACY58541.1| flagellin [Yersinia pestis D106004]
 gi|262366044|gb|ACY62601.1| flagellin [Yersinia pestis D182038]
 gi|270335109|gb|EFA45886.1| bacterial flagellin N-terminal domain protein [Yersinia pestis KIM
           D27]
 gi|294354454|gb|ADE64795.1| flagellin [Yersinia pestis Z176003]
 gi|320015419|gb|ADV98990.1| thermoregulated motility protein [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 369

 Score =  150 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 38/369 (10%), Positives = 94/369 (25%), Gaps = 16/369 (4%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              I+T+S+         +         E + +G   +      A       +      +
Sbjct: 1   MAVINTNSLSLLTQNNLNKSQSSLGTAIERLSSGLRINSAKDDAAGQAIANRFTSNIKGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
            +   + +       T++  L+ +   +Q +    V    G   ++        +     
Sbjct: 61  TQAARNANDGISIAQTTEGSLNEINNNLQRVRELTVQAQNGSNSSSDLDSIQDEISLRLA 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                ++ T          N++     G    +++         +     +         
Sbjct: 121 EIDRVSDQTQFNGKKVLAENTTMSIQVGANDGETIDINLQKIDSKSLGLGSYSVSGVSGA 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
           L   +  +         L+                 D        D   I  +     +G
Sbjct: 181 LTSLTDTSVTGVTTTTALDFSDISTFAKGATVHGIGDVGTDGAYADGYVIRTTDGKQYKG 240

Query: 243 IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLS-----------TVQQGLSGIIEQRAVL 291
             D     V   +  + +  D A  +      S           T+   +  +   R+ L
Sbjct: 241 EVDATNGKVTFADDANGDPIDDATKLEAAAQFSPAGKATASPLETLDDAIKQVDGLRSSL 300

Query: 292 GISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK- 350
           G  +         L N    + +  S+    +  T  + +S      +    + ++  + 
Sbjct: 301 GAVQNRFESAVTNLNNTVTNLTSARSRIEDADYATEVSNMSRAQILQQAGTSVLSQANQV 360

Query: 351 ----LSILN 355
               LS+LN
Sbjct: 361 PQTVLSLLN 369


>gi|119715013|ref|YP_921978.1| flagellin domain-containing protein [Nocardioides sp. JS614]
 gi|119535674|gb|ABL80291.1| flagellin domain protein [Nocardioides sp. JS614]
          Length = 376

 Score =  150 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 34/366 (9%), Positives = 80/366 (21%), Gaps = 17/366 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  I+ +                  K  E++ +G   +      A +        +   
Sbjct: 1   MSLRINQNIDALNSYRNLSVTQGQMSKSLEKLSSGYRINRAADDAAGLAISEGLRSQVGG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           I   + +       + T++  L+    I+Q M    V       D +             
Sbjct: 61  IKVAVRNAQDGVSVVQTAEGALTETHSILQRMRDLSVQAANDSNDVSSRAAIQSENDALV 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSK------ 175
           +     A  T          N   K     +   +    + D    G     S       
Sbjct: 121 DELDRIATSTTFNNVSLLDGNYIGKNFQVGYGTGATDSIAVDITSTGTGGAKSTWANGAA 180

Query: 176 -----------SLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKY 224
                      + +A     + +             +  F  +   + +         K 
Sbjct: 181 STTAAAATFTHNGVATTTGVLVASTDANNIATQLNADANFKTNYTASVDDKGGLVVTSKD 240

Query: 225 RIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGI 284
            +     +  +              A   +  L             K   + +   + G+
Sbjct: 241 GLPGAITVSGAGLAGAHVDAAPGANAGFSSTDLGVGALVLDSAANAKAATNAIDTAIKGV 300

Query: 285 IEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMI 344
              RA LG  +         L      +    S+    +      Q +      +    +
Sbjct: 301 STARAKLGAMQNRFEHTINNLSVTQENLSASESRIRDTDMAAEMMQFTRSQILSQAGTAM 360

Query: 345 TTKLQK 350
             +  +
Sbjct: 361 LAQANQ 366


>gi|323495370|ref|ZP_08100447.1| flagellar hook-associated protein FlgL [Vibrio brasiliensis LMG
           20546]
 gi|323310293|gb|EGA63480.1| flagellar hook-associated protein FlgL [Vibrio brasiliensis LMG
           20546]
          Length = 397

 Score =  150 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 31/397 (7%), Positives = 104/397 (26%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +           ++ +G+              I    Q+K  
Sbjct: 1   MMNRISSFHNYQSVQNDLRRSEAKVHHNQAQLASGKKLMKASDDPLATHYIQNIGQQKEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +L   RL   +  +S+ ++   +    ++ ++ G             + +  
Sbjct: 61  LRQFTDAITLTRNRLEHHEVIISNAEEFADEAKRTVMEMINGALSPEDRLAKRREIEEIS 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+   N+ DE           +           +     D   +  +  + +  +   
Sbjct: 121 NNFLNLVNVQDESGNYIFAGTKPKNQPFFRDRNGDVVYAGDDYQRKMKISNSLEMPINDP 180

Query: 182 HLEVSSMNAQQMTDFIK--------------QLEDKFSDDEYWANNWSNASDHNIKYRIK 227
             ++         DF                 +     D   +   + +  +    Y+++
Sbjct: 181 GSKLFMEIDNPFGDFEPKYNLKDASELLLERAINIDPDDQSSYKVTFVDMPEGKYGYQLE 240

Query: 228 DTEGIDVSANVNMRGIRDI---------------------------MFVAVIGTEFLSKN 260
               +  +   +                                          E    +
Sbjct: 241 RDGSVVKADTFDPAEGIQYEGVRIQVKGQITKGDEIELEPRRTFSVFETFQDAMELSRGS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      ++          + + R  +G     ++ +     +    +    S   
Sbjct: 301 VSDSSNTAQLHQITQEFHAAFIHLNKARTDVGARLNTLDIQEEQHDDFKMTLAKSKSNFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + +     ++ S     K + L++ NY+
Sbjct: 361 DLDYAEAIIEFNENSRALQASQQAFGKTKDLTLFNYI 397


>gi|262404531|ref|ZP_06081086.1| flagellin protein FlaD [Vibrio sp. RC586]
 gi|262349563|gb|EEY98701.1| flagellin protein FlaD [Vibrio sp. RC586]
          Length = 377

 Score =  150 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 91/367 (24%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLTSATNAQQSSMERLSSGYKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  +     I+Q M    +    G             +    
Sbjct: 61  LGVAVRNANDGISMAQTAEGAMKETTNILQRMRDLSLQSSNGSNSKADRIAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         + K              +   M    +    K+  A  
Sbjct: 121 DELNRVAETTSFGGNKLLNGTFATKSFQIGADNGEAVMLNIKDMRSDNVLMGGKTYQAAN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +        D    L+DK   D   + N     D        + +   V A+V+  
Sbjct: 181 GKDKNWGVEAGKNDLTITLKDKREGDVTISINAKEGDDIEELATYINGQTDMVKASVSEE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +           +   +                  D       ++ ++ V   L  
Sbjct: 241 GKLQLFTDNNKVDGAATFGGSLAGELGIGAAKDVTVDTLDVTTVGGAQESVAIVDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAINNLDNINENVNASKSRIKDTDFAKETTALTKAQILSQASSS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|59712472|ref|YP_205248.1| flagellin [Vibrio fischeri ES114]
 gi|46394805|gb|AAS91570.1| flagellin subunit B [Vibrio fischeri ES114]
 gi|59480573|gb|AAW86360.1| Flagellin FlaB [Vibrio fischeri ES114]
          Length = 377

 Score =  150 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 32/367 (8%), Positives = 97/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  ++T+           +  +   +  E + +G+  +      A +      + + + 
Sbjct: 1   MSVTVNTNVSAMTAQRYLNQATEHLNQSMERLSSGKRINSAKDDAAGLQISNRLKSQMSG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G                  
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNESTNILQRMRDLALQSSNGSNTLQDRQAIQEEADALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G                        + +   M    L        +  
Sbjct: 121 DELNRIAETTSFGGRRLLNGQFGTSTFQIGANAGEAVQLTLGSMRSDTLAMGGFHYTSQN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            L       +          DK    +          D        + +   V A+V+  
Sbjct: 181 QLNKGWTVPEGGQTLTMSFNDKNGKAQEITIEAKAGDDIEELATYINGQNDTVQASVDEN 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +     + +  ++   +                  D      +++ ++T+   +  
Sbjct: 241 GQLQLFTAGDLVSSAVTFGGSLSAELAIGGAVFDTVNDLDLTSVGGSQRAIATLDAAMGF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           + ++RA LG  +   +     L N +  +    S+    +      ++       ++S  
Sbjct: 301 VDKERATLGAFQNRFDHAINNLNNIHENVAASNSRIEDTDFAKETVEMMKAQILQQVSST 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|28897560|ref|NP_797165.1| flagellar hook-associated protein FlgL [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|260364618|ref|ZP_05777220.1| flagellar hook-associated protein 3 [Vibrio parahaemolyticus K5030]
 gi|260878277|ref|ZP_05890632.1| flagellar hook-associated protein 3 [Vibrio parahaemolyticus
           AN-5034]
 gi|260898107|ref|ZP_05906603.1| flagellar hook-associated protein 3 [Vibrio parahaemolyticus
           Peru-466]
 gi|260901961|ref|ZP_05910356.1| flagellar hook-associated protein 3 [Vibrio parahaemolyticus
           AQ4037]
 gi|551518|gb|AAD10270.1| hook-associated protein type 3 [Vibrio parahaemolyticus]
 gi|28805772|dbj|BAC59049.1| hook-associated protein type 3 FlgL [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308086120|gb|EFO35815.1| flagellar hook-associated protein 3 [Vibrio parahaemolyticus
           Peru-466]
 gi|308090194|gb|EFO39889.1| flagellar hook-associated protein 3 [Vibrio parahaemolyticus
           AN-5034]
 gi|308106762|gb|EFO44302.1| flagellar hook-associated protein 3 [Vibrio parahaemolyticus
           AQ4037]
 gi|308115100|gb|EFO52640.1| flagellar hook-associated protein 3 [Vibrio parahaemolyticus K5030]
          Length = 397

 Score =  150 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 40/397 (10%), Positives = 110/397 (27%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             T IS+   ++ +    +          E++ +G+              I    Q++  
Sbjct: 1   MLTRISSFHNYQSVQNDLRRQENKIHHNQEQLASGKKLLKPSDDPLAAHYIQNIGQQQEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L S  LV  RL   + ++++ +    +     + ++ G             L +  
Sbjct: 61  LKQYLSSIVLVRNRLENHEVNIANAESFADESKRLTMEMINGAFSAEDRQAKKRELEEIA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+   N  DE           +          S+     D   +  +       +   
Sbjct: 121 NNFLNLVNAQDESGNYVFAGTKPKSQPFYRDKDGSVQYAGDDYQRKMKVSSMLDMPMNDP 180

Query: 182 HLEVSSMNAQQMTDF--------------IKQLEDKFSDDEYWANNWSNASDHNIKYRIK 227
             ++         D+               K       D   +   + + ++    Y+++
Sbjct: 181 GSKLFMEIPNPFGDYQPSYDLQSGSDLLLSKATNVDAKDTASYRVTFVDMNNGKFGYQLE 240

Query: 228 DTEGIDVSANVNMRGIRDI---------------------------MFVAVIGTEFLSKN 260
               +  +   +     +                                     +  K+
Sbjct: 241 RNGKVVDADEFSPEKGIEYKGLKVHVKGQITPGDSIGIEKRESFSIFDTFKEAMSWSDKS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      +M    Q     + + R  +G     ++ +    ++ N  +    S   
Sbjct: 301 VSDTSATAKLHQMTEEFQAAFIHLNKARTDVGARLSTLDIQEQNHEDFNLSLAKAKSNFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + S     ++ S     K + L++ NY+
Sbjct: 361 DLDYSKAVIEFSENSRALQASQQAFGKTKDLTLFNYI 397


>gi|268589947|ref|ZP_06124168.1| flagellin 2 [Providencia rettgeri DSM 1131]
 gi|291314663|gb|EFE55116.1| flagellin 2 [Providencia rettgeri DSM 1131]
          Length = 370

 Score =  150 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 39/360 (10%), Positives = 92/360 (25%), Gaps = 11/360 (3%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+ +                   E + +G   +      A       +      
Sbjct: 1   MAQVINTNILSLTTQNNLNRSQGVLGSAIERLSSGSRINSAKDDAAGQAIANRFTSNVKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q +    V    G   N+        + +  
Sbjct: 61  LTQASRNANDGISIAQTTEGALNEINDNLQRIRELTVQAKNGTNSNSDLTSIQNEVTERL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 +  T            ++  +      + + K   D++    LE  S  L    
Sbjct: 121 AEIDRISKETQFNGVKVLSGEKTDMSIQVGTNDNEVIKFKLDKVDTTELEVTSDKLFTET 180

Query: 182 HL----EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSAN 237
                   +        D        +           +      KY   +     +  +
Sbjct: 181 TTKKGVTAAGSANIDAKDVGVAGGTTYKTGLTVKEYTEDGKAVPGKYVATEGGKSYLVTD 240

Query: 238 VNMRGIRDIMF-------VAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAV 290
            +                VAV   EF +    D     +    L+T+   ++ + E R+ 
Sbjct: 241 ADFEADGTTATQVNLKTGVAVTAREFTASAGKDVKSLDVKDDALATLDNAINKVDESRSR 300

Query: 291 LGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
           LG  +         L N  N +    S+    +  T  + +S      +    +  +  +
Sbjct: 301 LGAIQNRFQSTINNLNNSVNNLSAARSRIQDADFATEVSNMSRGQILQQAGTAVLAQANQ 360


>gi|304310892|ref|YP_003810490.1| Flagellin [gamma proteobacterium HdN1]
 gi|301796625|emb|CBL44837.1| Flagellin [gamma proteobacterium HdN1]
          Length = 412

 Score =  150 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 40/412 (9%), Positives = 90/412 (21%), Gaps = 58/412 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IS +  F +      +          ++  G             +  L   Q+ N   
Sbjct: 1   MRISNNQSFSQGVNSMLDQYSSVSYTQLQISEGTRILKPSDDPVGTSIALNLRQQVNAAE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   ++      L + +A L+S+  I+  +   LV    G  +       A  ++   + 
Sbjct: 61  QYAKNSGSAASMLKSEEASLTSVNDILGRIRDLLVTAGNGILNYEDRKTIATEMQGRLDE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V+ AN              +           +         L   +  +          
Sbjct: 121 LVSVANTQSADGKYIFSGARTNTMPITRDAGGNYVYGGDQTNLTVQVNSSVVVKGTDNGS 180

Query: 184 EVSSMNAQQMTDFIK------------------------------QLEDKFSDDEYWANN 213
           E+          F                                 +         ++ +
Sbjct: 181 ELFMEVPTGNGAFETRQNPLNNGSGVIGPASVYDVAQYLPDTYTVDVFVDGGGVTRYSIS 240

Query: 214 WSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGA-------- 265
            S                     N        +            K     +        
Sbjct: 241 DSAGGQVVPAPPAVIATDSPEFVNGADIQFNGVRVAIAGQPVAGDKFTIQPSLKKSVFQT 300

Query: 266 --------------------RNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFL 305
                                     + L  V Q +S     R+ LG     +  E    
Sbjct: 301 VADAIRDLQLANSSDAMLAHYKNNVGRALQNVDQAISHTDSFRSQLGTRVNVVESEADIN 360

Query: 306 QNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +N        +S    ++   A  +++     ++ +     K+Q L+I  ++
Sbjct: 361 ENLVVQAKGALSLVEDLDYAEAITRMNRQSVALQAAQQSFVKIQSLNIFQFI 412


>gi|551512|gb|AAC27800.1| polar flagellin [Vibrio parahaemolyticus]
          Length = 378

 Score =  150 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 43/368 (11%), Positives = 91/368 (24%), Gaps = 19/368 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K                  M          S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTHGAKSFQIGADNGEAVMLELKDMRSDNKMMGGVSYQAES 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   AQ   D    L D F  ++    N     D        + +   V A+V+  
Sbjct: 181 GKGKDWNVAQGKNDLKISLTDSFGQEQEININAKAGDDIEELATYINGQTDLVKASVDQD 240

Query: 242 GIRDIMFVAV-------------------IGTEFLSKNLTDGARNVLTKKMLSTVQQGLS 282
           G   I                           + ++ +  D       ++ ++ +   L 
Sbjct: 241 GKLQIFAGNNKVEGEVSFSGGLSGELGLGDVKKNVTVDTIDVTSVGGAQESVAIIDAALK 300

Query: 283 GIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSY 342
            +   RA LG  +   N     L N N  ++   S+    +       ++      + S 
Sbjct: 301 YVDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTAMTKSQILSQASS 360

Query: 343 MITTKLQK 350
            I  + ++
Sbjct: 361 SILAQAKQ 368


>gi|163802595|ref|ZP_02196487.1| flagellin [Vibrio sp. AND4]
 gi|159173678|gb|EDP58497.1| flagellin [Vibrio sp. AND4]
          Length = 384

 Score =  150 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 40/375 (10%), Positives = 97/375 (25%), Gaps = 25/375 (6%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+           + + +     E + +G   +      A +        +   
Sbjct: 1   MAVTVSTNVSAMTAQRYLNKASNELNTSMERLSSGHKINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    ++Q M    +    G    ++            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNEATSVMQRMRDLAIQSSNGTNSPSERQAINEESTALI 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +       +   +          +  +  
Sbjct: 121 DELNRIAETTSFGGRRLLNGSFGEAAFQIGSSSGEAMIMALTSIRADDQRMGGVTFFSEN 180

Query: 182 HLEVSSMNAQQMTD------FIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVS 235
             +          D       + + ED   DD     N  +  D        + +   ++
Sbjct: 181 GKDKDWGVDPTKADLKITLPGMGEDEDGNPDDLEININAKSGDDIEELATYINGQSDMIN 240

Query: 236 ANVNMRGIRDIMFVAVIGTEF-------------------LSKNLTDGARNVLTKKMLST 276
           A+V+  G   I                              S    D      ++  +S 
Sbjct: 241 ASVSEDGKLQIFVEHPNVQGDISISGGLASDLGLSDEAVRTSVQDIDMTTVQGSQNAISV 300

Query: 277 VQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLIN 336
           +   L  +  QRA LG  +  ++     L N    +D   S+    +      Q++    
Sbjct: 301 LDSALKYVDSQRADLGAKQNRLSHSINNLANIQENVDASNSRIKDTDFAKETTQMTKAQI 360

Query: 337 KIEMSYMITTKLQKL 351
             +    I  + ++L
Sbjct: 361 LQQAGTSILAQAKQL 375


>gi|172087731|ref|YP_205245.3| flagellin [Vibrio fischeri ES114]
 gi|59480570|gb|AAW86357.1| Flagellin FlaE [Vibrio fischeri ES114]
          Length = 398

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 37/369 (10%), Positives = 98/369 (26%), Gaps = 21/369 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  ++T+                  +  E + +G   +      A +        +   
Sbjct: 21  MSITVNTNVSAMTAQRYLNSATDGVNQSMERLSSGSKINSAKDDAAGLQISNRLNTQTRG 80

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  +     I+  +    +    G   +         +    
Sbjct: 81  LDVAVRNANDGISMMQTAEGAMKETSNILSRVRDLALQSSNGSNTDADRQAIQQEVTALS 140

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       N   K              + + +         K+  A +
Sbjct: 141 DEMNRIAETTSFGGTRLLNGNFGTKSFQVGADSGEAVMLTLNNLRADEANMGGKTFTASE 200

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            +       +     I  + DK  +++    N     D        + +   VSA+V   
Sbjct: 201 GVAAGWTAGKDANMTIT-IADKNGEEQAIEINAKAGDDIEEVATYINGQTDKVSASVGED 259

Query: 242 G--------------------IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
           G                    +     +A       +    D      ++  ++ V   +
Sbjct: 260 GKLQVFAAKDVAEGEISFSGALAKETGMADAEVANKTVGNIDVTTVAGSQNAVAVVDAAM 319

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +   R+ LG ++  +      L N N  +    S+   V+      +++      + S
Sbjct: 320 KFVDSHRSELGAAQNRMGHTISNLDNINENVSASKSQIKDVDFAKETTEMTKSQILQQAS 379

Query: 342 YMITTKLQK 350
             I  + ++
Sbjct: 380 SSILAQAKQ 388


>gi|148976404|ref|ZP_01813110.1| flagellin [Vibrionales bacterium SWAT-3]
 gi|145964227|gb|EDK29483.1| flagellin [Vibrionales bacterium SWAT-3]
          Length = 376

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 45/367 (12%), Positives = 101/367 (27%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+              + + K  E + +G   +      A +        +   
Sbjct: 1   MAINVSTNVSAMTAQRYLNNAAEGTQKSMERLSSGYKINSAKDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDMAVKNANDGISIAQTAEGAMNESTNILQRMRDLSLQSANGSNSKSERVAIQEEVSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 A  T  G           +              S   M     E   KS    +
Sbjct: 121 TELNRIAETTSFGGNKLLNGTYGSQSFQIGADSGEAVMLSMGNMRTDTQEMGGKSYGVTE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S        D   +  DKF + +  + +    +D        + +  DV A+V   
Sbjct: 181 GKDASWRVGAGA-DLTIKYNDKFGEAQELSISAKEGNDIEELATYINGQSQDVKASVGEG 239

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +   +                      + ++ N  D        + +S +   L  
Sbjct: 240 GKLQLFASSQKVEGDVEFGGSLASELGIGAGKDVTVNDIDVTSVAGANEAVSIIDGALKS 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +   +     L+N N  ++   S+    +       ++      + S  
Sbjct: 300 VDSQRASLGAFQNRFDHAISNLENINENVNASKSRIKDTDYAKETTAMTKSQILQQASTS 359

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 360 ILAQAKQ 366


>gi|328473446|gb|EGF44294.1| flagellar hook-associated protein FlgL [Vibrio parahaemolyticus
           10329]
          Length = 397

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 40/397 (10%), Positives = 110/397 (27%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             T IS+   ++ +    +          E++ +G+              I    Q++  
Sbjct: 1   MLTRISSFHNYQSVQNDLRRQENKIHHNQEQLASGKKLLKPSDDPLAAHYIQNIGQQQEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L S  LV  RL   + ++++ +    +     + ++ G             L +  
Sbjct: 61  LKQYLSSIVLVRNRLENHEVNIANAESFADESKRLTMEMINGAFSAEDRQAKKRELEEIA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+   N  DE           +          S+     D   +  +       +   
Sbjct: 121 NNFLNLVNAQDESGNYVFAGTKPKSQPFYRDKDGSVQYAGDDYQRKMKVSSMLDMPMNDP 180

Query: 182 HLEVSSMNAQQMTDF--------------IKQLEDKFSDDEYWANNWSNASDHNIKYRIK 227
             ++         D+               K       D   +   + + ++    Y+++
Sbjct: 181 GSKLFMEIPNPFGDYQPNYDLQSGSDLLLSKATNVDAKDTASYRVTFVDMNNGKFGYQLE 240

Query: 228 DTEGIDVSANVNMRGIRDI---------------------------MFVAVIGTEFLSKN 260
               +  +   +     +                                     +  K+
Sbjct: 241 RNGKVVDADEFSPEKGIEYKGLKVHVKGQITPGDSIDIEKRESFSIFDTFKEAMSWSDKS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      +M    Q     + + R  +G     ++ +    ++ N  +    S   
Sbjct: 301 VSDTSATAKLHQMTEEFQAAFIHLNKARTDVGARLSTLDIQEQNHEDFNLSLAKAKSNFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + S     ++ S     K + L++ NY+
Sbjct: 361 DLDYSKAVIEFSENSRALQASQQAFGKTKDLTLFNYI 397


>gi|28897564|ref|NP_797169.1| flagellin [Vibrio parahaemolyticus RIMD 2210633]
 gi|28899033|ref|NP_798638.1| flagellin [Vibrio parahaemolyticus RIMD 2210633]
 gi|260364621|ref|ZP_05777223.1| A-type flagellin [Vibrio parahaemolyticus K5030]
 gi|260365221|ref|ZP_05777778.1| A-type flagellin [Vibrio parahaemolyticus K5030]
 gi|260878274|ref|ZP_05890629.1| A-type flagellin [Vibrio parahaemolyticus AN-5034]
 gi|260897366|ref|ZP_05905862.1| A-type flagellin [Vibrio parahaemolyticus Peru-466]
 gi|260898104|ref|ZP_05906600.1| A-type flagellin [Vibrio parahaemolyticus Peru-466]
 gi|260899924|ref|ZP_05908319.1| A-type flagellin [Vibrio parahaemolyticus AQ4037]
 gi|29840859|sp|Q56702|FLAB_VIBPA RecName: Full=Polar flagellin B/D
 gi|28805776|dbj|BAC59053.1| polar flagellin FlaD [Vibrio parahaemolyticus RIMD 2210633]
 gi|28807252|dbj|BAC60522.1| polar flagellin D [Vibrio parahaemolyticus RIMD 2210633]
 gi|308086133|gb|EFO35828.1| A-type flagellin [Vibrio parahaemolyticus Peru-466]
 gi|308088260|gb|EFO37955.1| A-type flagellin [Vibrio parahaemolyticus Peru-466]
 gi|308090113|gb|EFO39808.1| A-type flagellin [Vibrio parahaemolyticus AN-5034]
 gi|308107325|gb|EFO44865.1| A-type flagellin [Vibrio parahaemolyticus AQ4037]
 gi|308115096|gb|EFO52636.1| A-type flagellin [Vibrio parahaemolyticus K5030]
 gi|308115392|gb|EFO52932.1| A-type flagellin [Vibrio parahaemolyticus K5030]
          Length = 378

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 43/368 (11%), Positives = 91/368 (24%), Gaps = 19/368 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K                  M          S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTHGAKSFQIGADNGEAVMLELKDMRSDNKMMGGVSYQAES 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   AQ   D    L D F  ++    N     D        + +   V A+V+  
Sbjct: 181 GKGKDWNVAQGKNDLKISLTDSFGQEQEININAKAGDDIEELATYINGQTDLVKASVDQD 240

Query: 242 GIRDIMFVAV-------------------IGTEFLSKNLTDGARNVLTKKMLSTVQQGLS 282
           G   I                           + ++ +  D       ++ ++ +   L 
Sbjct: 241 GKLQIFAGNNKVEGEVSFSGGLSGELGLGDDKKNVTVDTIDVTSVGGAQESVAIIDAALK 300

Query: 283 GIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSY 342
            +   RA LG  +   N     L N N  ++   S+    +       ++      + S 
Sbjct: 301 YVDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTAMTKSQILSQASS 360

Query: 343 MITTKLQK 350
            I  + ++
Sbjct: 361 SILAQAKQ 368


>gi|187934470|ref|YP_001885010.1| flagellar hook-associated protein 3 [Clostridium botulinum B str.
           Eklund 17B]
 gi|187722623|gb|ACD23844.1| flagellar hook-associated protein 3 [Clostridium botulinum B str.
           Eklund 17B]
          Length = 402

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 48/402 (11%), Positives = 118/402 (29%), Gaps = 48/402 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+TS +         +      KLH ++ +G+          +V+  ++   E     
Sbjct: 1   MRITTSMLASNYQSNMTKNLNHMQKLHNQLSSGKEISRPSDNPYKVSRTMQMYMEIGANK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +   ++  L T+   L+ M+ +   +   LV    G    ++       +++    
Sbjct: 61  QYNENIKDISNWLDTTDTSLNQMENVFARVRELLVSAGSGAYGPDEKKAIQDEIKERVNE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N   +G Y+F G  S+ KP+      +          +          L      
Sbjct: 121 MGQILNTNFDGVYIFGGTKSTSKPVIINSNGELCYADKDGNAVSKTATGVKIDLTNPITD 180

Query: 184 EVSSM------NAQQMTDFIKQLEDKFSDDEYWANNWSNASDHN---------------- 221
             +        +   +   I         +   A + S                      
Sbjct: 181 GGTKSIKGMEKDGNNIKMIITDTNTTPPSETPIAIDLSAIGSGTPPETEESLFKKELKGQ 240

Query: 222 --------------------------IKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTE 255
                                     +   +     I+ + N       +   +     +
Sbjct: 241 GFTDSDIGRLTGMVPSFDALDQISSELNVEVSQGVLINYNKNAVDLLEGNGTNIMSTLNK 300

Query: 256 FLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTY 315
            ++     G ++V+T + L  V   +  +++ RA +G  +  +   +   +++N  +   
Sbjct: 301 IITNLDEGGDKSVITGECLGEVDDIIKNLLQHRAEVGAMQNRMESAQDKNESENLDMTDI 360

Query: 316 ISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +SK+  ++      Q S +      +     K+   +IL+YL
Sbjct: 361 LSKTEDIDFTEKTIQYSIMQTVYMAALQTGAKILPATILDYL 402


>gi|17366557|sp|Q56570|FLAE_VIBAN RecName: Full=Probable flagellin E
 gi|1272424|gb|AAB09433.1| flagellin E [Listonella anguillarum]
          Length = 377

 Score =  149 bits (376), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 97/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             ++   +  E + +G+  +      A +      E +   
Sbjct: 1   MAITVNTNVSALIAQRHLGSASEMLNQSLERLASGKRINSAKDDAAGLQISNRLESQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  +     ++Q M    +    G             +    
Sbjct: 61  LDVAVRNANDGISIMQTAEGAMQETTSLLQRMRDLSLQSANGANSKADRQALQEEMGALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  +       +     + S   M    L+    S +A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFGQSSFQIGASSGEAVQVSLKNMRSDSLDMGGFSYVAAG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +      Q          D                D        + +   VSA+VN +
Sbjct: 181 MADSQWRVTQDNRQLTMSYTDAKGKQHNIQIQAKVGDDIEELATYINGQTDKVSASVNDK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  +    +                  D       ++ ++ +   +  
Sbjct: 241 GQLQLFMAGKETSGTIDFKGSLANQLQMNVTGYEAVDTLDITEVGGAQRAVAVIDTAMQY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   R+ LG  +   N     L N +  + +  S+    +      Q+       ++S  
Sbjct: 301 VDSHRSELGALQNRFNHAINNLDNVHENLASSNSRIKDTDYAKETTQMVKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           I  + +K
Sbjct: 361 ILAQAKK 367


>gi|313755745|gb|ADR77819.1| flagellin [Salmonella enterica subsp. enterica serovar Typhi]
          Length = 347

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 35/351 (9%), Positives = 94/351 (26%), Gaps = 12/351 (3%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+         +         E + +G   +      A       +      
Sbjct: 1   MAQVINTNSLSLLTQNNLNKSQSSLGTAIERLSSGLRINSAKDDAAGQAISNRFTANIKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q++    V    G   ++        +    
Sbjct: 61  LTQASRNANDGISLAQTTEGALNEVNDNLQNIRRLTVQAQNGSNSSSDLKSIQDEITQRM 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 +  TD         +       G    +++              +       G 
Sbjct: 121 SEINRISEQTDFNGVKVLSSDQKLTIQVGANDGETIDIDLQKIDSTKLGLDGFDVTKKGP 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            L        ++ D    ++   +  + ++   +   D                A +   
Sbjct: 181 KLGAEVTGTVKVGDKDLTVDAMAAGKKLFSGKDATGKDTFYVETTDKGVKTYKEATIAED 240

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
           G                  +T+G  +V     L+T+ + LS +   R+ LG  +   +  
Sbjct: 241 GTTGKAK------------ITEGTTDVKMADPLATLDKALSQVDGLRSSLGAVQNRFDSV 288

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLS 352
              L +  N +    S+    +  T  + +S      +    +  +  + +
Sbjct: 289 INNLNSTVNNLSASQSRIQDADYATEVSNMSRANILQQAGTSVLAQANQTT 339


>gi|29570533|gb|AAO85383.1| flagellin [Yersinia pseudotuberculosis]
          Length = 369

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 38/369 (10%), Positives = 95/369 (25%), Gaps = 16/369 (4%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              I+T+S+         +         E + +G   +      A       +      +
Sbjct: 1   MAVINTNSLSLLTQNNLNKSQSSLGTAIERLSSGLRINSAKDDAAGQAIANRFTSNIKGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
            +   + +       T++  L+ +   +Q +    V   +G   ++        +     
Sbjct: 61  TQAARNANDGISIAQTTEGSLNEINNNLQRVRELTVQAQKGSNSSSDLDSIQDEISLRLA 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                ++ T          N++     G    +++         +     +         
Sbjct: 121 EIDRVSDQTQFNGKKVLAENTTMSIQVGANDGETIDINLQKIDSKSLGLGSYSVSGVSGA 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
           L   +  +         L+                 D        D   I  +     +G
Sbjct: 181 LTSLTDTSVTGVTTTTALDFSDISTFAKGATVHGIGDVGTDGAYADGYVIRTTDGKQYKG 240

Query: 243 IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLS-----------TVQQGLSGIIEQRAVL 291
             D     V   +  + +  D A  +      S           T+   +  +   R+ L
Sbjct: 241 EVDATNGKVTFADDANGDPIDDATKLEAAAQFSPAGKATASPLETLDDAIKQVDGLRSSL 300

Query: 292 GISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK- 350
           G  +         L N    + +  S+    +  T  + +S      +    + ++  + 
Sbjct: 301 GAVQNRFESAVTNLNNTVTNLTSARSRIEDADYATEVSNMSRAQILQQAGTSVLSQANQV 360

Query: 351 ----LSILN 355
               LS+LN
Sbjct: 361 PQTVLSLLN 369


>gi|153839998|ref|ZP_01992665.1| flagellar hook-associated protein 3 [Vibrio parahaemolyticus
           AQ3810]
 gi|149746458|gb|EDM57467.1| flagellar hook-associated protein 3 [Vibrio parahaemolyticus
           AQ3810]
          Length = 397

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 39/397 (9%), Positives = 109/397 (27%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             T IS+   ++ +    +          E++ +G+              I    Q++  
Sbjct: 1   MLTRISSFHNYQSVQNDLRRQENKIHHNQEQLASGKKLLKPSDDPLAAHYIQNIGQQQEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L S  LV  RL   + ++++ +    +     + ++ G             L +  
Sbjct: 61  LKQYLSSIVLVRNRLENHEVNIANAESFADESKRLTMEMINGAFSAEDRQAKKRELEEIA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            + +   N  DE           +          S+     D   +  +       +   
Sbjct: 121 NNLLNLVNAQDESGNYVFAGTKPKSQPFYRDKDGSVQYAGDDYQRKMKVSSMLDMPMNDP 180

Query: 182 HLEVSSMNAQQMTDF--------------IKQLEDKFSDDEYWANNWSNASDHNIKYRIK 227
             ++         D+               K       D   +   + + ++    Y+++
Sbjct: 181 GSKLFMEIPNPFGDYQPSYDLQSGSDLLLSKATNVDAKDTASYRVTFVDMNNGKFGYQLE 240

Query: 228 DTEGIDVSANVNMRGIRDI---------------------------MFVAVIGTEFLSKN 260
               +  +   +     +                                     +  K+
Sbjct: 241 RNGKVVDADEFSPEKGIEYKGLKVHVKGQITPGDSIGIEKRESFSIFDTFKEAMSWSDKS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      +M    Q     + + R  +G     ++ +    ++ N  +    S   
Sbjct: 301 VSDTSATAKLHQMTEEFQAAFIHLNKARTDVGARLSTLDIQEQNHEDFNLSLAKAKSNFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + S     ++ S     K + L++ NY+
Sbjct: 361 DLDYSKAVIEFSENSRALQASQQAFGKTKDLTLFNYI 397


>gi|258621058|ref|ZP_05716092.1| Flagellin C [Vibrio mimicus VM573]
 gi|258626880|ref|ZP_05721685.1| Flagellin C [Vibrio mimicus VM603]
 gi|262166273|ref|ZP_06034010.1| flagellin protein FlaD [Vibrio mimicus VM223]
 gi|262170835|ref|ZP_06038513.1| flagellin protein FlaD [Vibrio mimicus MB-451]
 gi|258580836|gb|EEW05780.1| Flagellin C [Vibrio mimicus VM603]
 gi|258586446|gb|EEW11161.1| Flagellin C [Vibrio mimicus VM573]
 gi|261891911|gb|EEY37897.1| flagellin protein FlaD [Vibrio mimicus MB-451]
 gi|262025989|gb|EEY44657.1| flagellin protein FlaD [Vibrio mimicus VM223]
          Length = 377

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 44/367 (11%), Positives = 97/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLTSATNAQQTSMERLSSGYKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LGVAVRNANDGISMAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         S K              +   M    +    K+  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFSTKSFQIGADNGEAVMLNIKDMRSDNVLMGGKTYQAAN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S       TD    L+DK   D   + N     D        + +   V A+V+  
Sbjct: 181 GKDKSWGVEAGKTDLTITLKDKREGDVTISVNAKEGDDIEELATYINGQTDMVKASVDED 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +                          + ++ +  D       ++ ++ V   L  
Sbjct: 241 GKLQLFTDNNKVDGAATFGGALAGELGIGAAQDVTVDTLDVTTVGGAQESVAIVDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAINNLDNINENVNASKSRIKDTDFAKETTALTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|218708813|ref|YP_002416434.1| flagellin [Vibrio splendidus LGP32]
 gi|218321832|emb|CAV17804.1| Polar flagellin B [Vibrio splendidus LGP32]
          Length = 407

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 37/378 (9%), Positives = 90/378 (23%), Gaps = 29/378 (7%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 20  MAVNVNTNVSAMTAQRYLNSANSAQQTSMERLSSGSKINSAKDDAAGLQISNRLNVQSRG 79

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G             +    
Sbjct: 80  LDVAVRNANDGISIAQTAEGAMNETSNILQRMRDLSLQSTNGSNTKADRVAIQEEVTALN 139

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K                  M     +    S    +
Sbjct: 140 DELNRIAETTSFGGNKLLNGTHGTKSFQIGADNGEAVMLQLKDMRSDNDQMGGNSYQFTE 199

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D    L+D F D      +     D        + +   V A+++  
Sbjct: 200 AKGKDWGVTAGANDLTMSLKDSFGDQREINISAKAGDDIEELATYINGQQDLVKASIDEE 259

Query: 242 G-----------------------------IRDIMFVAVIGTEFLSKNLTDGARNVLTKK 272
           G                                      +  + ++ +  D       ++
Sbjct: 260 GKLQIFAGNNKVDGEIAFSGALSDELGMTAGAKPEDPKTLEAKQVTVDSIDVTSVGGAQE 319

Query: 273 MLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLS 332
            ++ +   L  +   R+ LG  +   +     L N N  ++   S+    +      Q++
Sbjct: 320 SVAVIDAALKYVDSHRSELGAFQNRFDHAINNLDNINENVNASKSRIKDTDFAKETTQMT 379

Query: 333 TLINKIEMSYMITTKLQK 350
                 + S  I  + ++
Sbjct: 380 KSQILSQASSSILAQAKQ 397


>gi|119503651|ref|ZP_01625734.1| Flagellin-like protein [marine gamma proteobacterium HTCC2080]
 gi|119460713|gb|EAW41805.1| Flagellin-like protein [marine gamma proteobacterium HTCC2080]
          Length = 402

 Score =  149 bits (375), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 48/403 (11%), Positives = 105/403 (26%), Gaps = 48/403 (11%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +S++ ++        E      ++ E++ +G+              I+    E N 
Sbjct: 1   MIDRVSSNQVYRTGIGSILEAQSKLSRIQEQVASGKRIQNPSDDPGAAAEIVRLRSELNR 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLE-GKTDNNKFPINAGMLRDS 120
           +     +       LS  ++ ++  + ++Q      V     G  + +   I A  +   
Sbjct: 61  VETYQRTADQAISSLSFEESAVAGAESVLQRARELAVQGANDGALNASDREIIAAEIDGL 120

Query: 121 YESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
            +S +   N  +         +                + S    L              
Sbjct: 121 RDSLLNIGNTRNADGEYIFAGDKVNTAAFSESNGAVTYEGSGGPRLVNIASGIRLQTNDT 180

Query: 181 QHLEVSSMNAQQ----------------------------------------------MT 194
                    A                                                +T
Sbjct: 181 GATVFQGAAAGNGQFEVSATGSNTGTGVVGATGFDGTFPGTENYTITFSSVGGQLKYAIT 240

Query: 195 DFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGT 254
                      D     +     +   I+   +  +   V+A         +  ++    
Sbjct: 241 GSTSGAIGAAQDYVSGEDITFAGATVKIEGAPEAGDTFAVTAGGTQSAFDTLTELSAALR 300

Query: 255 EFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDT 314
                   D  R     + L  +   L  I + R  LG     ++E+     + N  I++
Sbjct: 301 T-QGSAAKDAQRATAVGQALQNIDASLGQINKVRTDLGARLNRVDEQISLNASFNFQIES 359

Query: 315 YISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ISK   ++  TA  +L+  +  +E +     K Q +S+ NYL
Sbjct: 360 TISKLEDLDFATAVTELNLQLVALEAAQQTYIKTQGISLFNYL 402


>gi|15642186|ref|NP_231818.1| flagellin [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121586269|ref|ZP_01676059.1| flagellin FlaC [Vibrio cholerae 2740-80]
 gi|121726543|ref|ZP_01679792.1| flagellin FlaC [Vibrio cholerae V52]
 gi|147675419|ref|YP_001217704.1| flagellin [Vibrio cholerae O395]
 gi|153817100|ref|ZP_01969767.1| flagellin FlaC [Vibrio cholerae NCTC 8457]
 gi|153820801|ref|ZP_01973468.1| flagellin FlaC [Vibrio cholerae B33]
 gi|153825320|ref|ZP_01977987.1| flagellin FlaC [Vibrio cholerae MZO-2]
 gi|153831273|ref|ZP_01983940.1| flagellin FlaC [Vibrio cholerae 623-39]
 gi|227082311|ref|YP_002810862.1| flagellin FlaC [Vibrio cholerae M66-2]
 gi|229507735|ref|ZP_04397240.1| flagellin protein FlaD [Vibrio cholerae BX 330286]
 gi|229512029|ref|ZP_04401508.1| flagellin protein FlaD [Vibrio cholerae B33]
 gi|229513832|ref|ZP_04403294.1| flagellin protein FlaD [Vibrio cholerae TMA 21]
 gi|229519165|ref|ZP_04408608.1| flagellin protein FlaD [Vibrio cholerae RC9]
 gi|229528807|ref|ZP_04418197.1| flagellin protein FlaD [Vibrio cholerae 12129(1)]
 gi|229607280|ref|YP_002877928.1| flagellin [Vibrio cholerae MJ-1236]
 gi|254225810|ref|ZP_04919415.1| flagellin FlaC [Vibrio cholerae V51]
 gi|254286542|ref|ZP_04961499.1| flagellin FlaC [Vibrio cholerae AM-19226]
 gi|254849266|ref|ZP_05238616.1| flagellin FlaC [Vibrio cholerae MO10]
 gi|255747113|ref|ZP_05421058.1| flagellin protein FlaD [Vibrio cholera CIRS 101]
 gi|262161343|ref|ZP_06030453.1| flagellin protein FlaD [Vibrio cholerae INDRE 91/1]
 gi|262167786|ref|ZP_06035488.1| flagellin protein FlaD [Vibrio cholerae RC27]
 gi|262191680|ref|ZP_06049856.1| flagellin protein FlaD [Vibrio cholerae CT 5369-93]
 gi|298500434|ref|ZP_07010239.1| flagellin FlaC [Vibrio cholerae MAK 757]
 gi|172044517|sp|P0C6C5|FLAC_VIBCH RecName: Full=Flagellin C
 gi|172047623|sp|A5F671|FLAC_VIBC3 RecName: Full=Flagellin C
 gi|2271023|gb|AAC01553.1| flagellin [Vibrio cholerae]
 gi|9656742|gb|AAF95332.1| flagellin FlaC [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121549535|gb|EAX59561.1| flagellin FlaC [Vibrio cholerae 2740-80]
 gi|121630996|gb|EAX63375.1| flagellin FlaC [Vibrio cholerae V52]
 gi|125621716|gb|EAZ50045.1| flagellin FlaC [Vibrio cholerae V51]
 gi|126512368|gb|EAZ74962.1| flagellin FlaC [Vibrio cholerae NCTC 8457]
 gi|126521593|gb|EAZ78816.1| flagellin FlaC [Vibrio cholerae B33]
 gi|146317302|gb|ABQ21841.1| flagellin FlaC [Vibrio cholerae O395]
 gi|148873246|gb|EDL71381.1| flagellin FlaC [Vibrio cholerae 623-39]
 gi|149741004|gb|EDM55073.1| flagellin FlaC [Vibrio cholerae MZO-2]
 gi|150423491|gb|EDN15435.1| flagellin FlaC [Vibrio cholerae AM-19226]
 gi|227010199|gb|ACP06411.1| flagellin FlaC [Vibrio cholerae M66-2]
 gi|227014083|gb|ACP10293.1| flagellin FlaC [Vibrio cholerae O395]
 gi|229332581|gb|EEN98067.1| flagellin protein FlaD [Vibrio cholerae 12129(1)]
 gi|229343854|gb|EEO08829.1| flagellin protein FlaD [Vibrio cholerae RC9]
 gi|229349013|gb|EEO13970.1| flagellin protein FlaD [Vibrio cholerae TMA 21]
 gi|229351994|gb|EEO16935.1| flagellin protein FlaD [Vibrio cholerae B33]
 gi|229355240|gb|EEO20161.1| flagellin protein FlaD [Vibrio cholerae BX 330286]
 gi|229369935|gb|ACQ60358.1| flagellin protein FlaD [Vibrio cholerae MJ-1236]
 gi|254844971|gb|EET23385.1| flagellin FlaC [Vibrio cholerae MO10]
 gi|255735515|gb|EET90915.1| flagellin protein FlaD [Vibrio cholera CIRS 101]
 gi|262023851|gb|EEY42550.1| flagellin protein FlaD [Vibrio cholerae RC27]
 gi|262028654|gb|EEY47308.1| flagellin protein FlaD [Vibrio cholerae INDRE 91/1]
 gi|262032419|gb|EEY50981.1| flagellin protein FlaD [Vibrio cholerae CT 5369-93]
 gi|297541127|gb|EFH77181.1| flagellin FlaC [Vibrio cholerae MAK 757]
 gi|327484708|gb|AEA79115.1| Flagellin protein FlaD [Vibrio cholerae LMA3894-4]
          Length = 377

 Score =  149 bits (375), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 93/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLTSATNAQQSSMERLSSGYKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  +     I+Q M    +    G             +    
Sbjct: 61  LGVAVRNANDGISMAQTAEGAMKETTNILQRMRDLSLQSANGSNSKADRVAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         + K              +   M         K+  A  
Sbjct: 121 DELNRVAETTSFGGNKLLNGTFATKSFQIGADNGEAVMLNIKDMRSDNALMGGKTYQAAN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +       TD    L+DK   D   + N     D        + +   + A+V+  
Sbjct: 181 GKDKNWGVEAGKTDLTITLKDKREGDVTISINAKEGDDIEELATYINGQTDMIKASVDEE 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +                          + ++ +  D       ++ ++ V   L  
Sbjct: 241 GKLQLFTDNNRIDGAATFGGALAGELGIGAAQDVTVDTLDVTTVGGAQESVAIVDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAINNLDNINENVNASKSRIKDTDFAKETTALTKAQILSQASSS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|156973597|ref|YP_001444504.1| flagellin [Vibrio harveyi ATCC BAA-1116]
 gi|156525191|gb|ABU70277.1| hypothetical protein VIBHAR_01300 [Vibrio harveyi ATCC BAA-1116]
          Length = 384

 Score =  149 bits (375), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 39/375 (10%), Positives = 94/375 (25%), Gaps = 25/375 (6%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+           +   +     E + +G   +      A +        +   
Sbjct: 1   MAVTVSTNVSAMTAQRYLNKATNELNTSMERLSSGHKINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    ++Q M    +    G     +            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNEATSVMQRMRDLAIQSANGTNSPAERKAINEESSALT 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +       +   +          +  +  
Sbjct: 121 DELNRIAETTSFGGRRLLNGSFGEAAFQIGSSSGEAMIMALTSIRADDQRMGGVTFFSEN 180

Query: 182 HLEVSSMNAQQMTD------FIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVS 235
             +          D       + + ED   DD     N     D        + +   ++
Sbjct: 181 GKDKDWGVDPTKADLKITLPGMGEDEDGNPDDLEININAKTGDDIEELATYINGQSDMIN 240

Query: 236 ANVNMRGIRDIMFVAVIGTEF-------------------LSKNLTDGARNVLTKKMLST 276
           A+V+  G   +                              S    D      ++  +S 
Sbjct: 241 ASVSEDGKLQVFVAHPNVQGDISISGGLASDLGLSDEAVRTSVQDIDMTTVQGSQNAISV 300

Query: 277 VQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLIN 336
           +   L  +  QRA LG  +  ++     L N    +D   S+    +      Q++    
Sbjct: 301 LDSALKYVDSQRADLGAKQNRLSHSINNLANIQENVDASNSRIKDTDFAKETTQMTKAQI 360

Query: 337 KIEMSYMITTKLQKL 351
             +    I  + ++L
Sbjct: 361 LQQAGTSILAQAKQL 375


>gi|229916659|ref|YP_002885305.1| flagellar hook-associated protein 3 [Exiguobacterium sp. AT1b]
 gi|229468088|gb|ACQ69860.1| flagellar hook-associated protein 3 [Exiguobacterium sp. AT1b]
          Length = 310

 Score =  149 bits (374), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 33/354 (9%), Positives = 99/354 (27%), Gaps = 45/354 (12%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++ + + +              ++ E++++G+      +        + +  E   + 
Sbjct: 1   MRVTQTMLTQTNLKHLSSSYNTLARVQEQLISGKRIQKASEDPVVAMQGIRYRTEVREVD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + S  T  +  + + L+ + + V+ +            ++++  I    +    E 
Sbjct: 61  QFRRNVSEATSWMDLTDSTLNEVTEAVKRIRELTTQAANDTYESSQREIIKSEVDQLIEH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
             + AN     +Y+++G  + +  +N    K  LA  +              +    +  
Sbjct: 121 IGSLANSKAGEKYIYNGTKTDQPLINVDNLKAYLANPAGSVDSIYESGTAPTASGKIEFE 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
               +  Q           +  +                                     
Sbjct: 181 VSKGITVQVNMQPETVFGKELFEG------------------------------------ 204

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                      +  +               L T+      +I +RA LG     +     
Sbjct: 205 ---------LHKLSTLLKETTTTGADLSAELDTLDTLGQNLITERAELGARANRLELVDN 255

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            LQ+   I  T +S +  ++      +L +       +     ++ + ++L++L
Sbjct: 256 RLQDHEIIAKTIMSDNEDIDVEKVIMELKSHETVHRAALSAGARIIQPTLLDFL 309


>gi|209695749|ref|YP_002263679.1| flagellin [Aliivibrio salmonicida LFI1238]
 gi|208009702|emb|CAQ80003.1| flagellin subunit C [Aliivibrio salmonicida LFI1238]
          Length = 402

 Score =  149 bits (374), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 37/367 (10%), Positives = 97/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  ++T+                  K  E + +G   +      A +        +   
Sbjct: 26  MSITVNTNVSAMTAQRYLNNATDGVNKSMERLSSGYKINSAKDDAAGLQISNRLTSQSRG 85

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    +        +    
Sbjct: 86  LDVAVRNANDGISIAQTAEGAMNESTNILQRMRDLSLQSSNGSNTTSDREAIQQEVGALN 145

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K              +   M          S  A  
Sbjct: 146 DELNRIAETTSFGGSRLLNGQFGTKSFQIGADSGEAVMLNLSNMRSDSASMGGTSYKAET 205

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            L        + ++      +K  +++    N     D        + +   ++A+V+ +
Sbjct: 206 ELGAGWAVNAENSELKVSFLNKAGEEKELTINAKAGDDIEQVATYINGQTDSINASVSEK 265

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I+                         +  +    D      ++K ++ +   +  
Sbjct: 266 GELQIVTSNDKVKGEVSFGGSLAGELKMGAAQAETVKSIDVTTVGGSQKSVAILDAAMQF 325

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   +     L + N  +    S+   V+      +++      + S  
Sbjct: 326 VDSNRADLGAFQNRFSHAISNLDSINENVSASNSRIKDVDFAKETTEMTKAQILQQASSS 385

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 386 ILAQAKQ 392


>gi|315179451|gb|ADT86365.1| Probable flagellin E [Vibrio furnissii NCTC 11218]
          Length = 378

 Score =  149 bits (374), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 92/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G   +      A +      E +   
Sbjct: 1   MAITVNTNVSALVAQRHLNTATDLLHQSLERLSSGNRINSAKDDAAGLQISNRLESQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  +     ++Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIMQTAEGAMQETTSLLQRMRDLSLQSANGSNSKAERVALQEEMGALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  +       +     + S   M    L     S +A  
Sbjct: 121 DEMNRIAETTSFGGRKLLNGSFGQTSFQIGASSGEAVQVSLKNMRSDDLNMGGFSYVAAG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                               +   +DE    +     D        + +   VSA+VN +
Sbjct: 181 EANSQWQVGAGRNQLTISFTNAQGEDEQIHIHAKQGDDIEQLATYINGQTDKVSASVNDK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +          LS +                    D       ++ +S +   L  
Sbjct: 241 GQLQLYMAGKETAGTLSFSGNLADELQMNLKGYEAVDNLDITSVGGAQRAVSVLDTALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +         L N +  +    S+    +      Q+       ++   
Sbjct: 301 VDSHRAELGALQNRFGHAVSNLDNVHENLAASKSRIKDTDYAKETTQMIKQQILQQVGTS 360

Query: 344 ITTKLQK 350
           I  + + 
Sbjct: 361 ILAQAKN 367


>gi|187778687|ref|ZP_02995160.1| hypothetical protein CLOSPO_02282 [Clostridium sporogenes ATCC
           15579]
 gi|187772312|gb|EDU36114.1| hypothetical protein CLOSPO_02282 [Clostridium sporogenes ATCC
           15579]
          Length = 320

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 38/355 (10%), Positives = 103/355 (29%), Gaps = 37/355 (10%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + +            ++  ++ +++ +G++        A V   ++     +   
Sbjct: 1   MRITNNMMANSFMTDMNNNLENLDRIRQQLTSGKNFSKPSHDPAGVIRSMQLYSGIDANK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + S V   L  +   L  + K +  +   L           +       +     S
Sbjct: 61  QYNKNISNVINWLDVTDTALDQVGKQLGKIRDKLEEAGNPGFGETERKALKDEVNGIIAS 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N T +G+Y+FSG   + KP                                   +
Sbjct: 121 MSQTLNTTFDGKYIFSGTRVTGKP---------------------------------TGV 147

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           +  +       D++ +      D            +  +K  I +   ++ +        
Sbjct: 148 QKDATTKNNSIDYVNKDGSIPLDPAGDE---YKQMEQKLKAEISEGVVMEYNVTATEVLE 204

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTK-KMLSTVQQGLSGIIEQRAVLGISEKNINEER 302
                   +       +  D           L  + + L  ++  RA +G  +  ++  +
Sbjct: 205 GGGDLRRFLEDIVKHLDSDDPKEISKLYGDDLGNIDKALDNVLRIRAEVGAKQNRMDAAK 264

Query: 303 VFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
              +  N  +   +S    V     + + + L +    S   + K+ + ++++YL
Sbjct: 265 EMNKETNFNMTEILSNIEDVNLVEKNMEYAILQSVYISSLQTSAKVLQPTLMDYL 319


>gi|551520|gb|AAD10272.1| polar flagellin [Vibrio parahaemolyticus]
          Length = 378

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 43/368 (11%), Positives = 91/368 (24%), Gaps = 19/368 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K                  M          S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTHGAKSFQIGADNGEAVMLELKDMRSDNKMMGGVSYQAES 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   AQ   D    L D F  ++    N     D        + +   V A+V+  
Sbjct: 181 GKGKDWNVAQGKNDLKISLTDSFGQEQEININAKAGDDIEELATYINGQTDLVKASVDQD 240

Query: 242 GIRDIMFVAV-------------------IGTEFLSKNLTDGARNVLTKKMLSTVQQGLS 282
           G   I                           + ++ +  D       ++ ++ +   L 
Sbjct: 241 GKLQIFAGNNKVEGEVSFSGGLSGELGLGDDKKNVTVDTIDVTSVGGAQESVAIIDAALK 300

Query: 283 GIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSY 342
            +   RA LG  +   N     L N N  ++   S+    +       ++      + S 
Sbjct: 301 YVDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTAMTKSQILSQASS 360

Query: 343 MITTKLQK 350
            I  + ++
Sbjct: 361 SILAQRKQ 368


>gi|269961607|ref|ZP_06175969.1| Flagellin A [Vibrio harveyi 1DA3]
 gi|269833648|gb|EEZ87745.1| Flagellin A [Vibrio harveyi 1DA3]
          Length = 384

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 39/375 (10%), Positives = 96/375 (25%), Gaps = 25/375 (6%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+           + + +     E + +G   +      A +        +   
Sbjct: 1   MAVTVSTNVSAMTAQRYLNKASNELNTSMERLSSGHKINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    ++Q M    +    G     +            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNEATSVMQRMRDLAIQSSNGTNSPAERQAINEESSALT 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +       +   +          +  +  
Sbjct: 121 DELNRIAETTSFGGRRLLNGSFGEAAFQIGSSSGEAMIMALTSIRADDQRMGGVTFFSEN 180

Query: 182 HLEVSSMNAQQMTD------FIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVS 235
             +          D       + + ED   DD   + N     D        + +   ++
Sbjct: 181 GKDKDWGVDPTKADLKITLPGMGEDEDGNPDDLEISINAKAGDDIEELATYINGQSDMIN 240

Query: 236 ANVNMRGIRDIMFVAVIGTEF-------------------LSKNLTDGARNVLTKKMLST 276
           A+V+  G   +                              S    D      ++  +S 
Sbjct: 241 ASVSEDGKLQVFVAHPNVQGEISISGGLASDLGLSDEAVRTSVQDIDMTTVQGSQNAISV 300

Query: 277 VQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLIN 336
           +   L  +  QRA LG  +  ++     L N    +D   S+    +      Q++    
Sbjct: 301 LDSALKYVDSQRADLGAKQNRLSHSINNLANIQENVDASNSRIKDTDFAKETTQMTKAQI 360

Query: 337 KIEMSYMITTKLQKL 351
             +    I  + ++L
Sbjct: 361 LQQAGTSILAQAKQL 375


>gi|153834463|ref|ZP_01987130.1| polar flagellin C [Vibrio harveyi HY01]
 gi|148869159|gb|EDL68191.1| polar flagellin C [Vibrio harveyi HY01]
          Length = 384

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 39/375 (10%), Positives = 94/375 (25%), Gaps = 25/375 (6%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+           +   +     E + +G   +      A +        +   
Sbjct: 1   MAVTVSTNVSAMTAQRYLNKATNELNTSMERLSSGHKINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    ++Q M    +    G     +            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNEATSVMQRMRDLAIQSANGTNSPAERQAINEESSALT 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  E       +       +   +          +  +  
Sbjct: 121 DELNRIAETTSFGGRRLLNGSFGEAAFQIGSSSGEAMIMALTSIRADDQRMGGVTFFSEN 180

Query: 182 HLEVSSMNAQQMTD------FIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVS 235
             +          D       + + ED   DD     N     D        + +   ++
Sbjct: 181 GKDKDWGVDPTKADLKITLPGMGEDEDGNPDDLEININAKTGDDIEELATYINGQSDMIN 240

Query: 236 ANVNMRGIRDIMFVAVIGTEF-------------------LSKNLTDGARNVLTKKMLST 276
           A+V+  G   +                              S    D      ++  +S 
Sbjct: 241 ASVSEDGKLQVFVAHPNVQGDISISGGLASDLGLSDEAVRTSVQDIDMTTVQGSQNAISV 300

Query: 277 VQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLIN 336
           +   L  +  QRA LG  +  ++     L N    +D   S+    +      Q++    
Sbjct: 301 LDSALKYVDSQRADLGAKQNRLSHSINNLANIQENVDASNSRIKDTDFAKETTQMTKAQI 360

Query: 337 KIEMSYMITTKLQKL 351
             +    I  + ++L
Sbjct: 361 LQQAGTSILAQAKQL 375


>gi|153836951|ref|ZP_01989618.1| polar flagellin [Vibrio parahaemolyticus AQ3810]
 gi|149749724|gb|EDM60469.1| polar flagellin [Vibrio parahaemolyticus AQ3810]
          Length = 377

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 39/367 (10%), Positives = 101/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G+  +      A +      + +   
Sbjct: 1   MAITVNTNVAALVAQRHLTSATDMLNQSMERLSSGKRINSAKDDAAGLQISNRLQSQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  ++ +  I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIMQTAEGAMNEVTNIMQRMRDLSLQSANGSNSQAERTALQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G          +       +     +     M    L+    S +A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGTFGKSSFQIGASSGEAVQIELKSMRTDGLDMGGFSYVAQG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +      +   D      ++  + E    N     D        + +   V+A+VN +
Sbjct: 181 RADSDWQVKENANDLTMSFTNRSGETEKIQINAKAGDDIEELATYINGQTDKVTASVNEK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   I          +S +                    +       ++ ++ +   +  
Sbjct: 241 GQLQIFMAGEETAGTISFSGDLASELGMSLKGYDAVNNLNITTVGGAQQAVAVLDTAMKF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +   N     L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDSQRAELGAYQNRFNHAINNLDNIHENLTASNSRIQDTDYAKETTQMVKQQILQQVSTT 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|288554144|ref|YP_003426079.1| flagellin domain-containing protein Fli [Bacillus pseudofirmus OF4]
 gi|288545304|gb|ADC49187.1| flagellin domain-containing protein Fli [Bacillus pseudofirmus OF4]
          Length = 380

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 36/370 (9%), Positives = 99/370 (26%), Gaps = 23/370 (6%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +              ++     E++ +G   +      A +    +   +   + 
Sbjct: 1   MIINNNIPALNTYRQMGVNQQNGQNAMEKLASGLRINRAGDDAAGLAISEKMRGQIRGLD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   ++      + T++  L     I+Q M    V       ++         +    + 
Sbjct: 61  QASRNSQDGISLIQTAEGALQETHSILQRMRELAVQSSNDTNNDKDREELQKEVDQLAQE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A+ T+       G N      +           S D M    L  N  +  A    
Sbjct: 121 ITRIADNTEFNTKNLMGENGFSGKFHIGANAGQDITLSIDNMTSKALGVNEATASAVDVG 180

Query: 184 EVSSM-----------------------NAQQMTDFIKQLEDKFSDDEYWANNWSNASDH 220
           + +S+                           M++    +    +     +   S     
Sbjct: 181 DYASVKNNTETEITIEFAALGGGAEISETTAVMSEDGTTITVTLAQAADNSATASKQDVI 240

Query: 221 NIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQG 280
           +    I +   ++   ++               T   SK +   +        ++T+   
Sbjct: 241 DALKGIGEISVLEKDVDLTADAAVVTDITVGAATIDTSKGIDISSSQAAASSAITTINSA 300

Query: 281 LSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEM 340
           +  +  +R+ LG  +  +      L N +  +    S+   V+      +++      + 
Sbjct: 301 IETVSAERSKLGAVQNRLEHTISNLNNSSENLQAAESRIRDVDMAREVMEMTKNNILSQA 360

Query: 341 SYMITTKLQK 350
           S  +  +  +
Sbjct: 361 SQAMLAQANQ 370


>gi|86146832|ref|ZP_01065151.1| flagellin [Vibrio sp. MED222]
 gi|85835284|gb|EAQ53423.1| flagellin [Vibrio sp. MED222]
          Length = 388

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 36/378 (9%), Positives = 90/378 (23%), Gaps = 29/378 (7%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNSANSAQQTSMERLSSGSKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    +        +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETSNILQRMRDLSLQSTNGSNTKSDRVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K                  M     +    S    +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTHGTKSFQIGADNGEAVMLQLKDMRSDNDQMGGSSYQFTE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D    L+D F D      +     D        + +   V A+++  
Sbjct: 181 AKGKDWGVKAGANDLTMSLKDSFGDQREINISAKAGDDIEELATYINGQQDLVKASIDEE 240

Query: 242 G-----------------------------IRDIMFVAVIGTEFLSKNLTDGARNVLTKK 272
           G                                      +  + ++ +  D       ++
Sbjct: 241 GKLQIFAGNNKVDGEIAFSGALSDELGMQAGAKPEDPKTLEGKQVTVDTIDVTSVGGAQE 300

Query: 273 MLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLS 332
            ++ +   L  +   R+ LG  +   +     L N N  ++   S+    +       ++
Sbjct: 301 SVAVIDAALKYVDSHRSELGAFQNRFDHAINNLDNINENVNASKSRIKDTDFAKETTNMT 360

Query: 333 TLINKIEMSYMITTKLQK 350
                 + S  I  + ++
Sbjct: 361 KSQILSQASSSILAQAKQ 378


>gi|261211313|ref|ZP_05925601.1| flagellin protein FlaD [Vibrio sp. RC341]
 gi|260839268|gb|EEX65894.1| flagellin protein FlaD [Vibrio sp. RC341]
          Length = 377

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 92/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLTSATNAQQSSMERLSSGYKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  +     I+Q M    +    G             +    
Sbjct: 61  LGVAVRNANDGISMAQTAEGAMKETTNILQRMRDLSLQSSNGSNSKADRIAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         + K              +   M    +    K+  A  
Sbjct: 121 DELNRVAETTSFGGNKLLNGTFATKSFQIGADNGEAVMLNIKDMRSDNVLMGGKTYQAAN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +        D    L+DK   D   + N     D        + +   V A+V+  
Sbjct: 181 GKDKNWGVEAGKNDLTITLKDKREGDVTISINAKEGDDIEELATYINGQTDMVKASVSEE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +   +       +   +                  D       ++ ++ V   L  
Sbjct: 241 GKLQLFTDSNKVDGAATFGGSLAGELGIGAAKDVTVDTLDVTTVGGAQESVAIVDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAINNLDNINENVNASTSRIKDTDFAKETTALTKAQILSQASSS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|153213621|ref|ZP_01948894.1| flagellin FlaC [Vibrio cholerae 1587]
 gi|183179574|ref|ZP_02957785.1| flagellin FlaC [Vibrio cholerae MZO-3]
 gi|229522137|ref|ZP_04411554.1| flagellin protein FlaD [Vibrio cholerae TM 11079-80]
 gi|229524183|ref|ZP_04413588.1| flagellin protein FlaD [Vibrio cholerae bv. albensis VL426]
 gi|297580834|ref|ZP_06942759.1| flagellin FlaC [Vibrio cholerae RC385]
 gi|124115820|gb|EAY34640.1| flagellin FlaC [Vibrio cholerae 1587]
 gi|183012985|gb|EDT88285.1| flagellin FlaC [Vibrio cholerae MZO-3]
 gi|229337764|gb|EEO02781.1| flagellin protein FlaD [Vibrio cholerae bv. albensis VL426]
 gi|229341062|gb|EEO06067.1| flagellin protein FlaD [Vibrio cholerae TM 11079-80]
 gi|297534660|gb|EFH73496.1| flagellin FlaC [Vibrio cholerae RC385]
          Length = 377

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 96/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLTSATNAQQSSMERLSSGYKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISMAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         + K              +   M         K+  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFATKSFQIGADNGEAVMLNIKDMRSDNALMGGKTYQAAN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +       TD    L+DK   D   + N     D        + +   + A+V+  
Sbjct: 181 GKDKNWGVEAGKTDLTITLKDKREGDVTISINAKEGDDIEELATYINGQTDMIKASVDEE 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +                          + ++ +  D       ++ ++ V   L  
Sbjct: 241 GKLQLFTDNNRIDGAATFGGALAGELGIGAAQDVTVDTLDVTTVGGAQESVAIVDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAINNLDNINENVNASKSRIKDTDFAKETTALTKAQILSQASSS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|323491437|ref|ZP_08096621.1| flagellin [Vibrio brasiliensis LMG 20546]
 gi|323314306|gb|EGA67386.1| flagellin [Vibrio brasiliensis LMG 20546]
          Length = 377

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 98/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNGATDGMQKSMERLSSGYKINSARDDAAGLQISNRLNSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDMAVKNANDGISIAQTAEGAMNETTNILQRMRDLALQSSNGSNSRSERIAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +      +     + S   M    ++   K+ +A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFGNQSFQIGASSGEAVQLSMGNMRSDTIDMGGKAYIAQE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   +   TD      D   + +    N     D        + +  DV A+V   
Sbjct: 181 GKAADWTVSSGATDLTLGYTDVHGEAQELTINAKAGDDIEQLATYINGQSADVKASVGEE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +   +      ++                      D      ++  +S +   L  
Sbjct: 241 GKLQLFAASNKVATDVTIGGGLGSEIGFGAAQERTVADVDVTSVAGSQLAVSVIDGALKT 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +         L N N  ++   S+ +  +       ++      + S  
Sbjct: 301 VDSQRAELGAFQNRFGHAISNLDNINENVNASRSRIVDTDYAKETTAMTKSQILQQASTS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|3355298|gb|AAC27808.1| polar flagellin [Vibrio parahaemolyticus]
          Length = 377

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 100/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G+  +      A +      + +   
Sbjct: 1   MAITVNTNVAALVAQRHLTSATDMLNQSMERLSSGKRINSAKDDAAGLQISNRLQSQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  ++ +  I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIMQTAEGAMNEVTNIMQRMRDLSLQSANGSNSQAERTALQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G          +             +     M    LE    S +A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGTFGKSSFQIGAASGEAVQIELKSMRTDGLEMGGFSYVAQG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +      +   D      ++  + E    N     D        + +   V+A+VN +
Sbjct: 181 RADSDWQVKENANDLTMSFTNRSGETEKIQINAKAGDDIEELATYINGQTDKVTASVNEK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   I          +S +                    +       ++ ++ +   +  
Sbjct: 241 GQLQIFMAGEETAGTISFSGDLASELGMSLKGYDAVNNLNITTVGGAQQAVAVLDTAMKF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +   N     L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDSQRAELGAYQNRFNHAINNLDNIHENLAASNSRIQDTDYAKETTQMVKQQILQQVSTT 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|28899035|ref|NP_798640.1| flagellin [Vibrio parahaemolyticus RIMD 2210633]
 gi|260365219|ref|ZP_05777776.1| polar flagellin F [Vibrio parahaemolyticus K5030]
 gi|260876883|ref|ZP_05889238.1| polar flagellin F [Vibrio parahaemolyticus AN-5034]
 gi|260897364|ref|ZP_05905860.1| polar flagellin F [Vibrio parahaemolyticus Peru-466]
 gi|29611943|sp|O87081|FLAF_VIBPA RecName: Full=Polar flagellin F
 gi|28807254|dbj|BAC60524.1| polar flagellin F [Vibrio parahaemolyticus RIMD 2210633]
 gi|308088247|gb|EFO37942.1| polar flagellin F [Vibrio parahaemolyticus Peru-466]
 gi|308091379|gb|EFO41074.1| polar flagellin F [Vibrio parahaemolyticus AN-5034]
 gi|308115431|gb|EFO52971.1| polar flagellin F [Vibrio parahaemolyticus K5030]
          Length = 377

 Score =  148 bits (372), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 102/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G+  +      A +      + + + 
Sbjct: 1   MAITVNTNVAALVAQRHLTSATDMLNQSMERLSSGKRINSAKDDAAGLQISNRLQSQMSG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  ++ +  I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIMQTAEGAMNEVTNIMQRMRDLSLQSANGSNSQVERTALQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G          +             +     M    LE    S +A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGAFGKSSFQIGAASGEAVQIELKSMRTDGLEMGGFSYVAQG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +      +   D      ++  + E    N  +  D        + +   V+A+VN +
Sbjct: 181 RADSDWQVKENANDLTMSFINRSGETEKIQINAKSGDDIEELATYINGQTDKVTASVNEK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   I          +S +                    +       ++ ++ +   +  
Sbjct: 241 GQLQIFMAGEDTAGTISFSGDLASELGMSLKGYDAVNNLNITTVGGAQQAVAVLDTAMKF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +   N     L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDSQRAELGAYQNRFNHAINNLDNIHENLAASNSRIQDTDYAKETTQMVKQQILQQVSTT 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|328474428|gb|EGF45233.1| flagellin [Vibrio parahaemolyticus 10329]
          Length = 377

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 39/367 (10%), Positives = 100/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G+  +      A +      + +   
Sbjct: 1   MAITVNTNVAALVAQRHLTSATDMLDQSMERLSSGKRINSAKDDAAGLQISNRLQSQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  ++ +  I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIMQTAEGAMNEVTNIMQRMRDLSLQSANGSNSQAERTALQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G          +             +     M    L+    S +A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGTFGKSSFQIGAASGEAVQIELKSMRTDGLDMGGFSYVAQG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +      +   D      ++  + E    N     D        + +   V+A+VN +
Sbjct: 181 RTDSDWQVKENANDLTMSFTNRSGETEKIQINAKAGDDIEELATYINGQTDKVTASVNEK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   I          +S +                    +       ++ ++ +   +  
Sbjct: 241 GQLQIFMAGEETAGTISFSGDLASELGMSLKGYDAVNNLNITTVGGAQQAVAVLDTAMKF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +   N     L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDSQRAELGAYQNRFNHAINNLDNIHENLAASNSRIQDTDYAKETTQMVKQQILQQVSTT 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|188590093|ref|YP_001920170.1| flagellar hook-associated protein 3 [Clostridium botulinum E3 str.
           Alaska E43]
 gi|251778367|ref|ZP_04821287.1| flagellar hook-associated protein 3 [Clostridium botulinum E1 str.
           'BoNT E Beluga']
 gi|188500374|gb|ACD53510.1| flagellar hook-associated protein 3 [Clostridium botulinum E3 str.
           Alaska E43]
 gi|243082682|gb|EES48572.1| flagellar hook-associated protein 3 [Clostridium botulinum E1 str.
           'BoNT E Beluga']
          Length = 402

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 46/402 (11%), Positives = 117/402 (29%), Gaps = 48/402 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+TS +                KL  ++ +G+          +V+  ++   E     
Sbjct: 1   MRITTSMLSSNYKSNMTTNLNHIQKLQNQLSSGKEISRPSDNPYKVSRTMQMYTEIGANK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +   ++  L T+   L+ M+ +   +   LV    G    ++       +++    
Sbjct: 61  QYNENIKDISNWLDTTDTSLNQMENVFARVRELLVTAGNGAYGPDEKKAIQDEIKERVNE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N   +G Y+F G  S+ KP+      +          +          L      
Sbjct: 121 MGQILNTNFDGVYIFGGTKSTSKPIMVNSNGELCYADKDGNAVSKTATGVKIDLTNPITD 180

Query: 184 EVSSM------NAQQMTDFIKQLEDKFSDDEYWANNWSNASDHN---------------- 221
             +        +   +   I         +     + S                      
Sbjct: 181 GGTKSIKGMEKDGNNVKMTITDTNTTPPSETPITIDLSTIGSGTPPETAESLFKVALNGQ 240

Query: 222 --------------------------IKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTE 255
                                     +   +     I+ + N       +   +     +
Sbjct: 241 GFADSDIGRLAGMVPSFDSLDQIGSELNVEVSQGVLINYNKNAVDLLEGNGTNIMSTLNK 300

Query: 256 FLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTY 315
            ++   T G ++V+T + +  V   +  +++ RA +G  +  +   +   +++N  +   
Sbjct: 301 IITNLGTGGDQSVITGECIGEVDDIIKNLLQHRAEVGAMQNRMESAQDKNESENLDMTDI 360

Query: 316 ISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +SK+  ++      Q S +      +   + K+   +IL+YL
Sbjct: 361 LSKTEDIDFTEKMIQYSIMQTVYMAALQTSAKILPATILDYL 402


>gi|37679155|ref|NP_933764.1| flagellin [Vibrio vulnificus YJ016]
 gi|161501853|ref|NP_759225.2| flagellin [Vibrio vulnificus CMCP6]
 gi|320157101|ref|YP_004189480.1| flagellin protein FlaC [Vibrio vulnificus MO6-24/O]
 gi|37197897|dbj|BAC93735.1| polar flagellin FlaC [Vibrio vulnificus YJ016]
 gi|319932413|gb|ADV87277.1| flagellin protein FlaC [Vibrio vulnificus MO6-24/O]
 gi|319999022|gb|AAO08752.2| Flagellin protein flaC [Vibrio vulnificus CMCP6]
          Length = 385

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 32/375 (8%), Positives = 90/375 (24%), Gaps = 25/375 (6%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+           +   +     E + +G   +      A +        +   
Sbjct: 1   MAVTVSTNVSAMTAQRYLNKATDELNTSMERLSSGHKINSAKDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    ++Q M    +    G    ++            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNEATAVLQRMRDLSIQSANGTNSTSERQAIHEEASALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G          +                   +          +  +  
Sbjct: 121 DEINRIAETTSFGGRRLLNGTFGDAAFQIGSNSGEAMIMGLTSIRADDFRMGGTTFQSEN 180

Query: 182 HLEVSSMNAQQ-------------------------MTDFIKQLEDKFSDDEYWANNWSN 216
                   +                           +        ++ +      +++ N
Sbjct: 181 GKNKDWEVSADNAELNIVLPEMGEDEDGNVIDLEINIMAKSGDDIEELATYINGQSDYIN 240

Query: 217 ASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLST 276
           AS              +V  ++++ G               +    D      ++  +S 
Sbjct: 241 ASVSEDGKLQIFVAQPNVKGDISISGSLASELGLSDEPIATTVQDLDLRTVQGSQNAISV 300

Query: 277 VQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLIN 336
           +   L  +  QRA LG  +  ++     L N    +D   S+    +      Q++    
Sbjct: 301 IDAALKYVDSQRADLGAKQNRLSHSINNLANVQENVDASNSRIKDTDFAKETTQMTKAQI 360

Query: 337 KIEMSYMITTKLQKL 351
             +    I  + ++L
Sbjct: 361 LQQAGTSILAQAKQL 375


>gi|212709526|ref|ZP_03317654.1| hypothetical protein PROVALCAL_00568 [Providencia alcalifaciens DSM
           30120]
 gi|212687864|gb|EEB47392.1| hypothetical protein PROVALCAL_00568 [Providencia alcalifaciens DSM
           30120]
          Length = 384

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 40/374 (10%), Positives = 93/374 (24%), Gaps = 25/374 (6%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+ +                   E + +G   +      A       +      
Sbjct: 1   MAQVINTNILSLTTQNNLNRSQGVLGTAIERLSSGSRINSAKDDAAGQAIANRFTANVKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  ++ +   +Q +    V    G    +        +    
Sbjct: 61  LTQASRNANDGISIAQTAEGAVNEINDNLQRVRELTVQAQNGTNSKSDIESINKEVTARM 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQ------GFLEENSK 175
           +     +  T          ++S K   G    +++A        +             K
Sbjct: 121 DEINRISEQTQFNGVKVLSEDTSMKIQVGTNDSETIAINLKKIDSEVLGLKGFDASSKGK 180

Query: 176 SLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVS 235
                      S     + D +          E         +D  I Y  K     D +
Sbjct: 181 FGTEVTSDSFVSALQGDLDDSVTATAAAKKGFEDITVGGDKITDAKIYYATKPDGTDDKT 240

Query: 236 -------------------ANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLST 276
                              A     G +       +     +    D  + +  K  LST
Sbjct: 241 QMLVVGKDAAGKEVTGKIAAPTVTAGEKAGSVAPKLEFADATALTPDEQKALDAKNPLST 300

Query: 277 VQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLIN 336
           + + L+ +   R+ LG  +  +      L N  N +    S+    +  T  + +S    
Sbjct: 301 LDKALATVDSLRSDLGAIQNRLQSTINNLNNSVNNLSAARSRIQDADFATEVSNMSRGQI 360

Query: 337 KIEMSYMITTKLQK 350
             +    +  +  +
Sbjct: 361 LQQAGTAVLAQANQ 374


>gi|260767717|ref|ZP_05876652.1| flagellin protein FlaF [Vibrio furnissii CIP 102972]
 gi|260617226|gb|EEX42410.1| flagellin protein FlaF [Vibrio furnissii CIP 102972]
          Length = 378

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 92/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G   +      A +      E +   
Sbjct: 1   MAITVNTNVSALVAQRHLNTATDLLNQSLERLSSGNRINSAKDDAAGLQISNRLESQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  +     ++Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIMQTAEGAMQETTSLLQRMRDLSLQSANGSNSKAERVALQEEMSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  +       +     + S   M    L     S +A  
Sbjct: 121 DEMNRIAETTSFGGRKLLNGSFGQTSFQIGASSGEAVQVSLKNMRSDDLNMGGFSYVAAG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                               +   +DE    +     D        + +   VSA+VN +
Sbjct: 181 EANSQWQVGAGRNQLTISFTNAQGEDEQIHIHAKQGDDIEQLATYINGQTDKVSASVNDK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +          LS +                    D       ++ +S +   L  
Sbjct: 241 GQLQLYMAGKETAGTLSFSGNLADELQMNLKGYEAVDNLDITSVGGAQRAVSVLDTALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +         L N +  +    S+    +      Q+       ++   
Sbjct: 301 VDSHRAELGALQNRFGHAVSNLDNVHENLAASKSRIKDTDYAKETTQMIKQQILQQVGTS 360

Query: 344 ITTKLQK 350
           I  + + 
Sbjct: 361 ILAQAKN 367


>gi|125974727|ref|YP_001038637.1| flagellar hook-associated protein FlgL [Clostridium thermocellum
           ATCC 27405]
 gi|256005262|ref|ZP_05430229.1| flagellar hook-associated protein 3 [Clostridium thermocellum DSM
           2360]
 gi|281418804|ref|ZP_06249823.1| flagellar hook-associated protein 3 [Clostridium thermocellum JW20]
 gi|125714952|gb|ABN53444.1| flagellar hook-associated protein 3 [Clostridium thermocellum ATCC
           27405]
 gi|255990813|gb|EEU00928.1| flagellar hook-associated protein 3 [Clostridium thermocellum DSM
           2360]
 gi|281407888|gb|EFB38147.1| flagellar hook-associated protein 3 [Clostridium thermocellum JW20]
 gi|316941861|gb|ADU75895.1| flagellar hook-associated protein 3 [Clostridium thermocellum DSM
           1313]
          Length = 302

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 46/354 (12%), Positives = 102/354 (28%), Gaps = 53/354 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + I   M     +      K  + + TG+               L+   +   I 
Sbjct: 1   MRITNNMIVNNMINNIGKNLARMDKYQQMLATGKKITVPSDDPVVAARALKLRTDVAQIE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       L  +++ ++++  I+Q      V    G T           +      
Sbjct: 61  QYKTNVQDAMSWLEITESAVANVGDILQRARELAVQASSGTTTEEDTKKIKQEVEQLKNQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +  AN T  G+Y+FSG  ++ + ++           S   + Q  + ++    + G  L
Sbjct: 121 LIKIANSTYAGRYIFSGFKTNTRLMDDDGYFTMDVANSEAIIYQIGISDSININVPGGDL 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
               ++A                                             A    + I
Sbjct: 181 FNGGIDA--------------------------------------------GAGGKGKLI 196

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
            D               ++D   N         + + L+ ++  RA +G     +     
Sbjct: 197 ADFEAYINALDSGDHSLISDAITN---------IDENLNHVLRIRADIGARYNRLELTAD 247

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L   +      +S++  V+Q      L T  N    S     ++ + S++++L
Sbjct: 248 RLDIDSINFRKLMSENEDVDQAENILLLKTEENVYRASLSGGARIIQTSLVDFL 301


>gi|197726037|gb|ACH73171.1| flagellin [Vibrio alginolyticus]
          Length = 376

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 99/367 (26%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+           +      K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNQAADGQQKSMERLSSGYKINSAKDDAAGLQISNRLNAQSCG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +        ++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDMAVKNANDGISIAQVAEGAMNESTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +              S   +         KS  A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYGTQSFQIGADSGEAVMLSMGNLRSDTSAMGGKSYAAEE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S     + T+F     +K  +++  + +     D        + +  DV A+V   
Sbjct: 181 GKDASW-TVGEKTEFKMSYTNKQGEEKELSISAKQGDDIEQLATYINGQNDDVKASVGED 239

Query: 242 G------------------IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G                        +   G + ++    D      +++ ++ +   L  
Sbjct: 240 GKLQVFASSQKVEGDVEFSGNLADEIGFGGPKDVTVKDIDVTTVAGSQEAVAVIDGALKS 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG      N     L N N  ++   S+    +       ++      + S  
Sbjct: 300 VDSQRASLGAFLNRFNHAISNLDNINENVNASKSRIKDTDYAKETTAMTKSQILQQASTS 359

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 360 ILAQAKQ 366


>gi|312884921|ref|ZP_07744611.1| flagellin [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367398|gb|EFP94960.1| flagellin [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 377

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 93/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNAATDGMQKSMERLSSGYKINSARDDAAGLQISNRLNSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  +S    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISISQTAEGAMSESTSILQRMRDLALQSSNGSNSISERTALQEEVSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G Y         +            + S   M     E   K  +A  
Sbjct: 121 DELNRIAESTSFGGYKLLNGTYGTQSFQIGAGSGEAVQLSMGNMRSDTDEMGGKVYIAST 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                 +      D     +D                D        + +  DV A+V   
Sbjct: 181 GKASDWVVEAGKEDITLAYDDVNGKSHSIDITAKVGDDLQELATFINGQSEDVKASVGED 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
               +   A      ++                      D +    ++  +S +   L  
Sbjct: 241 NKLQLFASANKVASDVTVTGNLGTDIGFAAGQKSTVSDIDISTVAGSQLAISVIDGALKT 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +         L++ N  ++   S+ +  +      Q++      +    
Sbjct: 301 VDSQRAQLGAFQNRFGHAISNLESINENVNASRSRIVDTDYAKETTQMTKSQILQQAGTS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|28211375|ref|NP_782319.1| flagellar hook-associated protein 3 [Clostridium tetani E88]
 gi|28203816|gb|AAO36256.1| flagellar hook-associated protein 3 [Clostridium tetani E88]
          Length = 316

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 40/353 (11%), Positives = 105/353 (29%), Gaps = 39/353 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+   +             +   + +++ +G+          +V   ++   E +   
Sbjct: 1   MRITNKMLANNFLTDMTTNLNNLQTIQQQLTSGKEIRRPSDDPIKVARAMQLHSEISANQ 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       L  +   L  + +  Q +   LV        +++       +++    
Sbjct: 61  QYNENIKDTLSWLEQTDTALGQLGEQSQRVRELLVSAGNAAYGSDERKKINDEVKEIVGQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N + +G+Y+F G   + KP+N    K   A++   ++         K +      
Sbjct: 121 MSQTLNASFDGRYIFGGTRGTSKPVNVKDNKLVYAERDGSELGAAEKIMKEKLVTEISQG 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
                N                                              A  N R +
Sbjct: 181 VRIEYNITATEA-----------------------------------MQFKDAKGNDRDL 205

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
           RDI+   V   E       D     +TK  L  +   +   ++ R+ +G     +     
Sbjct: 206 RDILEKIVEHLESP----DDDKIKEITKGDLEALDAVMDNTLKLRSQVGAKGNRMESALE 261

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNY 356
             + +N  +   +SK+  ++      + +  I+    +   + ++ + ++++Y
Sbjct: 262 KNKEENFNLKEILSKTEDIDLAEKSMEFAVAISVYMSALQTSARVLQPTLMDY 314


>gi|91223535|ref|ZP_01258800.1| flagellin [Vibrio alginolyticus 12G01]
 gi|269965714|ref|ZP_06179827.1| Flagellin B [Vibrio alginolyticus 40B]
 gi|91191621|gb|EAS77885.1| flagellin [Vibrio alginolyticus 12G01]
 gi|269829782|gb|EEZ84018.1| Flagellin B [Vibrio alginolyticus 40B]
          Length = 376

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 100/367 (27%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+           +      K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNQAADGQQKSMERLSSGYKINSAKDDAAGLQISNRLNAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +        ++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDMAVKNANDGISIAQVAEGAMNESTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +              S   +         KS  A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYGTQSFQIGADSGEAVMLSMGNLRSDTSAMGGKSYAAEE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S     + T+F     +K  +++  + +     D        + +  DV A+V   
Sbjct: 181 GKDASW-TVGEKTEFKMSYTNKQGEEKELSISAKQGDDIEQLATYINGQNDDVKASVGED 239

Query: 242 GIRDIMFVAVIG------------------TEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +   +                      + ++    D      +++ ++ +   L  
Sbjct: 240 GKLQVFASSQKVEGDVEFSGNLADEIGFGGPKDVTVKDIDVTTVAGSQEAVAVIDGALKS 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +   N     L N N  ++   S+    +       ++      + S  
Sbjct: 300 VDSQRASLGAFQNRFNHAISNLDNINENVNASKSRIKDTDYAKETTAMTKSQILQQASTS 359

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 360 ILAQAKQ 366


>gi|260899922|ref|ZP_05908317.1| polar flagellin [Vibrio parahaemolyticus AQ4037]
 gi|308107375|gb|EFO44915.1| polar flagellin [Vibrio parahaemolyticus AQ4037]
          Length = 377

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 39/367 (10%), Positives = 100/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G+  +      A +      + +   
Sbjct: 1   MAITVNTNVAALVAQRHLTSATDMLNQSMERLSSGKRINSAKDDAAGLQISNRLQSQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  ++ +  I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIMQTAEGAMNEVTNIMQRMRDLSLQSANGSNSQAERTALQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G          +             +     M    L+    S +A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGTFGKSSFQIGAASGEAVQIELKSMRTDGLDMGGFSYVAQG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +      +   D      ++  + E    N     D        + +   V+A+VN +
Sbjct: 181 RADSDWQVKENANDLTMSFTNRSGETEKIQINAKAGDDIEELATYINGQTDKVTASVNEK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   I          +S +                    +       ++ ++ +   +  
Sbjct: 241 GQLQIFMAGEDTAGTISFSGDLASELGMSLKGYDAVNNLNITTVGGAQQAVAVLDTAMKF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +   N     L N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDSQRAELGAYQNRFNHAINNLDNIHENLAASNSRIQDTDYAKETTQMVKQQILQQVSTT 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|254506945|ref|ZP_05119084.1| flagellin [Vibrio parahaemolyticus 16]
 gi|219550230|gb|EED27216.1| flagellin [Vibrio parahaemolyticus 16]
          Length = 377

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 46/367 (12%), Positives = 100/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G   +      A +      E + + 
Sbjct: 1   MAITVNTNVSAMTAQRHLTNATDLLNQSLERLASGSRINSAKDDAAGLQISNRLETQMSG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIMQTAEGAMNETTNILQRMRDLSLQSSNGSNSQAERTALQEEMAALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       + +        +     + S   M    LE    S +A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFASSSFQIGASSGEAVQVSLKNMRSDSLEMGGFSYVAAG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +    Q       +  +   + E          D        + +   VSA+VN  
Sbjct: 181 KADANWQVGQGNHVLNMEYTNARGEQEVIQIKAKAGDDIEELATYINGQTDKVSASVNEE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   I          LS +                    D +     ++ +S +   L  
Sbjct: 241 GQLQIFMAGKETAGTLSFSGNLANELQMNLAGYEAVDNLDISDVGGAQRAVSVIDTALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N +  +    S+    +      QL       ++S  
Sbjct: 301 VDSHRAELGALQNRFNHAITNLDNVHENLAASNSRIKDTDYAKETTQLVKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|148976401|ref|ZP_01813107.1| flagellar hook-associated protein L [Vibrionales bacterium SWAT-3]
 gi|145964224|gb|EDK29480.1| flagellar hook-associated protein L [Vibrionales bacterium SWAT-3]
          Length = 396

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 36/396 (9%), Positives = 106/396 (26%), Gaps = 40/396 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +           ++ +G+              +    Q+   
Sbjct: 1   MLNRISSFHNYQSVQNDLRRQENKVHHNQAQLASGKKLQSPSDDPLATHYLQNIGQQSEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + + + +LV  RL   +  +++ +    +    ++ ++ G             +++  
Sbjct: 61  LKQYVDAITLVRNRLEHHEVMIANSEGFADEAKRTVMEMINGALSPEDRLAKKREIQELA 120

Query: 122 ESFVTFANMTDEGQYL-FSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
            +F+  AN  DE     F+G     +P           +    Q           ++   
Sbjct: 121 NNFLYLANSQDESGNYTFAGTKPKSQPFFRDNEGTVTYQGDDYQRKMRVASSFEMAMNDP 180

Query: 181 QHLEV--------------------------SSMNAQQMTDFIKQLEDKFSDDEYWANNW 214
                                          ++ +A+  + +     D  +    +    
Sbjct: 181 GSKLFMEIDNPFGDYEPQYELEPASELLLGRATNSAEDGSTYKVTFVDMQTGKFAYQLEK 240

Query: 215 SNASDHNIKYRIKDT-------------EGIDVSANVNMRGIRDIMFVAVIGTEFLSKNL 261
             A      +                       S  +  R    I        E +   +
Sbjct: 241 DGAVVAAEDFDPATGIVYEGLNIQFKGQVTKGDSITLEPRETFSIFDTFKEAAEQVENPV 300

Query: 262 TDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIG 321
           +D +      +M          + + R  +G     ++ +    ++    +    S    
Sbjct: 301 SDASATAKLHQMTEEFHAAFIHLTKARTDVGARLSTLDIQEQQHEDFKLSLAKAKSNFED 360

Query: 322 VEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           ++   A  + +     ++ S     K + L++ NY+
Sbjct: 361 LDYSKAIIEFNENSRALQASQQAFGKTKDLTLFNYI 396


>gi|328474430|gb|EGF45235.1| flagellin [Vibrio parahaemolyticus 10329]
          Length = 378

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 43/368 (11%), Positives = 91/368 (24%), Gaps = 19/368 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K                  M          S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTHGAKSFQIGADNGEAVMLELKDMRSDNKMMGGVSYQAES 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   AQ   D    L D F  ++    N     D        + +   V A+V+  
Sbjct: 181 GKGKDWNVAQGKNDLKISLTDSFGQEQEININAKAGDDIEELATHINGQTDLVKASVDQD 240

Query: 242 GIRDIMFVAV-------------------IGTEFLSKNLTDGARNVLTKKMLSTVQQGLS 282
           G   I                           + ++ +  D       ++ ++ +   L 
Sbjct: 241 GKLQIFAGNNKVEGEVSFSGGLSGELGLGDNKKNVTVDTIDVTSVGGAQESVAIIDAALK 300

Query: 283 GIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSY 342
            +   RA LG  +   N     L N N  ++   S+    +       ++      + S 
Sbjct: 301 YVDSHRAELGAFQNRFNHATSNLDNINENVNASKSRITDTDFAKETTAMTKSQILSQASS 360

Query: 343 MITTKLQK 350
            I  + ++
Sbjct: 361 SILAQAKQ 368


>gi|156973595|ref|YP_001444502.1| flagellar hook-associated protein FlgL [Vibrio harveyi ATCC
           BAA-1116]
 gi|156525189|gb|ABU70275.1| hypothetical protein VIBHAR_01298 [Vibrio harveyi ATCC BAA-1116]
          Length = 396

 Score =  147 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 48/396 (12%), Positives = 120/396 (30%), Gaps = 40/396 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             T IS+   ++ +    +          E++ +G+              I    Q++  
Sbjct: 1   MLTRISSFHNYQSVQNDLRRQENKVHHNQEQLASGKQLTKPSDDPLATHYIQSIGQQEEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L +  LV  RL   +  +++ ++ V +     + ++ G             L +  
Sbjct: 61  LRQYLDAIVLVRNRLENQEVAVANAEQFVDESKRLSMEMINGAFSPEDRAAKKRELEEIA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+  AN  DE           +       +  S+     D   +  +  N +  +   
Sbjct: 121 NNFMALANSQDESGNYVFAGTKPKTQPFFRDSDGSVVYTGDDYQRKMKIASNIEMGINYP 180

Query: 182 HLEVSSMNAQQMTDF-------------IKQLEDKFSDDEYWANNWSNASDHNIKYRIKD 228
             +V S  +    DF             + Q  D+   D  +   + + S+    Y+++ 
Sbjct: 181 GNKVFSEISNPFGDFEPQYGLQEGSELLLGQATDESKSDSNYKVTFVDMSNGKFGYQLEK 240

Query: 229 TEGIDV---------------------SANVNMRGIRDI------MFVAVIGTEFLSKNL 261
             GI                         +       +               ++   ++
Sbjct: 241 DGGIVQVDDYSPIDGIQYEGVNIQLKGQVSAGDSITLEPRQTFSIFDAFKETMQWSESSV 300

Query: 262 TDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIG 321
           +D +      +M    Q     + + R  +G     ++ +    ++ N  +    S    
Sbjct: 301 SDASATAKLHQMTEEFQAAFVHMNKVRTDVGAKLSTLDIQEQNHEDFNLSLAKAKSNFED 360

Query: 322 VEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           ++   A  + S     ++ S     K + L++ NY+
Sbjct: 361 LDYSKAVIEFSENSRALQASQQAFGKTKDLTLFNYI 396


>gi|19910961|dbj|BAB87729.1| flagellin protein FliA(S) [Clostridium septicum]
          Length = 384

 Score =  147 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 30/361 (8%), Positives = 92/361 (25%), Gaps = 27/361 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +      +         + K  E++ +G   +      A ++   +   +   + 
Sbjct: 1   MIINHNMNAMNAHRNMASNTVATGKSMEKLSSGLRINRAGDDAAGLSISEKMRGQIRGLE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   ++      + T++  L+    I+Q M    V               +  L    + 
Sbjct: 61  QASRNSQDGISLIQTTEGALNETHSILQRMRELSVQASNDTNTAEDRGQLSKELDQLTQE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               ++ T   +         E          +  +     + +   +    +       
Sbjct: 121 IDRISSQTQFNKMDVLNGKGDEPFKANIQVGANSNQAIEIAINKMDYKSLFSAQRVVATK 180

Query: 184 EVSSM-------------------NAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKY 224
           EV+                         + +     +++F  +   + N        ++ 
Sbjct: 181 EVADGVELKKGANVKLTIDGKAVEVKADVKEDKTLTKEEFISELNKSINADKDLAGKVEA 240

Query: 225 RIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNV--------LTKKMLST 276
              D +      + +   I+  +  +  GT+          +               +  
Sbjct: 241 SFVDNKLTISRVDGSEEKIKVKIEGSTGGTDLSLVETESAMKEYKVDFKSHLAATSSIKE 300

Query: 277 VQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLIN 336
           + + +  +  QR+ LG  +  +      + N    +    S+   V+        S    
Sbjct: 301 IDKAIEKVSTQRSQLGAYQNRLEHTIKNVDNAAENLQAAESRVRDVDMANEMMTFSKNNI 360

Query: 337 K 337
            
Sbjct: 361 L 361


>gi|172058467|ref|YP_001814927.1| flagellar hook-associated protein 3 [Exiguobacterium sibiricum
           255-15]
 gi|171990988|gb|ACB61910.1| flagellar hook-associated protein 3 [Exiguobacterium sibiricum
           255-15]
          Length = 320

 Score =  147 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 33/354 (9%), Positives = 98/354 (27%), Gaps = 35/354 (9%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++ + + +          +    + E++++G+      +        + +  E   + 
Sbjct: 1   MRVTQTMLTKTNIGYLSASYQKLSSMQEQLISGKKIQRPSEDPVVAMQGIRYRTEVREVE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + +  T  +  + + L+ +   +  +            D  +       +    E 
Sbjct: 61  QFKKNVNEATGWMDLTDSALNEVTSAMSRVRELTTQAATDTYDATQRKAIQSEVGQLIEH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
             T AN     + +F+G  + +  ++    +D L              + +         
Sbjct: 121 IGTMANTKYNEKGIFNGTATDKPFVSIEGLRDYLTSSGKPVDSVFTDGDPATKGSEIIQY 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           E+SS    Q+      +    +         +                            
Sbjct: 181 EISSGIQVQVNVSPTDVFSPETFTTLKKLYDALGGVSET--------------------- 219

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                                        ML  +   ++  +E RA LG     +     
Sbjct: 220 --------------GGTADSSNNGAQLSAMLKDLDVMVNQTVETRADLGARVNRLELNAS 265

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L+++  I+ T +S +  +E      +L +       +     ++ + ++L++L
Sbjct: 266 RLEDQEIIVKTVMSDNEDIEAEKVIMELKSYETLHRAALSAGARIIQPTLLDFL 319


>gi|260776493|ref|ZP_05885388.1| flagellin B [Vibrio coralliilyticus ATCC BAA-450]
 gi|260607716|gb|EEX33981.1| flagellin B [Vibrio coralliilyticus ATCC BAA-450]
          Length = 377

 Score =  147 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 98/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNGAADGMQRSMERLSSGYKINSARDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDMAVKNANDGISIAQTAEGAMNETTNILQRMRDLSLQSSNGSNSRSERIAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +      +       +   M         K+ +A Q
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFGSQSFQIGASSGEAVMLTMGNMRSDTSGMGGKAYIAQQ 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +     +Q  TD      D   + +    N     D        + +  DV A+V   
Sbjct: 181 GKDTDWAVSQGSTDLTLDYTDVHGEAKQLTINAKVGDDIEQLATYINGQSEDVKASVGEE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +          ++                      D +    ++  +S +   L  
Sbjct: 241 GKLQLFAANNKVASDVTIGGALGGDIGFGAAENKTVSDVDVSTVAGSQMAVSVIDGALKT 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +   +     L N N  ++   S+    +      Q++      + S  
Sbjct: 301 VDSQRAELGAFQNRFSHAISNLDNINENVNASRSRIRDTDYAKETTQMTKSQILQQASTS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|153834456|ref|ZP_01987123.1| flagellar hook-associated protein 3 [Vibrio harveyi HY01]
 gi|148869152|gb|EDL68184.1| flagellar hook-associated protein 3 [Vibrio harveyi HY01]
          Length = 396

 Score =  147 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 45/396 (11%), Positives = 116/396 (29%), Gaps = 40/396 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             T IS+   ++ +    +          E++ +G+              I    Q++  
Sbjct: 1   MLTRISSFHNYQSVQNDLRRQENKVHHNQEQLASGKQLTKPSDDPLATHYIQSIGQQEEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L +  LV  RL   +  +++ ++ V +     + ++ G             L +  
Sbjct: 61  LRQYLDAIVLVRNRLENQEVVVANAEQFVDESKRISMEMINGAFSPEDRAAKKRELEEIA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+  AN  DE           +          S+     D   +  +  N +  +   
Sbjct: 121 NNFMALANSQDESGNYVFAGTKPKSQPFFRDYDGSVVYTGDDYQRKMKIASNIELGINYP 180

Query: 182 HLEVSSMNAQQMTDF-------------IKQLEDKFSDDEYWANNWSNASDHNIKYRIKD 228
              + +       DF             + Q  D+   D  +   + + S+    Y+++ 
Sbjct: 181 GNHLFTEIPNPFGDFEPQYDLQEGSELLLGQATDESKSDSNYKVTFVDMSNGKFGYQLEK 240

Query: 229 TEGIDV---------------------SANVNMRGIRDI------MFVAVIGTEFLSKNL 261
              I                         +       +               ++   ++
Sbjct: 241 DGSIVQVDDYSPIDGIQYEGVNIQLKGQVSAGDSITLEPRQTFSVFDAFKETMQWSESSV 300

Query: 262 TDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIG 321
           +D +      +M    Q     + + R  +G     ++ +    ++ N  +    S    
Sbjct: 301 SDASATAKLHQMTEEFQAAFVHMNKVRTDVGAKLSTLDIQEQNHEDFNLSLAKAKSNFED 360

Query: 322 VEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           ++   A  + S     ++ S     K + L++ NY+
Sbjct: 361 LDYSKAVIEFSENSRALQASQQAFGKTKDLTLFNYI 396


>gi|27363695|ref|NP_759223.1| flagellin [Vibrio vulnificus CMCP6]
 gi|27359811|gb|AAO08750.1| Flagellin protein flaE [Vibrio vulnificus CMCP6]
          Length = 375

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 32/366 (8%), Positives = 91/366 (24%), Gaps = 19/366 (5%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              ++T+                  +  + + +G   +      A +        +   +
Sbjct: 1   MVSLNTNVSAMVAQRHLSTAASQVAETQKNLSSGFRINSASDDAAGMQIANTLHVQTRGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
              L +         T++  L    +I+Q +    +    G   +         +    +
Sbjct: 61  DVALTNAHSAYAVAETAEGALEEGSEILQRLRSLSLQAANGSNSDEDRQSLQLEVVVLKD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                A  T          +   K  +     +S        M     E      LA + 
Sbjct: 121 EVERIARTTTFAGKNLFDGSYGSKSFHLGANSNS-ISLQLKNMRTHVPEMGGYHYLASEP 179

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
            +      ++         D   DD+    +              +++   V ++V    
Sbjct: 180 ADEDWQVDKESRQLSFTFRDSEGDDQSIKISLKPGDSLEEVATYINSQQNVVESSVTDDR 239

Query: 243 IRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSGI 284
                       + L+ + +                  D +     +  ++ V   +  +
Sbjct: 240 RLQFYVANRHAPDGLNISGSLEGELDFEPQGQVTLDELDISSVGGAQLAIAVVDTAIQYL 299

Query: 285 IEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMI 344
              R+ +G  +  +      LQ+ N  +     +    +   A   L       + +  +
Sbjct: 300 DSHRSEIGSFQNRVEGTMDNLQSINRNVTESKGRIWDTDFAKASTALVKSQVLQQATSAL 359

Query: 345 TTKLQK 350
             + ++
Sbjct: 360 LAQAKQ 365


>gi|260776495|ref|ZP_05885390.1| flagellin protein FlaF [Vibrio coralliilyticus ATCC BAA-450]
 gi|260607718|gb|EEX33983.1| flagellin protein FlaF [Vibrio coralliilyticus ATCC BAA-450]
          Length = 377

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 42/367 (11%), Positives = 103/367 (28%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G   +      A +      E +   
Sbjct: 1   MAITVNTNVSAMTAQRYLTNATDMLNQSLERLSSGNRINSAKDDAAGLQISNRLESQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  ++    ++Q M    +    G     +       +    
Sbjct: 61  LDVAMRNANDGISIMQTAEGAMNETTNLLQRMRDLSLQSANGSNSRAERDALQEEMAALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       + +        +     + S   M    +E    S +A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFASSSFQIGGSSGEAVQVSLKNMRSDSIEMGGFSYIAAG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +   +Q     + +  +     E          D        + +   VSA+VN  
Sbjct: 181 KADNNWQVSQGSQTLVMEYTNAEGQQESIQIEAKAGDDIEELATYINGQTDKVSASVNED 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  +S + +                  D ++    ++ +S +   L  
Sbjct: 241 GQLQVFMAGKETSGTISFSGSLAGELQMGLAGYEAVDNLDISKVGGAQRAVSVIDTALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  +    S+    +      Q+       ++S  
Sbjct: 301 VDGHRAELGAMQNRFNHAINNLGNINENLAASNSRIKDTDYAKETTQMLKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|323496565|ref|ZP_08101619.1| flagellin [Vibrio sinaloensis DSM 21326]
 gi|323318409|gb|EGA71366.1| flagellin [Vibrio sinaloensis DSM 21326]
          Length = 377

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 43/367 (11%), Positives = 100/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+              +   K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRHLNGAAEGMQKSMERLSSGYKINSARDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDMAVKNANDGISIAQTAEGAMNESTNILQRMRDLALQSSNGSNSRSERIAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +      +     + S   M     E   K+ +A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYGSQSFQIGASSGEAVQLSMGNMRSDTAEMGGKAYVAEE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S   +   TD      D   +++    N     D        + +  DV A+V   
Sbjct: 181 GKDASWTVSAGSTDLTLGYTDVHGEEKELTINAKVGDDIEQVATYINGQSDDVKASVGED 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +   +      +                       D      ++  +S +   L  
Sbjct: 241 GKLQLFAASNKVATDVDIGGGLGGEIGFGDAQSKTVADVDVTSVAGSQMAVSIIDGALKN 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +         L N N  ++   S+ +  +       ++      + S  
Sbjct: 301 VDSQRADLGAFQNRFGHAINNLDNINENVNASRSRILDTDFAKETTAMTKSQILQQASTS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|37679159|ref|NP_933768.1| flagellin [Vibrio vulnificus YJ016]
 gi|37197901|dbj|BAC93739.1| polar flagellin FlaE [Vibrio vulnificus YJ016]
          Length = 375

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 32/366 (8%), Positives = 91/366 (24%), Gaps = 19/366 (5%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              ++T+                  +  + + +G   +      A +        +   +
Sbjct: 1   MVSLNTNVSAMVAQRHLSTAASQVAETQKNLSSGFRINSASDDAAGMQIANTLHVQTRGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
              L +         T++  L    +I+Q +    +    G   +         +    +
Sbjct: 61  DVALTNAHSAYAVAETAEGALEEGSEILQRLRSLSLQAANGSNSDEDRQSLQLEVVVLKD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                A  T          +   K  +     +S        M     E      LA + 
Sbjct: 121 EVERIARTTTFAGKNLFDGSYGSKSFHLGANSNS-ISLQLKNMRTHIPEMGGYHYLASEP 179

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
            +      ++         D   DD+    +              +++   V ++V    
Sbjct: 180 ADEDWQVDKESRQLSFTFRDSEGDDQSIKISLKPGDSLEEVATYINSQQNVVESSVTDDR 239

Query: 243 IRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSGI 284
                       + L+ + +                  D +     +  ++ V   +  +
Sbjct: 240 RLQFYVANRHAPDGLNISGSLEGELDFEPQGQVTLDELDISSVGGAQLAIAVVDTAIQYL 299

Query: 285 IEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMI 344
              R+ +G  +  +      LQ+ N  +     +    +   A   L       + +  +
Sbjct: 300 DSHRSEIGSFQNRVEGTMDNLQSINRNVTESKGRIWDTDFAKASTALVKSQVLQQATSAL 359

Query: 345 TTKLQK 350
             + ++
Sbjct: 360 LAQAKQ 365


>gi|218710261|ref|YP_002417882.1| flagellin [Vibrio splendidus LGP32]
 gi|218323280|emb|CAV19457.1| Bacterial flagellin N-terminus [Vibrio splendidus LGP32]
          Length = 377

 Score =  146 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 43/367 (11%), Positives = 102/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T++            N    +  E + +G   +      A +      E + + 
Sbjct: 1   MAITVNTNASALVAQRNLSNANNMLNQSLERLASGSRINSAKDDAAGLQISNRLEAQMSG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           I   + + +     + T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  IDVAVRNANDGISIMQTAEGAMNETTNIMQRMRDLSLQATNGSNGQSERTAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +          +     +     M    +     S +A  
Sbjct: 121 DELNRIAETTSFGGKKLLNGSFGSSSFQIGGSSGEAVQIGLKNMRTDDINMGGFSYVANG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
               S       TD      D+F   +    N     D        + +   VSA+VN  
Sbjct: 181 MASDSWEVKSNQTDMTMAFTDRFGQPQEININAKAGDDIEELATYINGQTDLVSASVNDE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   I          +S + +                  +       ++ +S +   +  
Sbjct: 241 GQLQIYMSGEDTAGTISFSGSLASELSMSAGYYESVDDINVTDVGGAQRAVSILDTAMKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   R+ LG  +   +     L+N +  +    S+    +      Q+       ++S  
Sbjct: 301 VDSHRSELGAMQNRFDHAINNLENVHENLGASNSRIKDTDYAKETTQMLKQQILQQVSTT 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|332798838|ref|YP_004460337.1| flagellin domain-containing protein [Tepidanaerobacter sp. Re1]
 gi|332696573|gb|AEE91030.1| flagellin domain protein [Tepidanaerobacter sp. Re1]
          Length = 366

 Score =  146 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 33/355 (9%), Positives = 94/355 (26%), Gaps = 9/355 (2%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + +    +      N +  K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINNNIMALNTHRQLSINNTNVQKSLEKLSSGYRINRAGDDAAGLAISEKMRAQIRGLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               +       + T++  L+ +  I+Q M    V       +          L      
Sbjct: 61  MASKNAQDGISLIQTAEGALTEVHSILQRMRELAVQAANDTNETVDRDAVQEELAQLQSE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A+ T   Q      + +    +   +  +    S  ++      + S  +      
Sbjct: 121 ITRIADTTQFNQKKLLNGSLNANVTDIGASLTAANGISNIKITGAAAGDYSIEVNTTDST 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASD---------HNIKYRIKDTEGIDV 234
              S      T     +   F   +    +                + ++ +  T  I +
Sbjct: 181 ITLSDGTDSQTINYGSVPSDFETKDVTFGSLGITVTINSQIADISADNEFTVDATGQISL 240

Query: 235 SANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGIS 294
               N      I    +    F        +     +  ++ +   +S +  +R+ LG  
Sbjct: 241 MIGANEGENMTISIGDMRADAFTGLTSISVSDATAAEAAVTVINDAISKVSTERSKLGAY 300

Query: 295 EKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQ 349
           +  +      L      + +  S+   V+      + +      + +  +  +  
Sbjct: 301 QNRLEHTINNLDTSAENLQSAESRIRDVDMAKEMMEFTKQNILTQAATAMLAQAN 355


>gi|134095090|ref|YP_001100165.1| putative flagellar hook-associated protein 3 [Herminiimonas
           arsenicoxydans]
 gi|133738993|emb|CAL62041.1| putative flagellar hook-associated protein 3 FlgL-like
           [Herminiimonas arsenicoxydans]
          Length = 403

 Score =  146 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 56/402 (13%), Positives = 113/402 (28%), Gaps = 48/402 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST++IFE  +    +L    +K  +++ T +             + L  EQ  +   
Sbjct: 1   MRISTNTIFEMGSGKIGDLQAAMLKTQQQISTNRRILAPSDDPVAAAAALGMEQAISIND 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       LS  ++ L S+  ++Q +   ++    G  D+ +  + A  LR +++ 
Sbjct: 61  QLATNRLSAKAALSEEESILQSVTLLLQSVKDIVISAGNGALDDVQRQMFATQLRGNFDE 120

Query: 124 FVTFANMTDEGQYLFSGI-NSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
            +  AN  D       G   SS  P     T          +MLQ        S  +G  
Sbjct: 121 LMGLANTRDSNGNYIFGGFQSSSPPFMQSATGADYTGDQGQRMLQVGPARQLASGDSGSA 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWS--------------------------- 215
           +    +           L +  +      +                              
Sbjct: 181 VFEGGVTGNGRFVTAAGLGNTGTGIVSMGSVSDLTQLTGLAYDVTFSVDAITGETTYLVN 240

Query: 216 --------------------NASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTE 255
                                    +IK +  D +   V  + N      I  +    + 
Sbjct: 241 EPPPATPTPQLYVSGDPIEIGGMRFDIKGKPADGDTFSVKPSTNQSVFTTITDLLTTLST 300

Query: 256 FLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTY 315
                              + +   L  I   R  +G   K I+       +        
Sbjct: 301 SAVGPTGQTRLANGLASANTNIANVLDNISTVRTSVGARLKEIDNLDSAGADLKLQYTKT 360

Query: 316 ISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +S    ++   A+++ +     +E +     K+  LS+ N L
Sbjct: 361 LSDLQDIDPVEAYSRFTQQQFTLEAARQSFIKISGLSLFNML 402


>gi|84388101|ref|ZP_00990997.1| polar flagellin D [Vibrio splendidus 12B01]
 gi|84377168|gb|EAP94038.1| polar flagellin D [Vibrio splendidus 12B01]
          Length = 377

 Score =  146 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 90/367 (24%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLASGSKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSSNGSNSKSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K                  M     +   KS     
Sbjct: 121 DELNRIAETTSFGGNKLLNGTHGTKSFQIGADNGEAVMLQLKDMRSDNAQMGGKSYQTEN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D      D F   +    +     D        + +   V A+V   
Sbjct: 181 AKDKDWNVQAGANDLKMSFTDNFGQAQEIDVSAKAGDDIEELATYINGQQDSVKASVTED 240

Query: 242 GIRDIMFVAVI------------------GTEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +                          + ++ +  D       ++ ++ +   L  
Sbjct: 241 GKLQMFTGNNKVEGEVAFSGSLAGELGMQPGKDVTVDTIDVTSVGGAQESVAVIDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   +     L N N  ++   S+    +      Q++      + S  
Sbjct: 301 VDSHRAELGAFQNRFDHAISNLDNINENVNASKSRIKDTDFAKETTQMTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|119434396|gb|ABL75271.1| flagellin [Vibrio alginolyticus]
          Length = 376

 Score =  146 bits (367), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 100/367 (27%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+           +      K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNQAADGQQKSMERLSSGYKINSAKDDAAGLQISNRLNAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +        ++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDMAVKNANDGISIAQVAEGAMNESTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +              S   +         KS  A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYGTQSFQIGADSGEAVMLSMGNLRSDTSAMGGKSYAAEE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S     + T+F     +K  +++  + +     D        + +  DV A+V   
Sbjct: 181 GKDASW-TVGEKTEFKMSYTNKQGEEKELSISAKQGDDIEQLATYINGQNDDVKASVGED 239

Query: 242 GIRDIMFVAVIG------------------TEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +   +                      + ++    D      +++ ++ +   L  
Sbjct: 240 GKLQVFASSQKVEGDVEFSGNLADEIGFGGPKDVTVKDIDVTTVAGSQEAVAVIDGALKS 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +   N     L N N  ++   S+    +       ++      + S  
Sbjct: 300 VDSQRASLGAFQNRFNHAISNLDNINENVNASKSRIKDTDYAKETTAMTKSQILQQASTS 359

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 360 ILAQAKQ 366


>gi|45659267|ref|YP_003353.1| flagellar hook-associated protein FlgL [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
 gi|45602513|gb|AAS71990.1| flagellar hook-associated protein 2 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 422

 Score =  146 bits (367), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 46/421 (10%), Positives = 111/421 (26%), Gaps = 66/421 (15%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              I+       +         +  +   ++ TGQ          R T+ + +    N +
Sbjct: 1   MMRITNMMQNNSLIHNLNRHQLNMDETQNQLSTGQRIRLPSDEPGRATNQMFFRSRLNEL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINA----GMLR 118
                +      RL      L  +  + Q      V    G    +K           + 
Sbjct: 61  ETFQRNIDDGNSRLQQIDGELDRIGSLFQRARVLAVQASNGIYQGDKGFELEVAVGKEID 120

Query: 119 DSYESFVTFANMTDEGQYLFSGINSSEKPLN----------------------------- 149
           +   + V  AN  D       G +  E+P                               
Sbjct: 121 EILRALVDIANTRDATGRPLFGGHVIERPPFEPIESKIKGLQGIELKNQYIGVEYRGDIG 180

Query: 150 -------------------GYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNA 190
                                F   +++  S        +  + K  + G  + VS+ + 
Sbjct: 181 EQLREIEKGEYVPVTIPGNKVFWGTNMSITSKVDNSGYVVSSDQKFKIDGVEIHVSAGDT 240

Query: 191 QQMTDFIKQLED---KFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIM 247
                          K +       + S+ + H I     +   I     +      +  
Sbjct: 241 IDDIIDKINNSPLEVKANKLAQDNISLSSTAPHQIWMEDVEGGTILRDIGLVDSATSEPP 300

Query: 248 FVAVIGTEFLSKNLTDG-----------ARNVLTKKMLSTVQQGLSGIIEQRAVLGISEK 296
                       ++ D             +  ++ + L  +   +  I+  RA++G    
Sbjct: 301 NNYSKSATVTGLSVFDVMIQFRNDLIQKDQERISGRDLQDLDLAMENILRYRAIVGARMN 360

Query: 297 NINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNY 356
            + E    +    + +   +SK+ G++       +  L    + +  + +K+ K +++++
Sbjct: 361 RMEEHAQRVDFDKSYMTELLSKNEGIDFPETIMNMKWLETVHQYALNVGSKIIKPTLMDF 420

Query: 357 L 357
           L
Sbjct: 421 L 421


>gi|294636856|ref|ZP_06715189.1| flagellin [Edwardsiella tarda ATCC 23685]
 gi|291089931|gb|EFE22492.1| flagellin [Edwardsiella tarda ATCC 23685]
          Length = 350

 Score =  146 bits (367), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 35/351 (9%), Positives = 96/351 (27%), Gaps = 9/351 (2%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+         +         E + +G   +      A       +    N 
Sbjct: 1   MAQVINTNSLSLMAQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAISNRFTANING 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q++    V    G   ++        +    
Sbjct: 61  LTQASRNANDGISLAQTTEGALNEVNNNLQNIRRLSVQAQNGSNSSSDLQSIQDEITQRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  TD         +       G    +++     +   +    +       G 
Sbjct: 121 DEIDRISQQTDFNGVKVLSKDQKLTIQVGANDGETIDIDLKNINAKTLGLDKFDVTAPGT 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            +  +      +       + KF      A +   +            + +        +
Sbjct: 181 RIGDAVAAGDVIGKKADGSDLKFDAAGLAAGSTLVSGTDKDGNAGYYIKTVAAGGATTYK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
                        +  +   T GA     K  L+T+ + LS + + R+ LG  +   +  
Sbjct: 241 VATI---------DKTTGKATPGADVTDVKTPLATLDKALSQVDQLRSGLGAVQNRFDSV 291

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLS 352
              L +  N +    S+    +  T  + +S      +    +  +  + +
Sbjct: 292 INNLNSTVNNLSASRSRIQDADYATEVSNMSRAQILQQAGTSVLAQANQST 342


>gi|260767715|ref|ZP_05876650.1| flagellin B [Vibrio furnissii CIP 102972]
 gi|260617224|gb|EEX42408.1| flagellin B [Vibrio furnissii CIP 102972]
 gi|315179453|gb|ADT86367.1| flagellin [Vibrio furnissii NCTC 11218]
          Length = 376

 Score =  146 bits (367), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 93/367 (25%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+                  K  E + +G   +      A +        +   
Sbjct: 1   MAINVSTNVSAMTAQRYLNGAADGVQKSMERLSSGYRINSAKDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDMAVRNANDGISIAQTAEGAMNESTNILQRMRDLALQSSNGSNSRSERVAIQEEVSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K              +   M         KS  A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFGSKSFQIGADSGEAVNLTMGNMRSDNAAMGGKSYRAQE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
               +        D      DK  +         +  D        + +  DV A+V   
Sbjct: 181 GK-AADWTVGDAKDLTLNYTDKQGEARELTITAKSGDDLEEVATYINGQSDDVKASVGED 239

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +   +   T  ++                      D      +++ ++ +   L  
Sbjct: 240 GKLQLFASSQKVTGDVTIGGDLGSEIGFGAAQEVTVKDIDVTSVAGSQEAVAVLDGALKS 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +         L N N  ++   S+    +       ++      + S  
Sbjct: 300 VDSQRASLGAFQNRFGHAISNLDNINENVNASRSRIKDTDYARETTAMTKSQILQQASTS 359

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 360 VLAQAKQ 366


>gi|78485805|ref|YP_391730.1| flagellin-like [Thiomicrospira crunogena XCL-2]
 gi|78364091|gb|ABB42056.1| Flagellar hook-associated protein FlgL [Thiomicrospira crunogena
           XCL-2]
          Length = 341

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 35/354 (9%), Positives = 109/354 (30%), Gaps = 14/354 (3%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +S++    +     ++     + + E++ TG   +         + I    +  N I+
Sbjct: 1   MRVSSNQFHMQSFSAIEKHQNSVLDIQEKLTTGNRVNRPSDDPIATSQIHSLNKAVNTIS 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +      +LS  ++ +S+   + Q      + ++ G          A  +    + 
Sbjct: 61  QFEKNGEFAKSQLSLEESQISTAVDLTQRARELSIQMMNGTYTAEDRQATAQEIGQIIKH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N  +  + L    N+ +          +            ++   +         
Sbjct: 121 LTGIMNSNNSEEELLFAGNNVDAAAAFVVDPANSGALQPGNEYYAYIGSANAGAQFDNR- 179

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
             ++  ++ +       +    DD+  ++      +    + I        +        
Sbjct: 180 --ANFGSRFVQIGFDNDQTAAPDDKGDSSRVRITDNGAKVFNIPGGATSLPA-------- 229

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                   +    +    +    N     +   +   + G+ +Q+A +G  +  I  +  
Sbjct: 230 ---GVDPNLLNVLVGLKDSLDQGNPPPDAVADDLLSAVKGLSKQQAEIGSRQNRIQTQFE 286

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             Q  +  +         ++     +QL+   N ++M+  + +K+Q +S+ +YL
Sbjct: 287 AGQTFSMALQERRVNIEEMDVVEGISQLNMRQNALQMAQQVFSKVQGMSLFDYL 340


>gi|269961606|ref|ZP_06175968.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269833647|gb|EEZ87744.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 396

 Score =  145 bits (366), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 44/396 (11%), Positives = 113/396 (28%), Gaps = 40/396 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             T IS+   ++ +    +          E++ +G+              I    Q++  
Sbjct: 1   MLTRISSFHNYQSVQNDLRRQENKVHHNQEQLASGKQLTKPSDDPLATHYIQSIGQQEEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L +  LV  RL   +  +++ ++   +     + ++ G             L +  
Sbjct: 61  LKQYLDAIVLVRNRLENQEVVIANAEQFTDESKRISMEMINGAFSPEDRAAKKRELEEIA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+   N  DE           +          S+     D   +  +  N +  +   
Sbjct: 121 NNFLALVNTQDESGNYVFAGTKPKSQPFFRDYDGSVVYTGDDYQRKMKIASNIELGINYP 180

Query: 182 HLEVSSMNAQQMTDF-------------IKQLEDKFSDDEYWANNWSNASDHNIKYRIKD 228
              + S       DF             + Q      D+  +   + + S+    Y+++ 
Sbjct: 181 GNHLFSEIPNPFGDFEPQYDLQEGSELLLGQATSASEDNSNYKVTFVDMSNGKFGYQLEK 240

Query: 229 TEGIDV---------------------SANVNMRGIRDI------MFVAVIGTEFLSKNL 261
              I                         +       +               ++   ++
Sbjct: 241 DGSIVQVDDYSPIDGIQYEGINIQLKGQVSAGDSITLEPRQTFSVFDAFKETMQWSESSV 300

Query: 262 TDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIG 321
           +D +      +M    Q     + + R  LG     ++ +    ++ N  +    S    
Sbjct: 301 SDASATAKLHQMTEEFQAAFVHMNKVRTDLGAKLSTLDIQEQNHEDFNLSLAKAKSNFED 360

Query: 322 VEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           ++   A  + S     ++ S     K + L++ NY+
Sbjct: 361 LDYSKAVIEFSENSRALQASQQAFGKTKDLTLFNYI 396


>gi|84389710|ref|ZP_00991262.1| flagellin [Vibrio splendidus 12B01]
 gi|84376811|gb|EAP93685.1| flagellin [Vibrio splendidus 12B01]
          Length = 377

 Score =  145 bits (366), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 43/367 (11%), Positives = 102/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N    +  E + +G   +      A +      E + + 
Sbjct: 1   MAITVNTNVSALVAQRNLSNANNMLNQSLERLASGSRINSAKDDAAGLQISNRLEAQMSG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           I   + + +     + T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  IDVAVRNANDGISIMQTAEGAMNETTNIMQRMRDLSLQASNGSNSQSERTAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +          +     +     M    +     S +A  
Sbjct: 121 DELNRIAETTSFGGKKLLNGSFGSSSFQIGGSSGEAVQIGLKNMRTDDINMGGFSYVANG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
               S        D      D+F   +    N     D        +++   VSA+VN  
Sbjct: 181 MASDSWEVTPDQNDMTMSFTDRFGQPQELTINAKEGDDIEELATYINSQTDLVSASVNDE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   I          +S + +                  +       ++ +S +   +  
Sbjct: 241 GQLQIYMSGEDTAGTISFSGSLASELSMSAGYYESVDDINVTNVGGAQRAVSILDTAMKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   R+ LG  +   +     L+N +  + T  S+    +      Q+       ++S  
Sbjct: 301 VDSHRSELGAMQNRFDHAINNLENVHENLATSNSRIKDTDYAKETTQMLKQQILQQVSTT 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|260774945|ref|ZP_05883846.1| flagellar hook-associated protein FlgL [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260609200|gb|EEX35358.1| flagellar hook-associated protein FlgL [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 397

 Score =  145 bits (366), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 35/397 (8%), Positives = 107/397 (26%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +           ++ +G+              I    Q+K  
Sbjct: 1   MMNRISSFHNYQSVQNDLRRQEAKVHHNQAQLASGKKLMRASDDPLATHYIQNIGQQKEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   +  L   RL   +  +S+ ++   +    ++ ++ G             L +  
Sbjct: 61  LRQFTDAIVLSRNRLEHHEVIISNAEQYADEAKRTVMEMINGSLSPEDRIAKRRELLEIS 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+  +N+ DE           +           +     D   +  +  + +  +   
Sbjct: 121 NNFLNLSNVQDESGNYIFAGTKPKNQPFFRDKDGDVVYAGDDYQRKMKISNSLEMPINDP 180

Query: 182 HLEVSSMNAQQMTDFIK--------------QLEDKFSDDEYWANNWSNASDHNIKYRIK 227
             ++         DF                 +     D   +   + +  D N  Y+++
Sbjct: 181 GSKLFMEIDNPYGDFEPQYDLKGVSELLLERAINTNPDDQSTYKVTFVDMPDGNYGYQLE 240

Query: 228 DTEGIDVSANVNMRGIR---------------------------DIMFVAVIGTEFLSKN 260
               +  + N +                                 I        +    +
Sbjct: 241 RDGAVVKADNFDPAIGIKFEDVTIQVKGQITKGDAITLEPRKTYSIFDTFKQAMKLAEGS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      ++          + + R  +G     ++ +     +    +    S   
Sbjct: 301 VSDTSNTAELHQITQEFHAAFIHLNKARTDVGARLNTLDIQEEQHDDFKMTLAKSKSNFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + +     ++ S     K + L++ NY+
Sbjct: 361 DLDYADAIIEFNENSRALQASQQAFGKTKDLTLFNYI 397


>gi|238920297|ref|YP_002933812.1| flagellin [Edwardsiella ictaluri 93-146]
 gi|182342507|gb|ACB87392.1| flagellin 2 [Edwardsiella ictaluri]
 gi|238869866|gb|ACR69577.1| flagellin [Edwardsiella ictaluri 93-146]
          Length = 347

 Score =  145 bits (366), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 37/348 (10%), Positives = 92/348 (26%), Gaps = 12/348 (3%)

Query: 5   GISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAE 64
            I+T+ +         +         E + +G   +      A       +    N + +
Sbjct: 4   VINTNILSLEAQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANRFTANINGLTQ 63

Query: 65  RLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESF 124
              + +       T++  L+ +   +Q++    V    G    +        +    +  
Sbjct: 64  ASRNANDGISLAQTTEGALNEVNDNLQNIRRLAVQAQNGTNSESDLQSIQDEITQRLDEI 123

Query: 125 VTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLE 184
              +  TD         + S     G     ++               +   +  G  + 
Sbjct: 124 NRISAQTDFNGVKVLSKDQSLTIQVGADDGQTIGINLRKMDAGTLGLSSFSVMTKGTRVG 183

Query: 185 VSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIR 244
            +      +T                      ++     Y IK+T+      +     I 
Sbjct: 184 DAVSVGTMVTPTAGGKMVAVKAPAAGTLVSGTSAAGQAGYYIKNTDAKTGVVSYTSATIG 243

Query: 245 DIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVF 304
               VAV                   +  L+T+ + LS + + R+ LG  +   +     
Sbjct: 244 ADGSVAVGKPV------------TDLQTPLATLDKALSQVDDLRSGLGAVQNRFDSVISN 291

Query: 305 LQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLS 352
           L +    +    S+    +  T  + +S      +    +  K  + +
Sbjct: 292 LDSTVTNLSASRSRIQDADYATEVSDMSRAQILQQAGTAVLAKANQST 339


>gi|209695752|ref|YP_002263682.1| flagellin [Aliivibrio salmonicida LFI1238]
 gi|208009705|emb|CAQ80009.1| flagellin subunit B [Aliivibrio salmonicida LFI1238]
          Length = 377

 Score =  145 bits (366), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 37/367 (10%), Positives = 97/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  ++T+           +      +  E + +G+  +      A +      + + + 
Sbjct: 1   MSVTVNTNVSAMTAQRYLNQATDHLNQSMERLSSGKRINSAKDDAAGLQISNRLQAQMSG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G                  
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNESTNILQRMRDLALQSSNGSNALQDRQAIQEESDALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G                        + +   M    L     +  +  
Sbjct: 121 DELNRIAETTSFGGRRLLNGQFGTSTFQIGANAGEAVQLTLGSMRSDTLAMGGFNYTSQN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            L       +          DK    +          D        + +   V A+V+  
Sbjct: 181 QLNKGWTVPEGRQTLTLSFNDKEGKAQEITIEAKAGDDIEELATYINGQNDTVQASVDDN 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +     + +  ++   T                  D      ++K ++T+   L  
Sbjct: 241 GQLQLFTAGDLVSSAVTFGGTLSAELAVGGAVFDTVNDLDLTSVGGSQKAIATLDAALGF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           + ++RA LG  +         L N +  I +  S+    +      ++       ++S  
Sbjct: 301 VDQERATLGAFQNRFGHAINNLNNIHENIASSNSRIEDTDFAKETVEMMKAQILQQVSST 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|148979884|ref|ZP_01815762.1| flagellin [Vibrionales bacterium SWAT-3]
 gi|145961576|gb|EDK26877.1| flagellin [Vibrionales bacterium SWAT-3]
          Length = 377

 Score =  145 bits (366), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 44/367 (11%), Positives = 102/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N    +  E + +G   +      A +      E + + 
Sbjct: 1   MAITVNTNVSALVAQRNLSNANNMLNQSLERLASGSRINSAKDDAAGLQISNRLEAQMSG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           I   + + +     + T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  IDVAVRNANDGISIMQTAEGAMNETTNIMQRMRDLSLQASNGSNSQSERTAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       N          +     +     M    +     S +A  
Sbjct: 121 DELNRIAETTSFGGKKLLNGNFGSTSFQIGGSSGEAVQIGLKSMRTDDINMGGFSYVANG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
               S        D      D+F   +    N     D        + +   VSA+VN  
Sbjct: 181 MASDSWAVKSNQNDMTMSFTDRFGQPQEITINAKVGDDIEELATYINGQTDLVSASVNDD 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   I       +  +S + +                  +       ++ +S +   +  
Sbjct: 241 GQLQIYMSGEDTSGTISFSGSLASELSMSAGYYESVNDINVTDVGGAQRAVSILDTAMKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   R+ LG  +   +     L+N +  + T  S+    +      Q+       ++S  
Sbjct: 301 VDSHRSELGAMQNRFDHAINNLENVHENLATSNSRIKDTDYAKETTQMLKQQILQQVSTT 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|189164103|gb|ABU96039.2| flagellin [Bacillus thuringiensis serovar galleriae]
 gi|189164107|gb|ABU96040.2| flagellin [Bacillus thuringiensis serovar galleriae]
 gi|189339425|gb|ABD33701.2| flagellin [Bacillus thuringiensis serovar galleriae]
          Length = 397

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 32/354 (9%), Positives = 93/354 (26%), Gaps = 7/354 (1%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +         ++ + 
Sbjct: 34  MRINTNINSMRTQEYMRQNQAKMSNAMDRLSSGKRINNASDDAAGLAIATRMRARESGLG 93

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       + T+ + ++S+  I+  M         G   N              E 
Sbjct: 94  VAANNTQDGISLIRTADSAMNSVSNILLRMRDLANQSANGTNTNENQAALNKEFDALKEQ 153

Query: 124 FVTFANMTDEGQYLFSGINSSE---KPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
               +  T+         ++     + L+   T   +     +   +             
Sbjct: 154 IDYISTNTEFNDKKLLDGSNKTIAVQTLDNADTSKQININLSNVSTKELGLSTLSIGTDK 213

Query: 181 QHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDT----EGIDVSA 236
               V     +   D   +     +             D    +   D     E      
Sbjct: 214 VEKTVYDATTKAFADLGAKTGTDKAAFAADVTAAMKEFDKVKPFMSADDVKKIETKLEDY 273

Query: 237 NVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEK 296
           N       +    A+         L            ++++   L  I   RA LG +  
Sbjct: 274 NKANDAGAEAAAQALGKEFATLTKLETTDLKANASGAIASIDTALKNIASNRATLGATLN 333

Query: 297 NINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            ++     L+++++ + +  S+    +     ++++      E    + ++  +
Sbjct: 334 RLDFNVNNLKSQSSSMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQ 387


>gi|163801835|ref|ZP_02195732.1| flagellin [Vibrio sp. AND4]
 gi|163802594|ref|ZP_02196486.1| flagellin [Vibrio sp. AND4]
 gi|159173677|gb|EDP58496.1| flagellin [Vibrio sp. AND4]
 gi|159174343|gb|EDP59147.1| flagellin [Vibrio sp. AND4]
          Length = 377

 Score =  145 bits (365), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 93/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K                  M     +   +S     
Sbjct: 121 DELNRIAETTSFGGNKLLNGTHGTKSFQIGADNGEAVMLELKDMRSDNAQMGGQSYQTES 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +    +   D      D F  ++          D        + +   V A+V   
Sbjct: 181 AKDKNWNVQEGSNDLKMTFTDNFGQEQEIDITAKAGDDIEELATYINGQQDSVKASVTED 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +       T                  + ++ +  D       ++ ++ +   L  
Sbjct: 241 GKLQMFAGNNKVTGNVDFSGGLAGELDIQDGKEVTVDTIDVTSVGGAQESVAIIDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   +     L N N  ++   S+    +      Q++      + S  
Sbjct: 301 VDSNRAELGAFQNRFDHAINNLDNINENVNASKSRIKDTDFAKETTQMTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|294828508|ref|NP_714488.2| flagellar hook-associated protein FlgL [Leptospira interrogans
           serovar Lai str. 56601]
 gi|293386361|gb|AAN51506.2| flagellar hook-associated protein FlgL [Leptospira interrogans
           serovar Lai str. 56601]
          Length = 421

 Score =  145 bits (365), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 46/420 (10%), Positives = 111/420 (26%), Gaps = 66/420 (15%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+       +         +  +   ++ TGQ          R T+ + +    N + 
Sbjct: 1   MRITNMMQNNSLIHNLNRHQLNMDETQNQLSTGQRIRLPSDEPGRATNQMFFRSRLNELE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINA----GMLRD 119
               +      RL      L  +  + Q      V    G    +K           + +
Sbjct: 61  TFQRNIDDGNSRLQQIDGELDRIGSLFQRARVLAVQASNGIYQGDKGFELEVAVGKEIDE 120

Query: 120 SYESFVTFANMTDEGQYLFSGINSSEKPLN------------------------------ 149
              + V  AN  D       G +  E+P                                
Sbjct: 121 ILRALVDIANTRDATGRPLFGGHVIERPPFEPIESKIKGLQGIELKNQYIGVEYRGDIGE 180

Query: 150 ------------------GYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQ 191
                               F   +++  S        +  + K  + G  + VS+ +  
Sbjct: 181 QLREIEKGEYVPVTIPGNKVFWGTNMSITSKVDNSGYVVSSDQKFKIDGVEIHVSAGDTI 240

Query: 192 QMTDFIKQLED---KFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMF 248
                         K +       + S+ + H I     +   I     +      +   
Sbjct: 241 DDIIDKINNSPLEVKANKLAQDNISLSSTAPHQIWMEDVEGGTILRDIGLVDSATSEPPN 300

Query: 249 VAVIGTEFLSKNLTDG-----------ARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKN 297
                      ++ D             +  ++ + L  +   +  I+  RA++G     
Sbjct: 301 NYSKSATVTGLSVFDVMIQFRNDLIQKDQERISGRDLQDLDLAMENILRYRAIVGARMNR 360

Query: 298 INEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           + E    +    + +   +SK+ G++       +  L    + +  + +K+ K +++++L
Sbjct: 361 MEEHAQRVDFDKSYMTELLSKNEGIDFPETIMNMKWLETVHQYALNVGSKIIKPTLMDFL 420


>gi|327484671|gb|AEA79078.1| Flagellin protein FlaD [Vibrio cholerae LMA3894-4]
          Length = 377

 Score =  145 bits (365), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 42/367 (11%), Positives = 94/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRYLTGATNAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         S K              +   M          S +A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFSTKSFQIGADNGEAVMLTLKDMRSDNRMMGGTSYVAAE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D    L+D   +D+    N     D        + +  DV A+V   
Sbjct: 181 GKDKDWKVQAGANDITFTLKDIDGNDQTITVNAKEGDDIEEVATYINGQTEDVKASVGED 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +       T                     + +  D       ++ ++ +   L  
Sbjct: 241 GKLQLFAGNNKVTGDVAFSGGLAGALNMQAGTAETVDTIDVTSVGGAQQSVAVIDSALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTALTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|86146146|ref|ZP_01064472.1| flagellin [Vibrio sp. MED222]
 gi|85836093|gb|EAQ54225.1| flagellin [Vibrio sp. MED222]
          Length = 388

 Score =  145 bits (365), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 37/378 (9%), Positives = 90/378 (23%), Gaps = 29/378 (7%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNSANSAQQTSMERLSSGSKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G             +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETSNILQRMRDLSLQSTNGSNTKADRVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K                  M     +    S    +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTHGTKSFQIGADNGEAVMLQLKDMRSDNDQMGGNSYQFTE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D    L+D F D      +     D        + +   V A+++  
Sbjct: 181 AKGKDWGVTAGANDLTMSLKDSFGDQREINISAKAGDDIEELATYINGQQDLVKASIDEE 240

Query: 242 G-----------------------------IRDIMFVAVIGTEFLSKNLTDGARNVLTKK 272
           G                                      +  + ++ +  D       ++
Sbjct: 241 GKLQIFAGNNKVDGEIAFSGALSDELGMTAGAKPEDPKTLEAKQVTVDSIDVTSVGGAQE 300

Query: 273 MLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLS 332
            ++ +   L  +   R+ LG  +   +     L N N  ++   S+    +      Q++
Sbjct: 301 SVAVIDAALKYVDSHRSELGAFQNRFDHAINNLDNINENVNASKSRIKDTDFAKETTQMT 360

Query: 333 TLINKIEMSYMITTKLQK 350
                 + S  I  + ++
Sbjct: 361 KSQILSQASSSILAQAKQ 378


>gi|319787114|ref|YP_004146589.1| flagellar hook-associated protein 3 [Pseudoxanthomonas suwonensis
           11-1]
 gi|317465626|gb|ADV27358.1| flagellar hook-associated protein 3 [Pseudoxanthomonas suwonensis
           11-1]
          Length = 400

 Score =  145 bits (365), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 48/399 (12%), Positives = 113/399 (28%), Gaps = 43/399 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  ISTS ++++         K    L +++ TG+ +           + +  ++    
Sbjct: 1   MSNRISTSMMYDQSLATMLSRQKQLASLQQQIATGRKTVTAKDDPVGAGAAVGLDRSLAE 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +     + + +  RL   +  L+     +  +    V        ++     A  LR   
Sbjct: 61  LERFGLNANNINNRLGMQENVLALAGDDMIRINELAVQANSDTLSDDDRRSIAAELRSLR 120

Query: 122 ESFVTFANMTDEGQ-YLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
           E  V+ AN +D    YLF+G      P        +       +M++       K  L G
Sbjct: 121 EHLVSLANSSDGTGRYLFAGAADDVAPFGRVAGGIAYNGDQTQRMVEIAPGTFVKDTLPG 180

Query: 181 QHLEVSSMNAQQMTDFIKQLED-------------------------------------- 202
             + +         D      +                                      
Sbjct: 181 SEVFMRVRTGDGTVDARMDPANTGSMILEGFSRSPAGGWEGAGYRVEFTGDNTYSVTDHA 240

Query: 203 ----KFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLS 258
                        +         I     + + +++           +  +A        
Sbjct: 241 GNPIASGTWTAKQDIEFAGLRVRISGTPAEGDALEIGPAGTRDIFATVEALASALESPTV 300

Query: 259 KNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISK 318
               + AR    +  +  V +    +I+ RA+ G     I++     +  +  + T +S 
Sbjct: 301 TIADNAARRNALQAGMRDVARAAEQLIDARALGGAQLALIDDAGALREANSVTLKTTLSA 360

Query: 319 SIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
              ++   A  +       ++ +  + T++  LS+ N L
Sbjct: 361 MRDLDYADAITRFQLESTALQTAQTVFTRMHGLSLFNLL 399


>gi|116326934|ref|YP_796654.1| flagellar hook-associated protein FlgL [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116332401|ref|YP_802119.1| flagellar hook-associated protein FlgL [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
 gi|116119678|gb|ABJ77721.1| Endoflagellar hook-filament protein [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116126090|gb|ABJ77361.1| Endoflagellar hook-filament protein [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
          Length = 421

 Score =  145 bits (365), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 47/420 (11%), Positives = 110/420 (26%), Gaps = 66/420 (15%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+       +         +  +   ++ TGQ          R T+ + +    N + 
Sbjct: 1   MRITNMMQNNSLIHNLNRHQLNMDETQNQLSTGQRIRLPSDEPGRATNQMFFRSRLNELD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKF----PINAGMLRD 119
               +      RL      L  +  + Q      V    G    +K           + +
Sbjct: 61  TFQRNIDDGNSRLQQIDGELDRIGSLFQRARVLAVQASNGIYQGDKGFELEVAIGKEIDE 120

Query: 120 SYESFVTFANMTDEGQYLFSGINSSEKPLN------------------------------ 149
              + V  AN  D       G +  E+P                                
Sbjct: 121 ILRALVDIANTRDATGRPLFGGHVIERPPFEPIESKIKGLQGIELKNQYIGVEYRGDIGE 180

Query: 150 ------------------GYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQ 191
                               F   +++  S           + K  + G  + VS+ +  
Sbjct: 181 QLREIEKGEYIPVTVPGNKVFWGTNMSITSKVDNSGYVTSSDQKFKIDGVEIHVSAGDTI 240

Query: 192 QMTDFIKQLED---KFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMF 248
                         K +       + S+ + H I     +   I     +      +   
Sbjct: 241 DDIIDKINNSPLEVKANKLAQDNISLSSTAPHQIWMEDIEGGTILRDIGLVDSATSEPPN 300

Query: 249 VAVIGTEFLSKNLTDG-----------ARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKN 297
                      ++ D             +  ++ + L  +   +  I+  RAV+G     
Sbjct: 301 NYSKSATVTGLSVFDVMIQFRNDLIQKDQERISGRDLQDLDLAMENILRYRAVVGARMNR 360

Query: 298 INEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           + E    +    + +   +SK+ G++       +  L    + +  + +K+ K +++++L
Sbjct: 361 MEEHAQRVDFDKSYMTELLSKNEGIDFPETIMNMKWLETVHQYALNVGSKIIKPTLMDFL 420


>gi|242392304|dbj|BAH80325.1| flagellin [Bacillus sp. Kps3]
          Length = 378

 Score =  145 bits (365), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 27/368 (7%), Positives = 90/368 (24%), Gaps = 21/368 (5%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +                + K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINHNIAALNTYRQLTIGQGAAAKNMEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               ++      + T++  L+    I+Q M    V    G   +         ++     
Sbjct: 61  MASKNSQDAISLIQTAEGALNETHAILQRMRELAVQASNGTNTDEDRQALNEEVQQLKTE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                  T+                       +L       +      +     ++    
Sbjct: 121 ITRIGTQTEFNTQKLLDGTFGSTVDQDATNTTALTVTGVATITTSGGLKADTYTISWNAT 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSAN------ 237
           +            I + +D  +D           + +N    +         A       
Sbjct: 181 DNVYELQDSGGAVIGKAKDLAADGAGSITFMGWDATNNKDTGVSLITVTTNGAYTLQSLD 240

Query: 238 ---------------VNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLS 282
                           + +G    + +  +    L+ +          +  ++++   + 
Sbjct: 241 GSDIVIKGSANNFQIGSNQGQVMGLSIGDMTASGLAVDTVAVDTYDNAQSAIASIDNAIK 300

Query: 283 GIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSY 342
            + ++R+ LG  +  +      L      +    S+   V+      + +      + + 
Sbjct: 301 LVSQERSKLGAYQNRLEHTINNLGTAAENLTAAESRIRDVDMAKEMMEFTKNNILTQAAQ 360

Query: 343 MITTKLQK 350
            +  +  +
Sbjct: 361 AMLAQSSQ 368


>gi|262276405|ref|ZP_06054214.1| flagellin protein FlaC [Grimontia hollisae CIP 101886]
 gi|262220213|gb|EEY71529.1| flagellin protein FlaC [Grimontia hollisae CIP 101886]
          Length = 380

 Score =  145 bits (365), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 29/367 (7%), Positives = 84/367 (22%), Gaps = 21/367 (5%)

Query: 6   ISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAER 65
           ++T+           +   +     E + +G   +      A +        +   +   
Sbjct: 5   VNTNVSAMTAQRYLNKSTNELNTSMERLSSGSRINSAKDDAAGLQISNRLIAQTRGLDVA 64

Query: 66  LHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFV 125
           + + +       T++  +     I+Q M    +    G    ++       +    +   
Sbjct: 65  MRNANDGISIAQTAEGAMQESTNILQRMRDLALQSANGANGISERVAIQEEVSALQDELN 124

Query: 126 TFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEV 185
             A  T  G       +  E                   +            +       
Sbjct: 125 RIAETTAFGGRRLLNGSFGEASFQIGADSGEAIIMGLTSIRADDFRMGGTEFIGTSAKTA 184

Query: 186 SSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR---- 241
                   +        K  +      +     D        + +  ++           
Sbjct: 185 GWGVTAAASTLTLAFTTKDGNSINLNIDAKAGDDIEELATYINGQSDEMLTASVDDDGQL 244

Query: 242 -----------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGI 284
                             +   + +       ++    D +     +  +  +   +  I
Sbjct: 245 QIFIAEEKLEGNVTFGGALATSLGLVTGTGSAITAQDIDVSNVGGAQMAVGIIDSAMQYI 304

Query: 285 IEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMI 344
             QRA LG  +  ++     L N    +    S+    +      +L+      + S  I
Sbjct: 305 DSQRADLGAKQNRLSHTISNLSNIQENVSASNSRIRDTDFAKETTELTKGQILQQASTSI 364

Query: 345 TTKLQKL 351
             + ++L
Sbjct: 365 LAQAKQL 371


>gi|189339440|gb|ABD33708.2| flagellin [Bacillus thuringiensis serovar monterrey]
          Length = 394

 Score =  145 bits (365), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 29/352 (8%), Positives = 93/352 (26%), Gaps = 4/352 (1%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              I+T+    R     ++         + + +G+  +      A +         ++ +
Sbjct: 33  IMRINTNINSMRTQEYMRQNQAKMSNAMDRLSSGKRINNASDDAAGLAIATRMRARESGL 92

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
               ++       + T+ + ++S+  I+  M         G   N              E
Sbjct: 93  GVAANNTQDGMSLIRTADSAMNSVSNILLRMRDLANQSANGTNTNENQAALNKEFDALKE 152

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSK----SLL 178
                +  T+         ++    +      D+  K                      +
Sbjct: 153 QINYISTNTEFNDKKLLDGSNKTIAIQTLDNADTSKKIDIKLADVSTESLKIDKLKIGGV 212

Query: 179 AGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANV 238
           + +  +  S    +++      +D    +   A    +     +           +    
Sbjct: 213 SKETTDAVSETFTKLSTTKTTDKDALKAEVEAAMKEFDKVKGAMSTEDAKAVTDKLGLFN 272

Query: 239 NMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNI 298
                 D   +A       +               ++ +   L  I   RA LG +   +
Sbjct: 273 TAAAGTDDTAIATAAKNLGAAFDKTKVNMADPNASVAAIDSALENIASNRATLGATLNRL 332

Query: 299 NEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
           +     L+++ + + +  S+    +     ++++      E    + ++  +
Sbjct: 333 DFNVNNLKSQQSSMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQ 384


>gi|157690947|ref|YP_001485409.1| flagellin [Bacillus pumilus SAFR-032]
 gi|157679705|gb|ABV60849.1| flagellin protein [Bacillus pumilus SAFR-032]
          Length = 322

 Score =  145 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 28/348 (8%), Positives = 83/348 (23%), Gaps = 37/348 (10%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +             N  S K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINHNIAALNTLNRLSANNGASQKNMEKLSSGLKINRAGDDAAGLAISEKMRGQIRGLE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLE-GKTDNNKFPINAGMLRDSYE 122
               +       + T++  L+    I+Q +   +V     G             +    +
Sbjct: 61  MASKNAQDGISLIQTAEGALTETHSILQRVRELVVQAGNTGTQQGEDLTAIKDEITALVD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                +N T+                                                  
Sbjct: 121 EVDGISNRTEFNGKKLLNGTF------------------------------------NGT 144

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
               +      ++            +  A  +   ++   + ++   +    +  V    
Sbjct: 145 GTPGTPGTPADSEAGTPEIPATPATDGEALVFQIGANATQQIKVNIQDMSAAALGVAGTD 204

Query: 243 IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEER 302
            +     +V   +           +      L+ V   +  +  QR+ LG  +  +    
Sbjct: 205 GKTETGKSVKDIDVSKFETIAADEDGGFDDQLAIVDGAIKQVSAQRSKLGAVQNRLEHTI 264

Query: 303 VFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
             L   +  +    S+   V+     ++ +      + S  +  +  +
Sbjct: 265 NNLGASSENLTAAESRIRDVDMAKEMSEFTKNNILSQASQAMLAQANQ 312


>gi|218708811|ref|YP_002416432.1| flagellar hook-associated protein FlgL [Vibrio splendidus LGP32]
 gi|218321830|emb|CAV17802.1| flagellar hook-associated protein FlgL [Vibrio splendidus LGP32]
          Length = 396

 Score =  145 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 34/396 (8%), Positives = 108/396 (27%), Gaps = 40/396 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             T IS+   ++ +    +           ++ +G+              +    Q+   
Sbjct: 1   MLTRISSFHNYQSVQNDFRRQENKVHHNQAQLASGKKLQSASDDPLATHYLQNIGQQSEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + + + +L+  RL   +  +++ +    +    ++ ++ G             +++  
Sbjct: 61  LKQYVDAITLIRNRLEHHEVMVANSEGFADEAKRTVMEMINGALSPEDRLAKKREIQELS 120

Query: 122 ESFVTFANMTDEGQYL-FSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
            + +  AN  DE     FSG     +P       +   +    Q           ++   
Sbjct: 121 NNLLHLANTQDESGNYTFSGTKPKSQPFFQDNEGNVSYQGDDYQRKMRVATSFEMAMNDP 180

Query: 181 QHLEVSSMNA------------QQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKD 228
                  ++                   + +  +K  D   +   + +       Y+++ 
Sbjct: 181 GSKLFMEIDNPFGDYEPQYDLEPASELLLGRATNKSEDGSTYKVTFVDMQTGKFAYQLEK 240

Query: 229 TEGIDVSANVNMRGIRDI---------------------------MFVAVIGTEFLSKNL 261
              +  S + +                                          E     +
Sbjct: 241 DGEVVASEDFDPSKGVVYEGLNIQFKGQITKGDSITLEPRKTFSIFDTFKETAEQAENPV 300

Query: 262 TDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIG 321
           +D +      +M          + + R  +G     ++ +    ++    +    S    
Sbjct: 301 SDASATAKLHQMTEEFHAAFIHLTKARTDVGARLSTLDIQEQQHEDFKLSLAKAKSNFED 360

Query: 322 VEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           ++   A  + +     ++ S     K + L++ NY+
Sbjct: 361 LDYSKAIIEFNENSRALQASQQAFGKTKDLTLFNYI 396


>gi|312882649|ref|ZP_07742386.1| flagellin [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309369610|gb|EFP97125.1| flagellin [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 380

 Score =  145 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 36/370 (9%), Positives = 91/370 (24%), Gaps = 21/370 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             +       E + +G   +      A +      + +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNSASAAQQTSMERLSSGFKINSAKDDAAGLQISNRLQVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       TS+  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LGVAVRNANDGISIAQTSEGAMNETTTILQRMRDLSLQSANGSNSLSERTAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K              + + M          +  AG 
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFGTKAFQIGADSGEAVMFTLNNMRSDNKFMGGGTYAAGD 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNM- 240
                        + I  ++D     E          D        + +   V A+V   
Sbjct: 181 AKGKDWAVEDTKNELILDIKDLNGVVEQVKIEAKVGDDIEEVATYINGQTDKVKASVAEG 240

Query: 241 --------------------RGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQG 280
                                G            + ++ +  D       ++ ++ V   
Sbjct: 241 GVLQLFTDNNKVTDAEAIGISGTLATELNLTNTRKAVTVDTIDVKTVGGAQESVAIVDAA 300

Query: 281 LSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEM 340
           L  +   RA +G  +         L+N +  ++   S+    +       L+      + 
Sbjct: 301 LRFVDSHRAEIGAFQNRFGHAISNLENIDENVNASKSRIKDTDFAKETTALTKAQILTQA 360

Query: 341 SYMITTKLQK 350
           S  +  + ++
Sbjct: 361 SSSVLAQAKQ 370


>gi|229524144|ref|ZP_04413549.1| flagellin protein FlaD [Vibrio cholerae bv. albensis VL426]
 gi|229337725|gb|EEO02742.1| flagellin protein FlaD [Vibrio cholerae bv. albensis VL426]
          Length = 377

 Score =  145 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 43/367 (11%), Positives = 96/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRYLTGATNAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         S K              +   M          S +A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFSTKSFQIGADNGEAVMLTLKDMRSDNRMMGGTSYVAAE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D    L+D   +D+    N     D        + +   V A+VN +
Sbjct: 181 GKDKDWKVQAGANDITFTLKDIDGNDQTITVNTKEGDDIEEVATYINGQTDMVKASVNEK 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I       T                  +  + +  D       ++ ++ +   L  
Sbjct: 241 GQLQIFAGNNKVTGDVAFSGGLAGALNMQAGKAETVHTMDVTSVGGAQQSVAVIDSALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTALTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|27363698|ref|NP_759226.1| flagellar hook-associated protein FlgL [Vibrio vulnificus CMCP6]
 gi|37679154|ref|NP_933763.1| flagellar hook-associated protein FlgL [Vibrio vulnificus YJ016]
 gi|320157102|ref|YP_004189481.1| flagellar hook-associated protein FlgL [Vibrio vulnificus MO6-24/O]
 gi|27359814|gb|AAO08753.1| flagellar hook-associated protein 3 [Vibrio vulnificus CMCP6]
 gi|37197896|dbj|BAC93734.1| flagellar hook-associated protein FlgL [Vibrio vulnificus YJ016]
 gi|319932414|gb|ADV87278.1| flagellar hook-associated protein FlgL [Vibrio vulnificus MO6-24/O]
          Length = 397

 Score =  145 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 35/397 (8%), Positives = 114/397 (28%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             + I++   ++ +    + +         ++ +G+              I    Q+   
Sbjct: 1   MISRIASFHNYQSVQNDLRRMENKIHHNQAQLASGKKLLSPSDDPLATHYIQNIGQQSEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L +  LV  RL   + ++++ ++   +    ++ ++ G             + +  
Sbjct: 61  LKQYLDAIVLVRNRLEQHEVNVANQEQFADEAKRTVMEMINGALSPEDRRAKRREIEELA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+  AN  DE           +          ++     D   +  +  N +  +   
Sbjct: 121 TNFLYLANAQDESGNYTFAGTKPKSQPFFRDYDGTVTYAGDDYQRKMRVSANLEMAMNDP 180

Query: 182 HLEVSSMNAQQMTDF--------------IKQLEDKFSDDEYWANNWSNASDHNIKYRIK 227
             ++         D+               K + + + D   +     + S+    Y+++
Sbjct: 181 GSKLFMDIPNPFGDYEPEYQLQNASELLLEKAVNEDYFDKATYRVTMVDMSNGRWGYQLE 240

Query: 228 DTEGIDVSANVNMRGIRDI---------------------------MFVAVIGTEFLSKN 260
               +  +   N                                          ++   +
Sbjct: 241 KDGSVVAADEFNPSTGIQYEDLTIQLKGQIQKGDVIELKPRETFSIFDSFKNAEKYSEAS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D        ++          + + R  +G     ++ +    ++ N  +    S   
Sbjct: 301 VSDANATAKLHQVTEEFHAAFIHLNKARTDIGARLSTLDIQEQQHEDFNLSLAKAKSNFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + +     ++ S +   K + L++ NYL
Sbjct: 361 DLDYSKAIIEFNENSRALQASQLAFGKTKDLTLFNYL 397


>gi|150388567|ref|YP_001318616.1| flagellin domain-containing protein [Alkaliphilus metalliredigens
           QYMF]
 gi|149948429|gb|ABR46957.1| flagellin domain protein [Alkaliphilus metalliredigens QYMF]
          Length = 399

 Score =  145 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 35/389 (8%), Positives = 101/389 (25%), Gaps = 42/389 (10%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + +    +        +  K  E++ +G   +      A ++   +   +   + 
Sbjct: 1   MRINNNLMAMNTHRQLGSAQANGAKSMEKLSSGFRINRAGDDAAGLSISEKMRGQIRGLD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  L+    I+Q M    V                  +      
Sbjct: 61  QASRNAQDGISLIQTAEGALNETHSILQRMRELSVQSSNDTNVQEDRDALQAEMDQLATE 120

Query: 124 FVTFANMTDEGQYLFSGI----------------------------------------NS 143
               A+ T+       G                                         ++
Sbjct: 121 ITRIADNTEFNTKNLLGGEFEGKFHIGANEGQNMELKIAAMDADSLKVQGEVYEAQDLDN 180

Query: 144 SEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDK 203
            +       T + +  +     +       S +       +V ++   Q           
Sbjct: 181 VDNVQIQSRTGEDVTVEFAAIQVADGAAVTSTTAAWNTDGDVLTVTLAQAAPTSTGSTGL 240

Query: 204 FSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLT- 262
               +    N  NA+             +  +A  N       + +     +  +   + 
Sbjct: 241 VQASDQDIMNAINAAGGEYGLSAIANGTVSGTAITNGSAGIADVDLNNWELDVEASAASG 300

Query: 263 -DGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIG 321
            D +      + ++T+   L  + ++R++LG  +  +      L N +  +    S+   
Sbjct: 301 IDISSQAKADEAITTINTALERVSKERSMLGAVQNRLEHTISNLDNVSENLQASESRVRD 360

Query: 322 VEQHTAHAQLSTLINKIEMSYMITTKLQK 350
           V+      +L+      + S  +  +  +
Sbjct: 361 VDMAKEMMELTKQNILQQASTAMLAQANQ 389


>gi|189339494|gb|ABD33768.2| flagellin [Bacillus thuringiensis serovar kumamotoensis]
          Length = 399

 Score =  145 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 30/357 (8%), Positives = 102/357 (28%), Gaps = 9/357 (2%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              I+T+    R     ++         + + +G+  +      A +         ++ +
Sbjct: 33  IMRINTNINSLRTQEYMRQNQSKMSNSMDRLSSGKRINNASDDAAGLAIATRMRARESGL 92

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
               ++       + T+ + ++S+  I+  M         G   ++          +  +
Sbjct: 93  NVAANNTQDGMSLIRTADSAMNSVSNILLRMRDIANQSANGTNTDSNKSALQKEFDELQK 152

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQ---------GFLEEN 173
                A+ T          +S  K      +          + +                
Sbjct: 153 QITYIADNTQFNDKNLLKEDSEVKIQTLDSSSSEQQIGINLKAVTLEKLGIDKISIGAGA 212

Query: 174 SKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGID 233
                 G  +E + ++A          + K +D     + ++              +   
Sbjct: 213 GAGGAGGTKIEQTDIDAVTKGIADLTKDSKDADVTAIRDAFAKIKGSMDPAEATAIDDAL 272

Query: 234 VSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGI 293
            +       +  +  +            TD A      + +  + + L+ + + RA LG 
Sbjct: 273 NAFKAGTATVDTVKDIQDALKGATLPKATDAAEKDNALEAVKAIDKALTTVADNRATLGA 332

Query: 294 SEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
           +   ++     L+++++ + +  S+    +     ++++      E    + ++  +
Sbjct: 333 TLNRLDFNVNNLKSQSSSMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQ 389


>gi|189164099|gb|ABU96038.2| flagellin [Bacillus thuringiensis serovar kenyae]
 gi|189339456|gb|ABD33724.2| flagellin [Bacillus thuringiensis serovar kenyae]
          Length = 400

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/357 (10%), Positives = 91/357 (25%), Gaps = 10/357 (2%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +         +  + 
Sbjct: 34  MRINTNINSMRTQEYMRQNQAKMSNSMDRLSSGKRINNASDDAAGLAIATRMRSREGGLN 93

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               +       + T+ + L+S+  I+  M         G   +              E 
Sbjct: 94  VAARNTEDGMSLIRTADSALNSVSNILLRMRDLANQSASGTNTDKNQAAMQKEFDQLKEQ 153

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQG----------FLEEN 173
               A+ T+         ++S   +    + D   + +                      
Sbjct: 154 IQYIADNTEFNDKKLLDGSNSTINIQTLDSHDKNKQITISLDSASLKNLDIKDLAIGSAT 213

Query: 174 SKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGID 233
                           A   TD     +D       +    S  +   +       +  D
Sbjct: 214 INQTDLDTATNSMKRLATPATDGKVLAQDIADAKAAFNKVQSAYTPAEVDKIQDAFKAYD 273

Query: 234 VSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGI 293
             A        DI   A           T  A        +  + + +  I   RA LG 
Sbjct: 274 KLAADPASKDTDIADAAKNVNTVFGTLATPTATKFDPSSAVEKIDKAIETIASSRATLGA 333

Query: 294 SEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
           +   ++     L+++ N +    S+    +     ++++      E    + ++  +
Sbjct: 334 TLNRLDFNVTNLKSQENSMAASASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQ 390


>gi|84388102|ref|ZP_00990998.1| flagellin [Vibrio splendidus 12B01]
 gi|84377169|gb|EAP94039.1| flagellin [Vibrio splendidus 12B01]
          Length = 376

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 43/367 (11%), Positives = 102/367 (27%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+              + + K  E + +G   +      A +        +   
Sbjct: 1   MAINVSTNVSAMTAQRYLNSAAEGTQKSMERLSSGYKINSAKDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDMAVKNANDGISIAQTAEGAMNESTNILQRMRDLSLQSSNGSNSKSERVAIQEEVSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 A  T  G           +              + + M     +   KS    +
Sbjct: 121 TELNRIAETTSFGGNKLLNGTYGSQSFQIGADSGEAVMLTMNNMRTDTQDMGGKSYGVTE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S   A   +D   +  DKF + +  + +    +D        + +  DV A+V   
Sbjct: 181 GKDASWRVAAG-SDLTIKYNDKFGEAQELSISAKEGNDMEELATYINGQSQDVKASVGEG 239

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +   +                      + ++ N  D        + +S +   L  
Sbjct: 240 GKLQLFASSQKVEGDVEFGGSLAGELGIGAAKDVTVNDIDVTSVAGANEAVSIIDGALKS 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   +     L N N  ++   S+    +       ++      + S  
Sbjct: 300 VDSNRASLGAFQNRFDHAISNLDNINENVNASKSRIKDTDYAKETTAMTKSQILQQASTS 359

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 360 ILAQAKQ 366


>gi|2271027|gb|AAC01556.1| flagellin [Vibrio cholerae]
          Length = 377

 Score =  144 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 42/367 (11%), Positives = 95/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRYLTGATNAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         S K              +   M          S +A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFSTKSFQIGADNGEAVMLTLKDMRSDNRMMGGTSYVAAE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D    L+D   +D+    N     D        + +   V A+VN +
Sbjct: 181 GKDKDWKVQAGANDITFTLKDIDGNDQTITVNAKEGDDIEEVATYINGQTDMVKASVNEK 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +       T                     + +  D       ++ ++ +   L  
Sbjct: 241 GQLQVFAGNNKVTGDVAFSGGLAGALNMQAGTAETVDTIDVTSVGGAQQSVAVIDSALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKEITALTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|312884923|ref|ZP_07744613.1| flagellin [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367400|gb|EFP94962.1| flagellin [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 378

 Score =  144 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 46/367 (12%), Positives = 103/367 (28%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             +K   +  E + +G   +      A +        +   
Sbjct: 1   MAITVNTNVSAMTAQRYLSSASKMLEQSLERLSSGNRINSAKDDAAGLQISNRLTTQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  +S   +I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIMQTAEGAMSETTQILQRMRDLSLQSANGSNSRSERIALQEEMTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         +        +       S   M    +     S LA  
Sbjct: 121 DELNRIAETTSFGGRKLLNGTFATSAFQIGASSGESVLVSLKNMRSDDINMGGFSYLAAN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            L+ S          + +  D  +  +    +     D        + +  +VSA+VN  
Sbjct: 181 RLDKSWQVQGGKNQLVMEYTDVNNQQKVLTIDAKVGDDIEELATYINGQNQEVSASVNQD 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
               I     + +  LS + +                  D       ++ ++ +   L  
Sbjct: 241 QQLQIYLEGSLTSGTLSFSGSLASELGMGLIGYEAVDNIDITDVGGAQRAVAIIDTALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  +    S+    +      QL       ++S  
Sbjct: 301 VDSHRAELGAMQNRFNHSINNLSNINENLSASNSRIKDTDYAKETTQLVKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|189164111|gb|ABU96041.2| flagellin [Bacillus thuringiensis serovar galleriae]
          Length = 397

 Score =  144 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 32/354 (9%), Positives = 93/354 (26%), Gaps = 7/354 (1%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +         ++ + 
Sbjct: 34  MRINTNINSMRTQEYMRQNQAKMSNAMDRLSSGKRINNASDDAAGLAIATRMRARESGLG 93

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       + T+ + ++S+  I+  M         G   N              E 
Sbjct: 94  VAANNTQDGISLIRTADSAMNSVSNILLRMRDLANQSANGTNTNENQAALNKEFDALKEQ 153

Query: 124 FVTFANMTDEGQYLFSGINSSE---KPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
               +  T+         ++     + L+   T   +     +   +             
Sbjct: 154 IDYISTNTEFNDKKLLDGSNKTIAVQTLDNADTSKQININLSNVSTKELGLSTLSIGTDK 213

Query: 181 QHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDT----EGIDVSA 236
               V     +   D   +     +             D    +   D     E      
Sbjct: 214 VEKTVYDATTKAFADLGAKTGTDKAAFAADVTAAMKEFDKVKPFMSADDVKKIETKLEDY 273

Query: 237 NVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEK 296
           N       +    A+         L            ++++   L  I   RA LG +  
Sbjct: 274 NKANDAGAEAAAQALGKEFATLTKLETTDLKANASGAIASIDTALKNIASNRATLGATLN 333

Query: 297 NINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            ++     L+++++ + +  S+    +     ++++      E    + ++  +
Sbjct: 334 RLDFNVNNLKSQSSSMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQ 387


>gi|260772315|ref|ZP_05881231.1| flagellin B [Vibrio metschnikovii CIP 69.14]
 gi|260611454|gb|EEX36657.1| flagellin B [Vibrio metschnikovii CIP 69.14]
          Length = 376

 Score =  144 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 94/367 (25%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRHLNSAADGVQKSMERLSSGYRINSARDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  +     I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMGESTNILQRMRDLALQSSNGSNSRSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K              +   +     E   K+  A  
Sbjct: 121 QELNRIAESTSFGGNRLLNGTFGSKSFQIGAESGEAVLLTMGSLRSDTAEMGGKAYRAET 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                          +    DK  +      N     D        + +  D++A+V   
Sbjct: 181 GQTPDWRVTTATELTL-NYTDKQGEAREITINAKVGDDLEEVATYINGQSEDINASVGED 239

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +   +   T  ++                      D      +++ ++ +   L  
Sbjct: 240 GKLQLYASSQKVTGDVTIGGDLATEIGFGTGQDVNVKNIDVTTVAGSQEAIAILDGALKS 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +   +     L+N N  ++   S+    +       ++      + S  
Sbjct: 300 VDSQRASLGAFQNRFSHAINNLENTNENVNASRSRIQDTDYARETTAMTKAQILQQASTS 359

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 360 VLAQAKQ 366


>gi|86146148|ref|ZP_01064474.1| flagellar hook-associated protein [Vibrio sp. MED222]
 gi|85836095|gb|EAQ54227.1| flagellar hook-associated protein [Vibrio sp. MED222]
          Length = 396

 Score =  144 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 36/396 (9%), Positives = 103/396 (26%), Gaps = 40/396 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             T IS+   ++ +    +           ++ +G+              +    Q+   
Sbjct: 1   MLTRISSFHNYQSVQNDFRRQENKVHHNQAQLASGKKLQSASDDPLATHYLQNIGQQSEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + + + +L+  RL   +  +++ +    +    ++ ++ G             +++  
Sbjct: 61  LKQYVDAITLIRNRLEHHEVMVANSEGFADEAKRTVMEMINGALSPEDRLAKKREIQELS 120

Query: 122 ESFVTFANMTDEGQYL-FSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
            + +  AN  DE     FSG     +P       +   +    Q           ++   
Sbjct: 121 NNLLHLANTQDESGNYTFSGTKPKSQPFFQDNEGNVSYQGDDYQRKMRVATSFEMAMNDP 180

Query: 181 QHLEVSSMN----------------------AQQMTDFIKQLEDKFSDDEYWANNWSNAS 218
                  ++                      A    D     +  F D +     +    
Sbjct: 181 GSKLFMEIDNPFGDYEPQYDLEPASELLLGRATNKADDSSTYKVTFVDMQTGKFAYQLEK 240

Query: 219 DHNIKYRIKDTEGIDVSANVNMRGIRDI-----------------MFVAVIGTEFLSKNL 261
           D  +           V         +                           E     +
Sbjct: 241 DGEVVASEDFDPSKGVVYEGLNIQFKGQITKGDSITLEPRKTFSIFDTFKDTAEQAENPV 300

Query: 262 TDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIG 321
           +D +      +M          + + R  +G     ++ +    ++    +    S    
Sbjct: 301 SDASATAKLHQMTEEFHAAFIHLTKARTDVGARLSTLDIQEQQHEDFKLSLAKAKSNFED 360

Query: 322 VEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           ++   A  + +     ++ S     K + L++ NY+
Sbjct: 361 LDYSKAIIEFNENSRALQASQQAFGKTKDLTLFNYI 396


>gi|254508428|ref|ZP_05120548.1| flagellar hook-associated protein 3 [Vibrio parahaemolyticus 16]
 gi|219548638|gb|EED25643.1| flagellar hook-associated protein 3 [Vibrio parahaemolyticus 16]
          Length = 397

 Score =  144 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 32/397 (8%), Positives = 106/397 (26%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +           ++ +G+              I    Q+K  
Sbjct: 1   MLNRISSFHNYQSVQNDLRRQEGKVHHNQAQLASGKKLMKASDDPLATHYIQNIGQQKEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   +  L   RL   +  +S+ ++   +    ++ ++ G             + +  
Sbjct: 61  LRQYSDAIVLTRNRLEHHEVIISNAEEFADEAKRTVMEMINGALSPEDRFAKRREIEEIA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+   N+ DE           +           +     D   +  +  + +  +   
Sbjct: 121 NNFLNLVNVQDESGNYIFAGTKPKNQPFFRDKDAEVVYAGDDYQRKMKISNSLEMPINDP 180

Query: 182 HLEVSSMNAQQMTDFIK--------------QLEDKFSDDEYWANNWSNASDHNIKYRIK 227
             ++         DF                 +     D   +   + +  +    Y+++
Sbjct: 181 GSKLFMEIDNPFGDFSPKYDLQEASELLLERAINLNPDDQSTYKVTFVDMPNGKYGYQLE 240

Query: 228 DTEGIDVSANVNMRGIRDIMFVAVIG---------------------------TEFLSKN 260
               +  +   +         V +                              +  S +
Sbjct: 241 RDGSVVQADTFDPSKGIKYEDVTIQVKGQITKGDAIELEPRRTYSIFETFKEAMDLSSGS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      ++          + + R  +G     ++ +     +    +    S   
Sbjct: 301 VSDSSNTAQLHQVTQEFHAAFIHLNKARTDVGARLNTLDIQEEQHADFEMTLAKSKSNFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + +     ++ S     K + L++ NY+
Sbjct: 361 DLDYAAAIIEFNENSRALQASQQAFGKTKDLTLFNYI 397


>gi|84388098|ref|ZP_00990994.1| flagellar hook-associated protein [Vibrio splendidus 12B01]
 gi|84377165|gb|EAP94035.1| flagellar hook-associated protein [Vibrio splendidus 12B01]
          Length = 396

 Score =  144 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 36/396 (9%), Positives = 105/396 (26%), Gaps = 40/396 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +           ++ +G+              +    Q+   
Sbjct: 1   MLNRISSFHNYQSVQNDLRRQENKIHHNQAQLASGKKLQSPSDDPLATHYLQNIGQQSEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   +  LV  RL   +  +S+ +    +    ++ ++ G             +++  
Sbjct: 61  LKQYSDAIVLVRNRLEHHEVLVSNTEGFADEAKRTVMEMINGALSPEDRLAKKREIQELS 120

Query: 122 ESFVTFANMTDEGQYL-FSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
            +F+  AN  DE     F+G     +P       +   +    Q           ++   
Sbjct: 121 NNFLHLANSQDESGNYTFAGTKPKNQPFFRDNQGNVSYQGDDYQRKMRVASSFEMAMNDP 180

Query: 181 QHLEV--------------------------SSMNAQQMTDFIKQLEDKFSDDEYWANNW 214
                                          ++ +A+  + +     D  + +  +    
Sbjct: 181 GSKLFMEIDNPFGDYEPQYELEPASELLLERATNSAEDGSTYKVTFVDMQTGNYAYQLEK 240

Query: 215 SNASDHNIKYRIKDT-------------EGIDVSANVNMRGIRDIMFVAVIGTEFLSKNL 261
             A      +                       S  +  R    I        E     +
Sbjct: 241 DGAVVAAEDFDPSTGIVYEGLNIQIKGQITKGDSITLEPRETFSIFDTFKEAAEQAENPV 300

Query: 262 TDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIG 321
           +D +      ++          + + R  +G     ++ +    ++    +    S    
Sbjct: 301 SDASATAKLHQVTEEFHAAFIHLTKARTDVGARLSTLDIQEQQHEDFKLSLAKAKSNFED 360

Query: 322 VEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           ++   A  + +     ++ S     K + L++ NY+
Sbjct: 361 LDYSKAIIEFNENSRALQASQQAFGKTKDLTLFNYI 396


>gi|254228431|ref|ZP_04921857.1| bacterial flagellin N-terminus domain protein [Vibrio sp. Ex25]
 gi|262393579|ref|YP_003285433.1| flagellin protein flaA [Vibrio sp. Ex25]
 gi|151939019|gb|EDN57851.1| bacterial flagellin N-terminus domain protein [Vibrio sp. Ex25]
 gi|262337173|gb|ACY50968.1| flagellin protein flaA [Vibrio sp. Ex25]
          Length = 376

 Score =  144 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 99/367 (26%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+           +      K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNQAADGQQKSMERLSSGYKINSAKDDAAGLQISNRLNAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +        ++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDMAVKNANDGISIAQVAEGAMNESTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +              S   +         KS  A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYGTQSFQIGADSGEAVMLSMGSLRSDTSAMGGKSYAAEE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S     + T+F     +K  +++  + +     D        + +  DV A+V   
Sbjct: 181 GKDASW-TVGEKTEFKMSYTNKQGEEKELSISAKQGDDIEQLATYINGQNDDVKASVGED 239

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +   +      +  +                    D      +++ ++ +   L  
Sbjct: 240 GKLQVFASSQKVQGDVEFSGNLADEIGFGGPKDVTVKDIDVTTVAGSQEAVAVIDGALKS 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +   N     L N N  ++   S+    +       ++      + S  
Sbjct: 300 VDSQRASLGAFQNRFNHAISNLDNINENVNASNSRIKDTDYAKETTAMTKSQILQQASTS 359

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 360 ILAQAKQ 366


>gi|85712261|ref|ZP_01043312.1| Flagellin [Idiomarina baltica OS145]
 gi|85693888|gb|EAQ31835.1| Flagellin [Idiomarina baltica OS145]
          Length = 404

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 49/402 (12%), Positives = 113/402 (28%), Gaps = 49/402 (12%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST+ +F+R     +       K+ +++                + ++          
Sbjct: 1   MRISTNLMFQRGLDSLQRSESALYKVQQQLTRQTKILSPSDDPIANSQVMNLNNALAQNE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +++ +   L  S+A+L  +   +Q      V ++ G    +     A  LR   + 
Sbjct: 61  QFMRNSTSLEANLRQSEANLDGVNSGLQRARELAVGVVNGSYSADDRKAVAKELRAIEKQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQML----------------- 166
            V  AN  D           S K    Y       +   DQ                   
Sbjct: 121 LVDQANARDAQGEYMFAGFQSRKEPMQYNASTQSYQYVSDQGARNIQLTPNLKLAANEPG 180

Query: 167 --------------------------------QGFLEENSKSLLAGQHLEVSSMNAQQMT 194
                                                E  +S    +   +S   A   +
Sbjct: 181 SKPFANVSQRVDINVESGQNLVGELRVSNREQFTDFTEQQQSNGNPRDFNISFDGAGNYS 240

Query: 195 DFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGT 254
                  +  S          N  D  +      +    +  +      R+ + +     
Sbjct: 241 IDDTSGNNLASGAITDGKISFNGMDITLAEDASPSASDTIQISNGEPIGRNPITLVSDLA 300

Query: 255 EFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDT 314
             L    T+G         L  + + +  ++  +A +G     +   R  L++ + +  T
Sbjct: 301 AALEGKGTNGQWEDEASWALDDLNKAMDNVVGTQADIGARMNVMESARTQLRDADVVNQT 360

Query: 315 YISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNY 356
             ++   V+ + A  +L       + S  + +++ +LS+ +Y
Sbjct: 361 ARAELADVDYNEAVTELVKNETLYQASQQVFSRINQLSLFDY 402


>gi|163802596|ref|ZP_02196488.1| flagellar hook-associated protein L [Vibrio sp. AND4]
 gi|159173679|gb|EDP58498.1| flagellar hook-associated protein L [Vibrio sp. AND4]
          Length = 396

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 49/396 (12%), Positives = 116/396 (29%), Gaps = 40/396 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             T IS+   ++ +    +          E++ +G+              I    Q++  
Sbjct: 1   MLTRISSFHNYQSVQNDLRRQENKIHHNQEQLASGKQLIKPSDDPLATHYIQSIGQQEEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           I + L +  LV  RL   +  +S+ ++ + +     + ++ G             L +  
Sbjct: 61  IKQYLDAIVLVRNRLENQEVVVSNAEQFIDESKRISMEMINGAFSPEDRAAKKRELEEIA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+  AN  DE           +          S+     D   +  +  N +  +   
Sbjct: 121 NNFMALANTQDESGNYVFAGTKPKTQPFFRDYDGSVVYTGDDYQRKMKVASNIELGINYP 180

Query: 182 HLEVSSMNAQQMTDF-------------IKQLEDKFSDDEYWANNWSNASDHNIKYRIKD 228
             +V S       DF             + Q      DD  +   + + S+    Y+++ 
Sbjct: 181 GNKVFSEIPNPFGDFQPQYDLQEGSELLLSQATSASQDDSNYTVTFVDMSNGKFGYQLEK 240

Query: 229 TEGIDVS---------------------ANVNMRGIRDIMFVAVIGTEFLSKN------L 261
              +                         +       +      I   F          +
Sbjct: 241 DGSVVQVDDYSPIDGIKYEGVNIQLKGQVSAGDSITLEPRQTFSIFDAFKETMQWSESSV 300

Query: 262 TDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIG 321
           +D +      +M    Q     + + R  +G +   ++ +    ++ N  +    S    
Sbjct: 301 SDASATAQLHQMTEEFQAAFVHMNKVRTDVGANLSTLDIQEQNHEDFNLSLAKAKSNFED 360

Query: 322 VEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           ++   A  + S     ++ S     K + L++ NY+
Sbjct: 361 LDYSKAVIEFSENSRALQASQQAFGKTKDLTLFNYI 396


>gi|163801836|ref|ZP_02195733.1| flagellin [Vibrio sp. AND4]
 gi|159174344|gb|EDP59148.1| flagellin [Vibrio sp. AND4]
          Length = 376

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 99/367 (26%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+           +  +   K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNKAAEGQQKSMERLSSGYKINSAKDDAAGLQISNRLNAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +        ++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDMAVKNANDGISIAQVAEGAMNESTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +              S   +     E   KS  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYGTQSFQIGADSGEAVMLSMGNLRSDDAEMGGKSYAAED 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S       T+      +K  +++          D        + +  DV A+V   
Sbjct: 181 GKDASW-TVSDKTELKMTYTNKQGEEQELTIQAKQGDDIEQLATYINGQSEDVKASVGED 239

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +   +   T                  + ++    D      +++ ++ +   L  
Sbjct: 240 GKLQVFASSQKITGEVDFSGNLAGEIGFGDAKDVTVKDIDVTTVAGSQEAVAIIDGALKS 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +   +     L N N  ++   S+    +       ++      + S  
Sbjct: 300 VDSQRASLGAFQNRFDHAISNLDNINENVNASNSRIKDTDYAKETTAMTKSQILQQASTS 359

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 360 ILAQAKQ 366


>gi|323496567|ref|ZP_08101621.1| flagellin [Vibrio sinaloensis DSM 21326]
 gi|323318411|gb|EGA71368.1| flagellin [Vibrio sinaloensis DSM 21326]
          Length = 377

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 44/367 (11%), Positives = 100/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G   +      A +      E + + 
Sbjct: 1   MAITVNTNVSAMTAQRHLTTATDLLNQSLERLASGSRINSAKDDAAGLQISNRLETQMSG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  +     I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIMQTAEGAMQETTNILQRMRDLSLQSSNGSNSQAERTALQEEMTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       + +        +     + S   M    ++    S +A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFASSSFQIGASSGEAVQVSLKNMRSDSIDMGGFSYIAAG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
               S   +Q       +  +   + E          D        + +   VSA+VN  
Sbjct: 181 KASDSWQVSQGNHVLNMEFTNALGEQESIQVKAKIGDDIEELATYINGQTDKVSASVNEE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   I          +S + +                  D +     ++ +S +   L  
Sbjct: 241 GQLQIFMAGKESAGTISFSGSLANELQMNLAGYEAVDNIDISDVGGAQRAVSVIDTALGY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N +  +    S+    +      QL       ++S  
Sbjct: 301 VDSHRAELGALQNRFNHAITNLDNVHENLAASNSRIKDTDYAKETTQLVKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|27365271|ref|NP_760799.1| flagellin [Vibrio vulnificus CMCP6]
 gi|37680675|ref|NP_935284.1| flagellin [Vibrio vulnificus YJ016]
 gi|320155655|ref|YP_004188034.1| flagellin protein FlaA [Vibrio vulnificus MO6-24/O]
 gi|27361418|gb|AAO10326.1| Flagellin protein flaA [Vibrio vulnificus CMCP6]
 gi|37199424|dbj|BAC95255.1| polar flagellin FlaA [Vibrio vulnificus YJ016]
 gi|319930967|gb|ADV85831.1| flagellin protein FlaA [Vibrio vulnificus MO6-24/O]
          Length = 376

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 100/367 (27%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+           +  +   K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNQAAEGQQKSMERLSSGYKINSAKDDAAGLQISNRLNSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDMAVKNANDGISIAQTAEGAMTETTNILQRMRDLALQSSNGSNSRSERVAIQEEVSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +              S   +          S  + +
Sbjct: 121 QELNRIAETTSFGGNKLLNGTYGSQSFQIGADSGEAVMLSMGNLRSDTDAMGGLSYKSEE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            +      +   TDF     +K  +++    N     D        + +  DV A+V   
Sbjct: 181 GVGADWRVSDN-TDFTMSYVNKQGEEKEITVNAKAGDDLEELATYINGQNDDVKASVGEG 239

Query: 242 ------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
                             G      + +      + +  D      +++ ++ +   L  
Sbjct: 240 GKLQLFASNQRVEGEVEFGGGLASELNIGDGTKTNVSNIDVTTVAGSQEAVAIIDGALKS 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  +RA LG  +   N     L N N  ++   S+    +      Q++      + S  
Sbjct: 300 VDSERASLGAFQNRFNHAISNLSNINENVNASSSRIKDTDYAKETTQMTKTQILQQASTS 359

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 360 ILAQAKQ 366


>gi|262166245|ref|ZP_06033982.1| flagellin protein FlaD [Vibrio mimicus VM223]
 gi|262025961|gb|EEY44629.1| flagellin protein FlaD [Vibrio mimicus VM223]
          Length = 377

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 45/367 (12%), Positives = 96/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRYLNGATNAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         S K              S   M          S +A +
Sbjct: 121 DELNRVAETTSFGGNKLLNGTFSTKSFQIGADNGEAVMLSLKDMRSDNRMMGGTSYVATE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +        D    L+D   +D+    N     D        + +   V A+VN +
Sbjct: 181 GKDKNWKVEAGANDITFTLKDIDGNDQTITVNAKEGDDIEEVATYINGQTDMVKASVNEK 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I       T                     + +  D       ++ ++ +   L  
Sbjct: 241 GQLQIFAGNNKVTGDVAFSGGLAGALNMQAGTAETVDTIDVTSVGGAQQSVAVIDSALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTALTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|189339429|gb|ABD33702.2| flagellin [Bacillus thuringiensis serovar canadensis]
          Length = 397

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 34/354 (9%), Positives = 99/354 (27%), Gaps = 7/354 (1%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +         ++ + 
Sbjct: 34  MRINTNINSMRTQEYMRQNQAKMSNAMDRLSSGKRINNASDDAAGLAIATRMRARESGLG 93

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       + T+ + ++S+  I+  M         G   N              E 
Sbjct: 94  VAANNTQDGISLIRTADSAMNSVSNILLRMRDLANQSANGTNTNENQAALNKEFDALKEQ 153

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               +  T+         ++    +      D+  + + +       E    +L  G   
Sbjct: 154 IDYISTNTEFNDKKLLDGSNKTIAVQTLDNADTSKQININLSNVSTKELGLDTLSIGTDK 213

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDT-------EGIDVSA 236
              ++       F        +D   +  + + A     K +   +       E      
Sbjct: 214 VEKTVYDATTKAFADLGAKTGADKAAFDADVTAAMKEFDKVKPFMSADDVKKIETKLEDY 273

Query: 237 NVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEK 296
           N            A+         L            ++++   L  I   RA LG +  
Sbjct: 274 NKANDAGAQTAAQALGKEFATLTKLETTDLKANASGAIASIDTALKNIASNRATLGATLN 333

Query: 297 NINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            ++     L+++++ + +  S+    +     ++++      E    + ++  +
Sbjct: 334 RLDFNVNNLKSQSSSMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQ 387


>gi|28899032|ref|NP_798637.1| flagellin [Vibrio parahaemolyticus RIMD 2210633]
 gi|153837011|ref|ZP_01989678.1| polar flagellin A [Vibrio parahaemolyticus AQ3810]
 gi|260365222|ref|ZP_05777779.1| polar flagellin A [Vibrio parahaemolyticus K5030]
 gi|260878772|ref|ZP_05891127.1| polar flagellin A [Vibrio parahaemolyticus AN-5034]
 gi|260897367|ref|ZP_05905863.1| polar flagellin A [Vibrio parahaemolyticus Peru-466]
 gi|260899926|ref|ZP_05908321.1| polar flagellin A [Vibrio parahaemolyticus AQ4037]
 gi|15638981|sp|Q56703|FLAA_VIBPA RecName: Full=Polar flagellin A
 gi|551513|gb|AAC27801.1| polar flagellin [Vibrio parahaemolyticus]
 gi|28807251|dbj|BAC60521.1| polar flagellin FlaA [Vibrio parahaemolyticus RIMD 2210633]
 gi|149749784|gb|EDM60529.1| polar flagellin A [Vibrio parahaemolyticus AQ3810]
 gi|308088239|gb|EFO37934.1| polar flagellin A [Vibrio parahaemolyticus Peru-466]
 gi|308094282|gb|EFO43977.1| polar flagellin A [Vibrio parahaemolyticus AN-5034]
 gi|308107385|gb|EFO44925.1| polar flagellin A [Vibrio parahaemolyticus AQ4037]
 gi|308115477|gb|EFO53017.1| polar flagellin A [Vibrio parahaemolyticus K5030]
 gi|328474431|gb|EGF45236.1| flagellin [Vibrio parahaemolyticus 10329]
          Length = 376

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 38/366 (10%), Positives = 97/366 (26%), Gaps = 17/366 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+              +   K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNHAAEGQQKSMERLSSGYKINSAKDDAAGLQISNRLNAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +        ++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDMAVKNANDGISIAQVAEGAMNESTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +              S   +         KS  A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYGTQSFQIGADSGEAVMLSMGSLRSDTSAMGGKSYSAEE 180

Query: 182 HLEVSSMNAQQMTDFIK-----------QLEDKFSDDEYWANNWSNASDHNIKYRIKDTE 230
             + S     +    +             ++ K  DD      + N    ++K  + +  
Sbjct: 181 GKDASWTVGDKTELKMSYTNKQGEEKELTIKAKQGDDIEQLATYINGQSEDVKASVGEDG 240

Query: 231 GIDVSANVNMRGIRDIMFVAVI------GTEFLSKNLTDGARNVLTKKMLSTVQQGLSGI 284
            + V A+             +         + ++    D      +++ ++ +   L  +
Sbjct: 241 KLQVFASTQKVNGEVEFSGNLAGEIGFGDAKDVTVKDIDVTTVAGSQEAVAVIDGALKSV 300

Query: 285 IEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMI 344
             QRA LG  +   N     L N N  ++   S+    +       ++      + S  I
Sbjct: 301 DSQRASLGAFQNRFNHAISNLDNINENVNASNSRIKDTDYAKETTAMTKSQILQQASTSI 360

Query: 345 TTKLQK 350
             + ++
Sbjct: 361 LAQAKQ 366


>gi|318056201|gb|ADV36284.1| flagellin protein FliA(C) [Clostridium septicum]
          Length = 388

 Score =  144 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 30/365 (8%), Positives = 90/365 (24%), Gaps = 31/365 (8%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +      +         + K  E++ +G   +      A ++   +   +   + 
Sbjct: 1   MIINHNMNAMNAHRNMASNTVATGKSMEKLSSGLRINRAGDDAAGLSISEKMRGQIRGLE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   ++      + T++  L+    I+Q M    V        +         L      
Sbjct: 61  QASRNSQDGISLIQTTEGALNETHSILQRMRELSVQASNDTNTSEDRGQLTKELDQLKSE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKS---------------------- 161
               ++ T   +      +  +          +  +                        
Sbjct: 121 IDRISSQTQFNKMDVLNGDGDKPFKANIQVGANSNQAIEIAIDKMDYDSLFKAHSVSGDA 180

Query: 162 ---------FDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWAN 212
                      + +   ++     + A +     ++   ++   I +  +K +D +    
Sbjct: 181 VKGDNITIKAKKDITITIDTKKIVVEADKGTVDKTLTKGELVAEINKGIEKDADLKGKVK 240

Query: 213 NWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKK 272
                    I       + + V    N       +         +     D   +     
Sbjct: 241 ASFADDKLTISRVDGLDKEVTVKIEDNNASGNTKLGSGQDTKSKMEVFKVDFTSHAAATG 300

Query: 273 MLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLS 332
            +S + + +  +  QR+ LG  +  +      + N    +    S+   V+        S
Sbjct: 301 SISAIDRAIEKVSTQRSQLGAYQNRLEHTIKNVDNAAENLQAAESRVRDVDMANEMMTFS 360

Query: 333 TLINK 337
                
Sbjct: 361 KNNIL 365


>gi|256750560|gb|ACV21065.1| flagellin A [Vibrio parahaemolyticus]
          Length = 376

 Score =  144 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 38/366 (10%), Positives = 97/366 (26%), Gaps = 17/366 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+              +   K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNHAAEGQQKSMERLSSGYKINSAKDDAAGLQISNRLNAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +        ++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDMAVKNANDGISIAQVAEGAMNESTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +              S   +         KS  A +
Sbjct: 121 DGLNRIAETTSFGGNKLLNGTYGTQSFQIGADSGEAVMLSMGSLRSDTSAMGGKSYSAEE 180

Query: 182 HLEVSSMNAQQMTDFIK-----------QLEDKFSDDEYWANNWSNASDHNIKYRIKDTE 230
             + S     +    +             ++ K  DD      + N    ++K  + +  
Sbjct: 181 GKDASWTVGDKTELKMSYTNKQGEEKELTIKAKQGDDIEQLATYINGQSEDVKASVGEDG 240

Query: 231 GIDVSANVNMRGIRDIMFVAVI------GTEFLSKNLTDGARNVLTKKMLSTVQQGLSGI 284
            + V A+             +         + ++    D      +++ ++ +   L  +
Sbjct: 241 KLQVFASTQKVNGEVEFSGNLAGEIGFGDAKDVTVKDIDVTTVAGSQEAVAVIDGALKSV 300

Query: 285 IEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMI 344
             QRA LG  +   N     L N N  ++   S+    +       ++      + S  I
Sbjct: 301 DSQRASLGAFQNRFNHAISNLDNINENVNASNSRIKDTDYAKETTAMTKSQILQQASTSI 360

Query: 345 TTKLQK 350
             + ++
Sbjct: 361 LAQAKQ 366


>gi|197335862|ref|YP_002156690.1| flagellin [Vibrio fischeri MJ11]
 gi|197317352|gb|ACH66799.1| flagellin [Vibrio fischeri MJ11]
          Length = 377

 Score =  144 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 33/367 (8%), Positives = 98/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  ++T+           +  +   +  E + +G+  +      A +      + + + 
Sbjct: 1   MSVTVNTNVSAMTAQRYLNQATEHLNQSMERLSSGKRINSAKDDAAGLQISNRLKSQMSG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G                  
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNESTNILQRMRDLALQSSNGSNTLQDRQAIQEEADALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G                        + +   M    L        +  
Sbjct: 121 DELNRIAETTSFGGRRLLNGQFGTSTFQIGANAGEAVQLTLGSMRSDTLAMGGFHYTSQN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            L       +          D+    +          D        + +   V A+V+ +
Sbjct: 181 QLNKGWTVPEGGQTLTMSFNDENGKAQEITIEAKAGDDIEELATYINGQNDTVQASVDEK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +     + +  ++   T                  D      +++ ++T+   +  
Sbjct: 241 GQLQLFTAGDVVSSAVTFGGTLSAELAIGGAVFDTVNDLDLTSVGGSQRAIATLDAAMGF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           + ++RA LG  +   +     L N N  +    S+    +      ++       ++S  
Sbjct: 301 VDKERATLGAFQNRFDHAINNLNNINENVAASNSRIEDTDFAKETVEMMKAQILQQVSST 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|170725962|ref|YP_001759988.1| flagellar hook-associated protein FlgL [Shewanella woodyi ATCC
           51908]
 gi|169811309|gb|ACA85893.1| flagellar hook-associated protein 3 [Shewanella woodyi ATCC 51908]
          Length = 396

 Score =  144 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 40/396 (10%), Positives = 108/396 (27%), Gaps = 42/396 (10%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ISTS +F +      +    + K+ +++ +G+  +           I    Q+   + 
Sbjct: 1   MRISTSQMFNQSINSVLDKQTATSKILDQLSSGKKVNTAGDDPVASVGIDNLNQQNALVD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +      RL  S++ L + + +V      ++  + G    ++  + A  L+ + E 
Sbjct: 61  QFMKNIDYAKNRLGLSESKLGTAETLVASTREQVIRAINGGLSESERQMIADELKGTLEE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V  AN  DE          + K    + +  ++     +   +  +             
Sbjct: 121 LVAVANTKDESGNYIFAGFETGKQPFAFDSAGNMIYSGDNGAREAVIASGVTIATNIPGD 180

Query: 184 EVSSMNAQQMTDFIKQ----------------LEDKFSDDEYWANNWSNASDHNIKYRIK 227
                    + D+                          ++ +      A+         
Sbjct: 181 NAFMNAPSGLGDYSANYLASQVGEFSVDSAKITNPGTYVEDTYTFTMVGANLEVRDSSAT 240

Query: 228 DTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKML------------- 274
                      N      +                     V     +             
Sbjct: 241 LVTTEVGFDPTNPISFNGMEVKLDGMPTAGDSFSITPQSEVSIFDTINQAISLLEDPNKV 300

Query: 275 -------------STVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIG 321
                        + +  G++ I   R+  G S K+I        ++  +  + +S    
Sbjct: 301 NTPQGVSELAQILNNIDSGVNQISIARSETGNSLKSIESYSTHHVDEKLVNSSTLSMLED 360

Query: 322 VEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           ++  +A  +       +     + +K+  +S+ +Y+
Sbjct: 361 LDYASAITEFEKQQLALNAVSSVFSKVGSVSLFDYI 396


>gi|91225880|ref|ZP_01260849.1| flagellar hook-associated protein L [Vibrio alginolyticus 12G01]
 gi|269965417|ref|ZP_06179536.1| flagellar hook-associated protein [Vibrio alginolyticus 40B]
 gi|91189530|gb|EAS75806.1| flagellar hook-associated protein L [Vibrio alginolyticus 12G01]
 gi|269829896|gb|EEZ84126.1| flagellar hook-associated protein [Vibrio alginolyticus 40B]
          Length = 397

 Score =  144 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 43/397 (10%), Positives = 110/397 (27%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             T IS+   ++ +    +          E++ +G+              I    Q++  
Sbjct: 1   MLTRISSFHNYQSVQNDLRRQENKVHHNQEQLASGKKLLKPSDDPLAAHYIQNISQQQEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L S  LV  RL   + ++++ +    +     + ++ G             L +  
Sbjct: 61  LQQYLSSIVLVRNRLENHEVNIANAENFADESKRLTMEMINGAFSAEDRQAKKRELEEIA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+   N  DE           +          S+     D   +  +    +  +   
Sbjct: 121 NNFLNLVNSQDESGNYVFAGTKPKSQPFYRDKDGSVQYAGDDYQRKMKVSSMLEMPMNDP 180

Query: 182 HLEVSSMNAQQMTDF--------------IKQLEDKFSDDEYWANNWSNASDHNIKYRIK 227
             ++         D+               K       DD  +   + + ++    Y+++
Sbjct: 181 GSKLFMEIPNPFGDYQPNYDLQNGSELLLNKATNVDAKDDAAYRVTFVDMNNGKFGYQLE 240

Query: 228 DTE---------------------------GIDVSANVNMRGIRDIMFVAVIGTEFLSKN 260
                                             S  +  R    I         +  K+
Sbjct: 241 RNGKVVDADEFSPEKGIEYKGLKVHVKGQITPGDSIEIEKRAEFSIFDTFKDAMAWSDKS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      +M          + + R   G     ++ +    ++ N  +    S   
Sbjct: 301 VSDTSATAKLHQMTEEFHAAFIHLNKARTDAGARLSTLDIQEQNHEDFNLSLAKAKSNFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + S     ++ S     K + L++ NY+
Sbjct: 361 DLDYSKAVIEFSENSRALQASQQAFGKTKDLTLFNYI 397


>gi|46394806|gb|AAS91571.1| flagellin subunit C [Vibrio fischeri ES114]
          Length = 400

 Score =  144 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 37/367 (10%), Positives = 98/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  ++T+                  +  E + +G   +      A +        +   
Sbjct: 24  MSITVNTNVSAMTAQRYLNNATDGVNQSMERLSSGFKINSAKDDAAGLQISNRLTSQSRG 83

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    +        +    
Sbjct: 84  LDVAVRNANDGISIAQTAEGAMNESTNILQRMRDLSLQSANGSNTTSDREAIQQEVGALN 143

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K              S + M          S  A  
Sbjct: 144 DELNRIAETTSFGGSRLLNGQFGTKSFQIGADSGEAVMLSLNNMRSDSASMGGTSYKAET 203

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            L        + ++      ++  +++    N  +  D        + +   ++A+V+  
Sbjct: 204 ALGGDWAVNAEKSELTVSYVNRAGEEKELTINAKSGDDIEQVATYINGQTDAINASVSEN 263

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I+                         +  +    D      ++K ++ +   +  
Sbjct: 264 GELQIVTSNDKVQGEVKFGGSLAGELNMGAAQAETVKSIDVTTVGGSQKAVAILDAAMQF 323

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   +     L N N  +    S+   V+      +++      + S  
Sbjct: 324 VDSNRADLGAFQNRFSHAINNLDNINENVSASNSRIKDVDFAKETTEMTKSQILQQASSS 383

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 384 ILAQAKQ 390


>gi|323498413|ref|ZP_08103409.1| flagellar hook-associated protein FlgL [Vibrio sinaloensis DSM
           21326]
 gi|323316486|gb|EGA69501.1| flagellar hook-associated protein FlgL [Vibrio sinaloensis DSM
           21326]
          Length = 397

 Score =  144 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 31/397 (7%), Positives = 105/397 (26%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +           ++ +G+              I    Q+K  
Sbjct: 1   MLNRISSFHNYQSVQNDLRRQESKVHHNQAQLASGKKLMKASDDPLATHYIQNIGQQKEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   +  L   RL   +  +S+ ++   +    ++ ++ G             + +  
Sbjct: 61  LRQYSDAIVLTRNRLEHHEVIISNAEEFADEAKRTVMEMINGALSPEDRFAKRREIEEIS 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+   N+ DE           +           +     D   +  +  + +  +   
Sbjct: 121 NNFLNLVNVQDESGNYIFAGTKPKNQPFFRDKDADVVYAGDDYQRKMKISNSLEMPINDP 180

Query: 182 HLEVSSMNAQQMTDFIK--------------QLEDKFSDDEYWANNWSNASDHNIKYRIK 227
             ++         DF                 +     D   +   + +  +    Y+++
Sbjct: 181 GSKLFMEIDNPFGDFSPKYDLKEASELLLERAINLNPDDQSTYKVTFVDMPEGKYGYQLE 240

Query: 228 DTEGIDVSANVNMRGIRDIMFVAVIG---------------------------TEFLSKN 260
               +  +   +         V +                                   +
Sbjct: 241 RDGSVVQADTFDPSKGIKYEDVTIQVKGQITKGDAIELEPQRTYSIFETFKEAMALSEGS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      ++          + + R  +G     ++ +    ++    +    S   
Sbjct: 301 VSDSSNTAQLHQITQEFHAAFIHLNKARTDVGARLSTLDIQEEQHEDFKMTLAKSQSNFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + +     ++ S     K + L++ NY+
Sbjct: 361 DLDYAAAIIEFNENSRALQASQQAFGKTKDLTLFNYI 397


>gi|254506908|ref|ZP_05119047.1| flagellin FlaB [Vibrio parahaemolyticus 16]
 gi|219550193|gb|EED27179.1| flagellin FlaB [Vibrio parahaemolyticus 16]
          Length = 376

 Score =  144 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 39/366 (10%), Positives = 98/366 (26%), Gaps = 17/366 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+              +   K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRHLNGAAEGMQKSMERLSSGYKINSARDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDMAVKNANDGISIAQTAEGAMNESTNILQRMRDLALQSSNGSNSRSERIAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +      +     + S   M     +   K+ +A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYGSQSFQIGASSGEAVQLSMGNMRSDTADMGGKAYVAEE 180

Query: 182 HLEVSSMNAQQMTDFIK-----------QLEDKFSDDEYWANNWSNASDHNIKYRIKDTE 230
                   +      +             +  K  DD      + N    ++K  + +  
Sbjct: 181 GKGADWRVSDNTDLTLGYTDVHGEEKELTINAKVGDDIEQVATYINGQSEDVKASVGEDG 240

Query: 231 GIDVSANVNMRGIRDIMFVAVIGTEFLSKNLT------DGARNVLTKKMLSTVQQGLSGI 284
            + + A  N       +   + G               D      ++  +S +   L  +
Sbjct: 241 KLQLFAATNKVATDVEITGGLGGEIGFGDAQNKTVADVDVTTVAGSQMAVSIIDGALKNV 300

Query: 285 IEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMI 344
             QRA LG  +         L N N  ++   S+ +  +       ++      + S  I
Sbjct: 301 DSQRAGLGAFQNRFGHAINNLDNINENVNASRSRILDTDFAKETTAMTKSQILQQASTSI 360

Query: 345 TTKLQK 350
             + ++
Sbjct: 361 LAQAKQ 366


>gi|167623368|ref|YP_001673662.1| flagellar hook-associated protein FlgL [Shewanella halifaxensis
           HAW-EB4]
 gi|167353390|gb|ABZ76003.1| flagellar hook-associated protein 3 [Shewanella halifaxensis
           HAW-EB4]
          Length = 396

 Score =  144 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 51/396 (12%), Positives = 118/396 (29%), Gaps = 42/396 (10%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST+ +F +      +    + ++ E++ TG+  +           I    Q+ + + 
Sbjct: 1   MRISTAQMFHQNINSVTQKQSQTSQIIEQLSTGKRVNTAGDDPVAAAGINNLNQKNSVVD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + L +      RLS S++ L S   +   +   ++  + G   ++     A  +R S E 
Sbjct: 61  QFLKNIDYAKNRLSISESKLGSAATLASSVREQVLRAVNGSLTDSDRQTVADEMRGSLEE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +  AN  DE      G  ++      +    +        + +  +   +         
Sbjct: 121 LMAIANSKDESGNYLFGGFNTGSQPFEFDASGNAVYHGDSGVRESVVASGTTIGANIPGD 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFS---------------------------------DDEYW 210
                 A  + D+        +                                 D    
Sbjct: 181 LAFMNAANGLGDYSVNYLATQTGEFNVESAKVTDPATHVPDTYTFNMVGNDLEVRDSTNA 240

Query: 211 ANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSK---------NL 261
                 A D N        E                    V   + ++           +
Sbjct: 241 VVTTVTAFDPNTPVSFNGIEVKLDGKPAPGDSFTMEHAPEVSLLDTINSAIALIEDPNKV 300

Query: 262 TDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIG 321
              A      +ML+ +  G++ +   R V G S K+++      + +  + ++ +S    
Sbjct: 301 NTPAGKSELAQMLNNIDSGMNQLDLARGVAGNSLKSLDSYAATHEEEQIVNNSALSMLED 360

Query: 322 VEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           ++   A  QL      +  +  + TK+  +S+ +Y+
Sbjct: 361 LDYAEAITQLEQQQQALNAASSVFTKVGTVSLFDYI 396


>gi|154710458|gb|ABS84298.1| FlkA [Escherichia coli]
          Length = 368

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 37/360 (10%), Positives = 94/360 (26%), Gaps = 9/360 (2%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+         +         E + +G   +      A       +      
Sbjct: 1   MAQVINTNSLSLLTQNNLNKSQSSLSSAIERLSSGLRINSAKDDAAGQAIANRFTSNIKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L  +   +Q +    V    G    +        +    
Sbjct: 61  LTQASRNANDGISVAQTTEGALGEINNNLQRIRELTVQATNGTNSQSDMESIQAEITQRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  T+       G + + K   G     S+               +   +   Q
Sbjct: 121 DEIDRVSQQTEFNGVSVLGEDKTLKIQVGANDNQSIDINLKKIDSTVLKLRDLDVVSETQ 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
           + + ++     + D         +  E   +         +            +A+V+  
Sbjct: 181 YKDGATTLKGDIKDSTSVQGKFDTTSEAAISFKDGKYYAVVSKSTTTDNNGIYAASVDSD 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT---------DGARNVLTKKMLSTVQQGLSGIIEQRAVLG 292
           G   I     +  +                D      T   LS +   +S +   R+ LG
Sbjct: 241 GNVTIDASKKVTVDLADAAGDLTKTKVVDEDATAATKTSNPLSKIDDAISDVDSLRSDLG 300

Query: 293 ISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLS 352
             +   +     L N  N + +  S+    +  T  + +S      +    +  +  + +
Sbjct: 301 AVQNRFDSAITNLGNTVNNLSSARSRIEDSDYATEVSNMSRAQILQQAGTSVLAQANQTT 360


>gi|258621094|ref|ZP_05716128.1| Flagellin D [Vibrio mimicus VM573]
 gi|258626167|ref|ZP_05721015.1| Flagellin D [Vibrio mimicus VM603]
 gi|262170870|ref|ZP_06038548.1| flagellin protein FlaD [Vibrio mimicus MB-451]
 gi|258581522|gb|EEW06423.1| Flagellin D [Vibrio mimicus VM603]
 gi|258586482|gb|EEW11197.1| Flagellin D [Vibrio mimicus VM573]
 gi|261891946|gb|EEY37932.1| flagellin protein FlaD [Vibrio mimicus MB-451]
          Length = 377

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 44/367 (11%), Positives = 96/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRYLNGATNAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         S K              +   M          S +A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFSTKSFQIGADNGEAVMLTLKDMRSDNRMMGGTSYVATE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D    L+D   +D+    N     D        + +   V A+VN +
Sbjct: 181 GKDKDWKVQAGANDITFTLKDIDGNDQTITVNAKEGDDIEEVATYINGQTDMVKASVNEK 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I       T                  +  + +  D       ++ ++ +   L  
Sbjct: 241 GQLQIFAGNNKVTGDVAFSGGLAGALNMQAGKAETVDTMDVTSVGGAQQSVAVIDSALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTALTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|83589599|ref|YP_429608.1| flagellar hook-associated protein FlgL [Moorella thermoacetica ATCC
           39073]
 gi|83572513|gb|ABC19065.1| Flagellin-like protein [Moorella thermoacetica ATCC 39073]
          Length = 305

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 43/354 (12%), Positives = 97/354 (27%), Gaps = 50/354 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++   +   +        ++  +  E+M +G+  +        V  +L ++       
Sbjct: 1   MRVTNRMLNNNVIRNINRNLENMARTQEQMSSGKRVNRPSDDPIVVARVLAFKTSIAAND 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       L  S++ L     ++Q      V    G             +    + 
Sbjct: 61  QYKKNMEDAKGWLDASESVLGMATDVLQRARELAVYGSNGTMPPESMDALGKEVDQLLDE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +  AN +  G+Y+F G  ++  P                                    
Sbjct: 121 MMQVANTSYGGRYIFGGSQTTATPF----------------------------------- 145

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
                    +++     +    + +  A NW  A    I       +    + N      
Sbjct: 146 ---------VSNSSSTDDPVEYNGDSAALNWEIAPGVTISVNENGDQIFMQAINNGSATE 196

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                +  +         TD +        L+   Q +  I+  RA LG     +     
Sbjct: 197 SIFKLLNDLSAALHGGTATDVSAT------LNKFDQAIDHILNIRATLGAKSNRMEMAMS 250

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L++    +   +SK   ++         T  N    S     K+ + S+++YL
Sbjct: 251 RLEDTQIGLTQTMSKLEDIDLAETVMNYKTQENVYLASLSTGAKVLQPSLIDYL 304


>gi|197335550|ref|YP_002156689.1| flagellin subunit C [Vibrio fischeri MJ11]
 gi|197317040|gb|ACH66487.1| flagellin subunit C [Vibrio fischeri MJ11]
          Length = 377

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 39/367 (10%), Positives = 98/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  ++T+                  +  E + +G   +      A +        +   
Sbjct: 1   MSITVNTNVSAMTAQRYLNNATDGVNQSMERLSSGFKINSAKDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    +        +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNESTNILQRMRDLSLQSANGSNTTSDREAIQQEVGALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K              S + M          S  A  
Sbjct: 121 DELNRIAETTSFGGSRLLNGQFGTKSFQIGADSGEAVMLSLNNMRSDSASMGGTSYKAET 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            L        + +D      ++  +++    N  +  D        + +   V+A+V+  
Sbjct: 181 ALGGDWAVNAEKSDLTVSYVNRAGEEKELTINAKSGDDIEQVATYINGQTDAVNASVSEN 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I+                         +  +    D      ++K ++ +   +  
Sbjct: 241 GELQIVTSNDKVQGEVKFGGSLAGELNMGAAQAETVKSIDVTTVGGSQKAVAILDAAMQF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   +     L N N  +    S+   V+      +++      + S  
Sbjct: 301 VDSNRADLGAFQNRFSHAINNLDNINENVSASNSRIKDVDFAKETTEMTKSQILQQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|332188355|ref|ZP_08390080.1| flagellin protein FlaA [Sphingomonas sp. S17]
 gi|332011584|gb|EGI53664.1| flagellin protein FlaA [Sphingomonas sp. S17]
          Length = 372

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 35/361 (9%), Positives = 86/361 (23%), Gaps = 13/361 (3%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
            T I+T+    R    T+  N D  +    + +GQ  +      A +        +   +
Sbjct: 1   MTVINTNGAALRAMAATQRANTDLAQSMARLSSGQRINSAKDDAAGLAISSSMTAQIRGM 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
           ++ + +       + T+   LS +  ++Q +    V    G             +     
Sbjct: 61  SQGIRNAMDGVSLIQTADGVLSEVSNMLQRVRELAVQAGSGTYSMTDRAALQKEVTALAT 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                              N+     +      S+                S   +  + 
Sbjct: 121 QIDQTIRSASFNGVALFNANAPIYDADNNLVDASVKLNVQAGPNIADTIPVSIDPVPIEF 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDE-------------YWANNWSNASDHNIKYRIKDT 229
           +          +   +    K+ D                     + A     +   +  
Sbjct: 181 VRDDVDGYWGWSYHGRLTNPKYRDQSQSHLVTFDDYMARGKIAGTTVARQDIGRIVYQSD 240

Query: 230 EGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRA 289
                  N       D         +F   +  +      T   +  V   LS +   + 
Sbjct: 241 GDQWYDPNGPTYDPGDTYDAYTARRQFSLVDELNVMNRYRTDHTMGRVDALLSTVASVQG 300

Query: 290 VLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQ 349
            LG +   +      L +    +    S+    +      +L+      + S  +  +  
Sbjct: 301 QLGATGNRLESAIATLTSGTTNLSEARSRIADTDYSDESVKLARAQILAQASTAMLAQAN 360

Query: 350 K 350
           +
Sbjct: 361 Q 361


>gi|71067029|gb|AAZ22698.1| flagellin [Bacillus cereus]
          Length = 397

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 31/363 (8%), Positives = 89/363 (24%), Gaps = 16/363 (4%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +         ++ + 
Sbjct: 25  MRINTNINSMRTQEYMRQNQAKMSNAMDRLSSGKRINNASDDAAGLAIATRMRARESGLG 84

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       + T+ + L+S+  I+  M         G   N           +  E 
Sbjct: 85  VASNNTQDGMSLIRTADSALNSVSNILLRMRDLANQSANGTNTNENKAAMQKEFGELKEQ 144

Query: 124 FVTFANMTDEGQYL----------------FSGINSSEKPLNGYFTKDSLAKKSFDQMLQ 167
               A  T                          + S++           A    D  + 
Sbjct: 145 IKYIAENTQFNDQHLLNADKGITKEIAIQTLDSDSDSKQIKIKLQGSSLEALDIKDLQIG 204

Query: 168 GFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIK 227
                     L    ++          D   Q      D        S++     +    
Sbjct: 205 NTELAQKDLDLLNATMDRLDATVPGTRDVDVQAAKDAFDKVKGFYTNSDSVKAIERAFED 264

Query: 228 DTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQ 287
                                  +   +           +  +   ++ +   L  + + 
Sbjct: 265 YATASTAGTAKADAATAIKAAFDLAANKVGKPATGGAQGSANSLGAITKIDAALKTVADN 324

Query: 288 RAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTK 347
           RA LG +   ++     L+++ + +    S+    +     ++++      E    + ++
Sbjct: 325 RATLGATLNRLDFNVNNLKSQASSMAAAASQVEDADMAKEMSEMTKFKILNEAGISMLSQ 384

Query: 348 LQK 350
             +
Sbjct: 385 ANQ 387


>gi|15642142|ref|NP_231774.1| flagellin [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121586802|ref|ZP_01676584.1| flagellin FlaD [Vibrio cholerae 2740-80]
 gi|121727182|ref|ZP_01680349.1| flagellin FlaD [Vibrio cholerae V52]
 gi|147675484|ref|YP_001217666.1| flagellin [Vibrio cholerae O395]
 gi|153213251|ref|ZP_01948663.1| flagellin FlaD [Vibrio cholerae 1587]
 gi|153801626|ref|ZP_01956212.1| flagellin FlaD [Vibrio cholerae MZO-3]
 gi|153818799|ref|ZP_01971466.1| flagellin FlaD [Vibrio cholerae NCTC 8457]
 gi|153822611|ref|ZP_01975278.1| flagellin FlaD [Vibrio cholerae B33]
 gi|153825621|ref|ZP_01978288.1| flagellin FlaD [Vibrio cholerae MZO-2]
 gi|153828611|ref|ZP_01981278.1| flagellin FlaD [Vibrio cholerae 623-39]
 gi|227082268|ref|YP_002810819.1| flagellin FlaD [Vibrio cholerae M66-2]
 gi|229507772|ref|ZP_04397277.1| flagellin protein FlaD [Vibrio cholerae BX 330286]
 gi|229511991|ref|ZP_04401470.1| flagellin protein FlaD [Vibrio cholerae B33]
 gi|229513794|ref|ZP_04403256.1| flagellin protein FlaD [Vibrio cholerae TMA 21]
 gi|229519127|ref|ZP_04408570.1| flagellin protein FlaD [Vibrio cholerae RC9]
 gi|229522096|ref|ZP_04411513.1| flagellin protein FlaD [Vibrio cholerae TM 11079-80]
 gi|229528845|ref|ZP_04418235.1| flagellin protein FlaD [Vibrio cholerae 12129(1)]
 gi|229607317|ref|YP_002877965.1| flagellin [Vibrio cholerae MJ-1236]
 gi|254291380|ref|ZP_04962173.1| flagellin FlaD [Vibrio cholerae AM-19226]
 gi|254849229|ref|ZP_05238579.1| flagellin FlaD [Vibrio cholerae MO10]
 gi|255745120|ref|ZP_05419069.1| flagellin protein FlaD [Vibrio cholera CIRS 101]
 gi|262153492|ref|ZP_06028622.1| flagellin protein FlaD [Vibrio cholerae INDRE 91/1]
 gi|262167502|ref|ZP_06035208.1| flagellin protein FlaD [Vibrio cholerae RC27]
 gi|262192270|ref|ZP_06050427.1| flagellin protein FlaD [Vibrio cholerae CT 5369-93]
 gi|298497835|ref|ZP_07007642.1| flagellin FlaD [Vibrio cholerae MAK 757]
 gi|172044518|sp|P0C6C6|FLAD_VIBCH RecName: Full=Flagellin D
 gi|172047634|sp|A5F6C5|FLAD_VIBC3 RecName: Full=Flagellin D
 gi|9656695|gb|AAF95288.1| flagellin FlaD [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121548969|gb|EAX59008.1| flagellin FlaD [Vibrio cholerae 2740-80]
 gi|121630427|gb|EAX62820.1| flagellin FlaD [Vibrio cholerae V52]
 gi|124116051|gb|EAY34871.1| flagellin FlaD [Vibrio cholerae 1587]
 gi|124122803|gb|EAY41546.1| flagellin FlaD [Vibrio cholerae MZO-3]
 gi|126510642|gb|EAZ73236.1| flagellin FlaD [Vibrio cholerae NCTC 8457]
 gi|126519859|gb|EAZ77082.1| flagellin FlaD [Vibrio cholerae B33]
 gi|146317367|gb|ABQ21906.1| flagellin FlaD [Vibrio cholerae O395]
 gi|148875882|gb|EDL74017.1| flagellin FlaD [Vibrio cholerae 623-39]
 gi|149740772|gb|EDM54871.1| flagellin FlaD [Vibrio cholerae MZO-2]
 gi|150422710|gb|EDN14664.1| flagellin FlaD [Vibrio cholerae AM-19226]
 gi|227010156|gb|ACP06368.1| flagellin FlaD [Vibrio cholerae M66-2]
 gi|227014039|gb|ACP10249.1| flagellin FlaD [Vibrio cholerae O395]
 gi|229332619|gb|EEN98105.1| flagellin protein FlaD [Vibrio cholerae 12129(1)]
 gi|229341021|gb|EEO06026.1| flagellin protein FlaD [Vibrio cholerae TM 11079-80]
 gi|229343816|gb|EEO08791.1| flagellin protein FlaD [Vibrio cholerae RC9]
 gi|229348975|gb|EEO13932.1| flagellin protein FlaD [Vibrio cholerae TMA 21]
 gi|229351956|gb|EEO16897.1| flagellin protein FlaD [Vibrio cholerae B33]
 gi|229355277|gb|EEO20198.1| flagellin protein FlaD [Vibrio cholerae BX 330286]
 gi|229369972|gb|ACQ60395.1| flagellin protein FlaD [Vibrio cholerae MJ-1236]
 gi|254844934|gb|EET23348.1| flagellin FlaD [Vibrio cholerae MO10]
 gi|255736950|gb|EET92346.1| flagellin protein FlaD [Vibrio cholera CIRS 101]
 gi|262024074|gb|EEY42769.1| flagellin protein FlaD [Vibrio cholerae RC27]
 gi|262030729|gb|EEY49363.1| flagellin protein FlaD [Vibrio cholerae INDRE 91/1]
 gi|262031880|gb|EEY50461.1| flagellin protein FlaD [Vibrio cholerae CT 5369-93]
 gi|297542168|gb|EFH78218.1| flagellin FlaD [Vibrio cholerae MAK 757]
          Length = 377

 Score =  143 bits (360), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 43/367 (11%), Positives = 95/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRYLTGATNAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         S K              +   M          S +A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFSTKSFQIGADNGEAVMLTLKDMRSDNRMMGGTSYVAAE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D    L+D   +D+    N     D        + +   V A+VN +
Sbjct: 181 GKDKDWKVQAGANDITFTLKDIDGNDQTITVNAKEGDDIEEVATYINGQTDMVKASVNEK 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I       T                     + +  D       ++ ++ +   L  
Sbjct: 241 GQLQIFAGNNKVTGDVAFSGGLAGALNMQAGTAETVDTIDVTSVGGAQQSVAVIDSALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTALTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|260767716|ref|ZP_05876651.1| flagellin protein FlaD [Vibrio furnissii CIP 102972]
 gi|260617225|gb|EEX42409.1| flagellin protein FlaD [Vibrio furnissii CIP 102972]
 gi|315179452|gb|ADT86366.1| polar flagellin [Vibrio furnissii NCTC 11218]
          Length = 377

 Score =  143 bits (360), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 43/362 (11%), Positives = 91/362 (25%), Gaps = 18/362 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             +       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNSASNAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSSNGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K              S   M          S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFQTKSFQIGADNGEAVMLSLKDMRSDNRMMGGSSYQAEN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +    Q   D    L D   +++    N     D        + +   V A+VN +
Sbjct: 181 AKDKNWSVEQGKNDLTITLNDDKGNEQSININAKAGDDIEELATYINGQTDMVKASVNEK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +       +  +S +                    D       ++ ++ V   L  
Sbjct: 241 GQLQVFAGNNKVSGEVSFSGGLAGELGMKEGKEVTVDKIDVTSVGGAQESVAIVDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTALTKSQILSQASSS 360

Query: 344 IT 345
           + 
Sbjct: 361 VL 362


>gi|262404489|ref|ZP_06081044.1| flagellin protein FlaD [Vibrio sp. RC586]
 gi|262349521|gb|EEY98659.1| flagellin protein FlaD [Vibrio sp. RC586]
          Length = 377

 Score =  143 bits (360), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 44/367 (11%), Positives = 96/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNGATNAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         S K              +   M          S +A +
Sbjct: 121 DELNRVAETTSFGGNKLLNGTFSTKSFQIGADNGEAVMLTLKDMRSDNRMMGGTSYVATE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D    L+D   +D+    N     D        + +   V A+VN +
Sbjct: 181 GKDKDWKVQAGANDITFTLKDIDGNDQTITVNAKEGDDIEEVATYINGQTDMVKASVNEK 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I       T                  +  + +  D       ++ ++ +   L  
Sbjct: 241 GQLQIFAGNNKVTGDVAFSGGLAGALNMQAGKAETVDTMDVTSVGGAQQSVAVIDSALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTALTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|94500249|ref|ZP_01306782.1| Flagellin and related hook-associated protein [Oceanobacter sp.
           RED65]
 gi|94427548|gb|EAT12525.1| Flagellin and related hook-associated protein [Oceanobacter sp.
           RED65]
          Length = 412

 Score =  143 bits (360), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 40/412 (9%), Positives = 106/412 (25%), Gaps = 58/412 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST   F           + + +  +++ +G+            T IL+ +Q+ +   
Sbjct: 1   MRISTMQQFNSGLRSILNNQESTQRTQQQISSGRRVLTPADDPIAATQILQLQQDISLRD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + +    RL+   + L  +   +  +    V    G          A  + +  ++
Sbjct: 61  QYEKNITSARNRLNLEDSILGGVIDNIDRIRELTVNAGNGSMTKEDRGYIASEIEERLDA 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V   N  D       G    E           +  +  D      +  ++K   +    
Sbjct: 121 LVDLMNTKDASNTYIFGGFKGETVPFQERPGGGVTYQGDDGERFLEISNSTKIQTSDTGK 180

Query: 184 EVSSMNAQQMTDFIK-----------------------------------QLEDKFSDDE 208
            +          F                                       +   +   
Sbjct: 181 NIFVDVQSAQNTFYTRDNERNLGTGFISNGFVMDQEAYDEFYPEDIVIRFNPDGFITPPG 240

Query: 209 YWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNV 268
              +  S + +  I               V     +         + F++ +      + 
Sbjct: 241 PNFSVLSQSDNRPIDGLAGVAYSPGTELVVKGAAFKIAGQPEQGDSFFVTSSPKQSLTDT 300

Query: 269 LTKKMLS----------------TVQQGLSGIIEQRAV-------LGISEKNINEERVFL 305
           +   M                   ++  L+ +   +         +G     ++      
Sbjct: 301 VASLMEGLRTLEDNPEQSAQLDVLIENTLNNLDFAQTSVSEVRSEVGGRLNTVDNIESLH 360

Query: 306 QNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           ++ + +    +S+   V+   A ++LS     +E S     ++ +L++ N L
Sbjct: 361 KDVDLVSQDILSQLQDVDFAEAVSRLSLESLLLEASQQSFAQINRLTLFNQL 412


>gi|254226371|ref|ZP_04919960.1| flagellin FlaD [Vibrio cholerae V51]
 gi|297582041|ref|ZP_06943960.1| flagellin FlaD [Vibrio cholerae RC385]
 gi|125621121|gb|EAZ49466.1| flagellin FlaD [Vibrio cholerae V51]
 gi|297533736|gb|EFH72578.1| flagellin FlaD [Vibrio cholerae RC385]
          Length = 377

 Score =  143 bits (360), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 43/367 (11%), Positives = 95/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRYLTGATNAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         S K              +   M          S +A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFSTKSFQIGADNGEAVMLTLKDMRSDNRMMGGTSYVATE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D    L+D   +D+    N     D        + +   V A+VN +
Sbjct: 181 GKDKDWKVQAGANDITFTLKDIDGNDQTITVNAKEGDDIEEVATYINGQTDMVKASVNEK 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I       T                     + +  D       ++ ++ +   L  
Sbjct: 241 GQLQIFAGNNKVTGDVAFSGGLAGALNMQAGTAETVDTIDVTSVGGAQQSVAVIDSALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTALTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|59712471|ref|YP_205247.1| flagellin [Vibrio fischeri ES114]
 gi|59480572|gb|AAW86359.1| Flagellin FlaC [Vibrio fischeri ES114]
          Length = 377

 Score =  143 bits (360), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 37/367 (10%), Positives = 98/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  ++T+                  +  E + +G   +      A +        +   
Sbjct: 1   MSITVNTNVSAMTAQRYLNNATDGVNQSMERLSSGFKINSAKDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    +        +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNESTNILQRMRDLSLQSANGSNTTSDREAIQQEVGALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K              S + M          S  A  
Sbjct: 121 DELNRIAETTSFGGSRLLNGQFGTKSFQIGADSGEAVMLSLNNMRSDSASMGGTSYKAET 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            L        + ++      ++  +++    N  +  D        + +   ++A+V+  
Sbjct: 181 ALGGDWAVNAEKSELTVSYVNRAGEEKELTINAKSGDDIEQVATYINGQTDAINASVSEN 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I+                         +  +    D      ++K ++ +   +  
Sbjct: 241 GELQIVTSNDKVQGEVKFGGSLAGELNMGAAQAETVKSIDVTTVGGSQKAVAILDAAMQF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   +     L N N  +    S+   V+      +++      + S  
Sbjct: 301 VDSNRADLGAFQNRFSHAINNLDNINENVSASNSRIKDVDFAKETTEMTKSQILQQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|320157097|ref|YP_004189476.1| flagellin protein FlaE [Vibrio vulnificus MO6-24/O]
 gi|319932409|gb|ADV87273.1| flagellin protein FlaE [Vibrio vulnificus MO6-24/O]
          Length = 375

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 32/366 (8%), Positives = 92/366 (25%), Gaps = 19/366 (5%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              ++T+                  +  + + +G   +      A +        +   +
Sbjct: 1   MVSLNTNVSAMVAQRHLSTAASQVAETQKNLSSGFRINSASDDAAGMQIANTLHVQTRGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
              L +         T++  L    +I+Q +    +    G   ++        +    +
Sbjct: 61  DVALTNAHSAYAVAETAEGALEEGSEILQRLRSLSLQAANGSNSDDDRQSLQLEVVVLKD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                A  T          +   K  +     +S        M     E      LA + 
Sbjct: 121 EVERIARTTTFAGKNLFDGSYGSKSFHLGANSNS-ISLQLKNMRTHIPEMGGYHYLASEP 179

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
            +      ++         D   DD+    +              +++   V ++V    
Sbjct: 180 ADDDWQVDKESRQLSFTFRDSEGDDQSIKISLKPGDSLEEVATYINSQQNVVESSVTDDR 239

Query: 243 IRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSGI 284
                       + L+ + +                  D +     +  ++ V   +  +
Sbjct: 240 RLQFYVANRHAPDGLNISGSLEGELDFESQGQVTLDDLDISSVGGAQLAIAVVDTAIQYL 299

Query: 285 IEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMI 344
              R+ +G  +  +      LQ+ N  +     +    +   A   L       + +  +
Sbjct: 300 DSHRSEIGSFQNRVEGTMDNLQSINRNVTESKGRIWDTDFAKASTALVKSQVLQQATSAL 359

Query: 345 TTKLQK 350
             + ++
Sbjct: 360 LAQAKQ 365


>gi|238920295|ref|YP_002933810.1| flagellin [Edwardsiella ictaluri 93-146]
 gi|182342508|gb|ACB87393.1| flagellin 3 [Edwardsiella ictaluri]
 gi|238869864|gb|ACR69575.1| flagellin [Edwardsiella ictaluri 93-146]
          Length = 352

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 30/351 (8%), Positives = 87/351 (24%), Gaps = 7/351 (1%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+ +  +      +         E + +G   +      A       +    N 
Sbjct: 1   MAQVINTNILSLQAQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANRFTANING 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q++    V    G    +        +    
Sbjct: 61  LTQASRNANDGISLAQTTEGALNEVNDNLQNIRRLTVQAQNGSNSESDLQSIQDEITQRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  TD         + +     G     ++                   +  G 
Sbjct: 121 DEINRISAQTDFNGVKVLSKDQTLTIQVGADDGQTIGINLRQIDAGKLGLSTFSVMTKGT 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            +  +      +   +                    +       +  T     +      
Sbjct: 181 RVGDAVAAGTMVPATVGGKMVAVKAPAA-------GTGGATTSLVSGTSKDGQAGYYIKT 233

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
                       +      +  GA     +  L+T+ + LS + + R+ LG  +   +  
Sbjct: 234 VDAKGAATYTEASIGADGTVKAGAAVTDLQTPLATLDKALSQVDDLRSGLGAVQNRFDSV 293

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLS 352
              L +    +    S+    +  T  + +S      +    +  K  + +
Sbjct: 294 ISNLDSTVTNLSASRSRIQDADYATEVSDMSRAQILQQAGTAVLAKANQST 344


>gi|52841458|ref|YP_095257.1| flagellar hook-associated protein FlgL [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|52628569|gb|AAU27310.1| flagellar hook associated protein type 3 FlgL [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 411

 Score =  143 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 40/411 (9%), Positives = 104/411 (25%), Gaps = 57/411 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST+ I++R         +   +L ++  +G               I   +Q  N+I 
Sbjct: 1   MRISTNQIYQRGLDNLLTQQERLARLQDQQASGIRVRTPSDDPVASAQIELIKQRINNIE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       L   +  LS+    +  +    +               A   +     
Sbjct: 61  LFQNNRQAADSALRLEEGILSNAVNSLHRLREIQIQAGNPSLSEEDRKTLAVEAQALLNQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            + +AN  D         + S                         +  +    +     
Sbjct: 121 LLDYANTKDSNGSYMFSGSKSLTQPVSLNLSGQYVYNGDSTQRFQAVTTSLLVAVNDTGD 180

Query: 184 EV-----------------SSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRI 226
            V                 +               +     + +   ++  S  N+   +
Sbjct: 181 NVFMRIPSGNGRFAIRETLTPNTGTASVSSGSVTNEAAFVPDNYTMTFALNSQGNLVVMV 240

Query: 227 ----------------------------------------KDTEGIDVSANVNMRGIRDI 246
                                                   K  +   +S   N      +
Sbjct: 241 SGTLSGNVIPPSGLPDDAPLYQEGSAIGFNGMEMVVSGLPKAGDSFSISPAKNESIFSTV 300

Query: 247 MFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQ 306
             +     +  + ++   A      ++L+ +   L  I+  ++ LG     +        
Sbjct: 301 QRMINNLNKPYTSSVEKAATQTENNQLLAQIDSALGHILSVQSDLGARLNQLETAEKANN 360

Query: 307 NKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +  +I    + K   ++      +L+  +  ++ + +  T++Q LS+ N+L
Sbjct: 361 DYLDISAATLKKLREIDPVAVATELNLQLVNLQAAQLSFTRIQGLSLFNFL 411


>gi|254508441|ref|ZP_05120561.1| flagellin C [Vibrio parahaemolyticus 16]
 gi|219548651|gb|EED25656.1| flagellin C [Vibrio parahaemolyticus 16]
          Length = 377

 Score =  143 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 94/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             +       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRHLNAASNAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISMAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         + K              +   M          S +A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFATKSFQIGADNGEAVMLTMKNMRSDNTMMGGNSYVAAN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D    L DKF +++    N     D        + +   V A+V+  
Sbjct: 181 GQDADWAVQSGANDLTITLTDKFGEEQNIEINAKAGDDIEELATYINGQTDFVKASVDED 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +           +   +                  D       ++ ++ V   L  
Sbjct: 241 GQLQLFTDNNKVEGAATFGGSLAGDLDIGAAQAVTVDTIDVRSVGGAQQSVAIVDAALKF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAINNLDNINENVNASKSRIKDTDFAKETTALTKSQILTQASSS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|254506892|ref|ZP_05119031.1| flagellin D [Vibrio parahaemolyticus 16]
 gi|219550177|gb|EED27163.1| flagellin D [Vibrio parahaemolyticus 16]
          Length = 377

 Score =  143 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 36/367 (9%), Positives = 95/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRYLNSATNAQQTSMERLSSGSKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         + K +            + + M    +     S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFTTKSMQIGADNGEAVMLTLNDMRSDNVGMGGTSYKAEN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D    L  K  +++    +     D        + +   V A+V+  
Sbjct: 181 GKNKDWSVQAGSNDLTITLTPKDGEEQTINISAKEGDDIEELATYINGQTDMVKASVDED 240

Query: 242 GIRDIMFVAVI------------------GTEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +                          + ++ +  +       ++ ++ +   L+ 
Sbjct: 241 GKLQVFAGTNKVEGEVSFGGGLAGELGMQDGQAVTVDTINVTSVGGAQESVAIIDAALNY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       ++      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAINNLDNINENVNASKSRIKDTDFAKETTAMTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|90411012|ref|ZP_01219026.1| flagellar hook-associated protein [Photobacterium profundum 3TCK]
 gi|90328225|gb|EAS44536.1| flagellar hook-associated protein [Photobacterium profundum 3TCK]
          Length = 396

 Score =  143 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 42/396 (10%), Positives = 127/396 (32%), Gaps = 40/396 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             + I+    +  ++           +  +++ +G+              I  ++Q+   
Sbjct: 1   MISRIANFHHYNSVSNDMNRQQIKVQENQQQLASGKRLLTAGDDPVASIYIQNFDQQNTQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           I + + S ++   RL+  +A ++ ++ ++ D     ++++ G   ++    +   ++  +
Sbjct: 61  IDQSVKSITMARNRLNNEEAAITEVENLLDDAKRKSMMMVNGSLSSDDRVAHKQDMQGVF 120

Query: 122 ESFVTFANMTDEGQYL-FSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEE-------- 172
           +SF+   N  DE     F+G   S++P       D        Q +              
Sbjct: 121 DSFMNLVNSRDESGNYVFAGTQYSQQPFFRDNNGDVAYVGDSYQRMAKIAPSVDVPINDA 180

Query: 173 -----------------NSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWS 215
                            +         L   + N         +++   S        + 
Sbjct: 181 GDKLFLEVANPFGDYQPDYTLESGSLLLLSQAKNGNDADQSEYRVDFSTSSGSTSYELYQ 240

Query: 216 NASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTE--------------FLSKNL 261
           + +  +             +  V+++G         +  +                  ++
Sbjct: 241 DGALVSTAPFDPHKGIQWNTLQVDLKGEIKDGDSIALNRQENVSVFDAFKRGIELSDSDV 300

Query: 262 TDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIG 321
           +D +      ++   + QG   I   R+ +G   + ++ +    Q+   +++        
Sbjct: 301 SDASATAELHQVAEELAQGFKHINRARSEVGTRLQTLDRQEDMHQDFKIVMNEARGTLED 360

Query: 322 VEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           ++  TA  +L+  +  ++ S     K + L++ NY+
Sbjct: 361 LDYATAVIELNQNMMALQASQQAFAKTKDLNLFNYI 396


>gi|323495367|ref|ZP_08100444.1| flagellin [Vibrio brasiliensis LMG 20546]
 gi|323310290|gb|EGA63477.1| flagellin [Vibrio brasiliensis LMG 20546]
          Length = 377

 Score =  143 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 42/367 (11%), Positives = 94/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             +       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNSASNAQQASMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISMAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         + K              + + M          S +A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFATKSFQIGADNGEAVMLTMNNMRSDNAMMGGNSYVAAN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D    L DKF  ++  A N     D        + +   V A+V+  
Sbjct: 181 GQGKDWTVQGGANDLTITLTDKFGQEQNVAINAKAGDDIEELATYINGQTDLVKASVDQD 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +           +   +                  D       ++ ++ V   L  
Sbjct: 241 GKLQLFTDNNRVEGAAAFGGSLAGELGIGEAKAVTVDTIDVTSVGGAQESVAIVDAALKF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAINNLDNINENVNASKSRIKDTDFAKETTALTKSQILTQASSS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|260776494|ref|ZP_05885389.1| flagellin protein FlaD [Vibrio coralliilyticus ATCC BAA-450]
 gi|260607717|gb|EEX33982.1| flagellin protein FlaD [Vibrio coralliilyticus ATCC BAA-450]
          Length = 377

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 93/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRYLNGANNAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         + K              + + M    +     S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYATKSFQIGADNGEAVMLTLNDMRSDNVGMGGTSYQAAN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D    L D     +    N     D        + +   V A+V+  
Sbjct: 181 GKDKDWTVQAGANDLAITLTDTDGQQQTININAKEGDDIEELATYINGQTDMVKASVDQD 240

Query: 242 GIRDIMFVAV------------------IGTEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +                          + ++ +  D       ++ ++ +   L  
Sbjct: 241 GQLQVFAGTDKVEGAVSFGGGLAGELSMGQGQAVTVDTIDVTSVGGAQESVAIIDSALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTALTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|323491436|ref|ZP_08096620.1| flagellin [Vibrio brasiliensis LMG 20546]
 gi|323314305|gb|EGA67385.1| flagellin [Vibrio brasiliensis LMG 20546]
          Length = 377

 Score =  142 bits (358), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 95/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRYLNSANNAQQVSMERLSSGSKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         + K              + + M    +     S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYATKSFQIGADNGEAVMLTLNDMRSDNIGMGGTSYQAAN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D    L +K   ++    +     D        + +   V A+VN  
Sbjct: 181 SKDKDWTVQAGANDLAITLTEKDGAEQTINISAKAGDDIEELATYINGQTDMVKASVNED 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +                          + ++ +  D       ++ ++ V   L  
Sbjct: 241 GQLQVFAGNNKVEGAVSFAGGLAGELSMGEGKAVTVDTIDVTSVGGAQESVAIVDSALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAINNLDNINENVNASKSRIKDTDFAKETTALTKTQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|86146833|ref|ZP_01065152.1| flagellin [Vibrio sp. MED222]
 gi|85835285|gb|EAQ53424.1| flagellin [Vibrio sp. MED222]
          Length = 354

 Score =  142 bits (358), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 41/343 (11%), Positives = 95/343 (27%), Gaps = 18/343 (5%)

Query: 26  SVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLVTKRLSTSQAHLSS 85
             +  E + +G   +      A +      E + + I   + + +     + T++  ++ 
Sbjct: 2   LNQSLERLASGSRINSAKDDAAGLQISNRLEAQMSGIDVAVRNANDGISIMQTAEGAMNE 61

Query: 86  MQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANMTDEGQYLFSGINSSE 145
              I+Q M    +    G    ++       +    +     A  T  G       +   
Sbjct: 62  TTNIMQRMRDLSLQATNGSNSQSERTAIQEEVTALNDELNRIAETTSFGGKKLLNGSFGS 121

Query: 146 KPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFS 205
                  +           M    +     S +A      S       TD      D+F 
Sbjct: 122 SSFQIGGSSGEAVHIGLKNMRTDDINMGGFSYVANGMASDSWEVKSNQTDMTMAFTDRFG 181

Query: 206 DDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLT--- 262
             +    N     D        + +   VSA+VN  G   I          +S + +   
Sbjct: 182 QPQEININAKAGDDIEELATYINGQTDLVSASVNDEGQLQIYMSGEDTAGTISFSGSLAS 241

Query: 263 ---------------DGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQN 307
                          +       ++ +S +   +  +   R+ LG  +   +     L+N
Sbjct: 242 ELSMSAGYYESVDDINVTDVGGAQRAVSILDTAMKYVDSHRSELGAMQNRFDHAINNLEN 301

Query: 308 KNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            +  +    S+    +      Q+       ++S  I  + ++
Sbjct: 302 VHENLGASNSRIKDTDYAKETTQMLKQQILQQVSTTILAQAKQ 344


>gi|261209879|ref|ZP_05924180.1| flagellin protein FlaD [Vibrio sp. RC341]
 gi|260841065|gb|EEX67590.1| flagellin protein FlaD [Vibrio sp. RC341]
          Length = 377

 Score =  142 bits (358), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 43/367 (11%), Positives = 93/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRYLTGATNAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G             +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKADRVAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         S K              +   M          S +A +
Sbjct: 121 DELNRVAETTSFGGNKLLNGTFSTKSFQIGADNGEAVMLTLKDMRSDNRMMGGTSYVATE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +     A    D    L+D    D+    N     D        + +   V A+VN +
Sbjct: 181 SKDKDWKVAAGANDITFTLKDIDGQDQTITVNAKEGDDIEEVATYINGQTDMVKASVNEK 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I       T                     + +  D       ++ ++ +   L  
Sbjct: 241 GQLQIFAGNNKVTGDVAFSGGLAGALNMQAGTAETVDTIDVTSVGGAQQSVAVIDSALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   +     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFSHAISNLDNINENVNASKSRIKDTDFAKETTALTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|209695748|ref|YP_002263678.1| flagellin [Aliivibrio salmonicida LFI1238]
 gi|208009701|emb|CAQ80002.1| flagellin subunit D [Aliivibrio salmonicida LFI1238]
          Length = 375

 Score =  142 bits (358), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 39/365 (10%), Positives = 99/365 (27%), Gaps = 16/365 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+               D     E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNNATNDLNSSMERLSSGLKINSAKDDAAGLQISNRLTSQTRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G   +         +    
Sbjct: 61  LDVAVRNANDGISMAQTAEGAMNETTNILQRMRDLSLQSSNGSNTSADRGAIQEEVVALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K              + + M     +    +  A +
Sbjct: 121 DELNRIAETTSFGGSRLLNGQFGTKSFQIGSDSGEAVMLTLNNMRSDTTDMGGSTYSATE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S     + ++      DK   ++  + N     D        + +   ++A+V   
Sbjct: 181 GKDSSWKVGAENSELTMNFVDKDGKEQNISINAKTGDDIEEVATYINGQSNAINASVTGE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT----------------DGARNVLTKKMLSTVQQGLSGII 285
           G   +   A         +L+                D      ++K ++ +   +  + 
Sbjct: 241 GKLQVFASADASDIKFGGSLSSELGMGNKVADTVKSIDVTTVGGSQKAVAILDSAMQYVD 300

Query: 286 EQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMIT 345
             RA LG  +         L+N N  ++   S+   V+       ++      + S  I 
Sbjct: 301 SNRADLGAFQNRFGHAISNLENINENVNASNSQIKDVDFAKETTAMTKAQILQQASSSIL 360

Query: 346 TKLQK 350
            + ++
Sbjct: 361 AQAKQ 365


>gi|17366564|sp|Q56572|FLAB_VIBAN RecName: Full=Flagellin B
 gi|1272426|gb|AAB09435.1| flagellin B [Listonella anguillarum]
          Length = 376

 Score =  142 bits (358), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 42/367 (11%), Positives = 97/367 (26%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+                + K  E + +G   +      A +        +   
Sbjct: 1   MAINVSTNVSAMTAQRYLNNAADGTQKSMERLSSGYKINSARDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G   +++       +    
Sbjct: 61  LDMAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSSSERQAIQEEVSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +   K              S   M         KS +A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGSFGNKSFQIGADSGEAVMLSMSDMRSDTKAMGGKSYVATN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                  +    TD      DK  +      N     D        + +  D+ A+V   
Sbjct: 181 GKAP-DWSVTNATDLTLSYTDKQGEAREVTINAKAGDDLEEVATYINGQNGDIKASVGDE 239

Query: 242 GIRDIMFVAV------------------IGTEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +                          + ++    +      +++ ++ +   L  
Sbjct: 240 GKLQLFAANQKVSSDVTIGGGLGTEIGFAAGKDVTVKDINVTTVGGSQEAVALIDGALKA 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +         L N N  ++   S+    +      Q++      + S  
Sbjct: 300 VDSQRASLGAFQNRFGHAISNLDNINENVNASRSRIKDTDYARETTQMTKSQILQQASTS 359

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 360 VLAQAKQ 366


>gi|149189130|ref|ZP_01867418.1| flagellin [Vibrio shilonii AK1]
 gi|148837093|gb|EDL54042.1| flagellin [Vibrio shilonii AK1]
          Length = 378

 Score =  142 bits (358), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 38/367 (10%), Positives = 100/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  ++T+           + ++   +  E + +G   +      A +      E + + 
Sbjct: 1   MSITVNTNVSAMMAQNQLNKASQALNQSLERLSSGYRINSAKDDAAGLQISNRLEAQISG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +     + +     + T++  ++    I+Q M    +    G     +            
Sbjct: 61  LGVAQRNANDGISIMQTAEGAMNETTAILQRMRDLSLQSANGSNSAQERKALQEEFTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +  +             +     M    LE    +  A  
Sbjct: 121 DELNRIAETTSFGGKRLLNGSFGKATFQIGAQAGEAIQVELKNMRSDQLEMGGVAYRANN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            +  S +            +D     +          D        + +   +SA+VN +
Sbjct: 181 GVSESWLVDSSNRSLSFSYQDAQGRTQTDTIELKVGDDIEQVATYINGQTDTISASVNGQ 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +   +   T  ++ + +                          +  +S + Q L  
Sbjct: 241 GQLQLFADSQQVTSSVTFSGSFAQALDIATQGIVTVDNLSIEAVGGAQMSVSVIDQALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +  +      L N    + +  S+    +      ++       ++S  
Sbjct: 301 VDGHRAELGAYQNRLGHTINNLANMEENLSSSNSRIKDTDYAKETTEMLKQQILQQVSTT 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|226944499|ref|YP_002799572.1| flagellar hook-associated protein FlgL [Azotobacter vinelandii DJ]
 gi|226719426|gb|ACO78597.1| flagellar hook-associated protein [Azotobacter vinelandii DJ]
          Length = 401

 Score =  142 bits (358), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 44/401 (10%), Positives = 105/401 (26%), Gaps = 47/401 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST ++FE+          + +K+ +++ +G+            +  +   Q +    
Sbjct: 1   MRISTVTMFEQGLSSLVRQQSEYLKVGQQIASGKRVVNPSDDPQAASRAISVSQSQAVNQ 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       LS  ++ L+S+   +      LV    G   +      A  ++  YES
Sbjct: 61  QYDDARVSTRNALSQEESVLNSIADAIASAKTRLVQAGNGTLSDADRSSLASEIKGIYES 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQM------------------ 165
            +  AN TD       G      P               D+                   
Sbjct: 121 LLGQANATDGSGRYLFGGYQDSSPPFVKDNTSGAVAYQGDEGLILQQVDASRQMPSSDNG 180

Query: 166 --------LQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNA 217
                           + +  AG         +                     +   ++
Sbjct: 181 KQIFQSVHGSAGYLAQADAGNAGTVTFTGPYVSDSTAAGFGSGFTLDFAVATDGSVTYSS 240

Query: 218 SDHNIKYRIKDTEGIDVSA---------------------NVNMRGIRDIMFVAVIGTEF 256
                +    D + I+++                      N +    R +  +       
Sbjct: 241 DGGTTQVPYADGQSIEINGLSLTLEGTPADGDSIVVEKAQNADPDLFRTLENMIAALDTP 300

Query: 257 LSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYI 316
           +  +                +   L  ++  RA +G     ++       N+       +
Sbjct: 301 VETDADLARLQNTLSTSSRELDNALDSVLTVRASVGARLNELDVLDAVGDNRALNYKQTL 360

Query: 317 SKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           S  I ++ + A ++ S     ++ +      +  LS+ + L
Sbjct: 361 SDLIDLDYNEAISEYSLRQVGLQAAQKAFVDISSLSLFDLL 401


>gi|323498411|ref|ZP_08103407.1| flagellin [Vibrio sinaloensis DSM 21326]
 gi|323316484|gb|EGA69499.1| flagellin [Vibrio sinaloensis DSM 21326]
          Length = 377

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 97/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             +       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRHLNAASTAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISMAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         + K              +   M          S +A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFATKSFQIGADNGEAVMLTMKNMRSDNTMMGGNSYIAEN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +        D    L DKF  ++    N     D        + +   V A+V+  
Sbjct: 181 GQDANWAVQAGSNDLTINLTDKFGQEQNIEINAKAGDDIEELATYINGQTDLVKASVDQD 240

Query: 242 ------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
                             G      + +   + ++ +  D       ++ ++ V   L  
Sbjct: 241 GQLQLFTDNNKVEGEATFGGSLAGDLGIGDAQAVTVDTIDVRSVGGAQQSVAIVDAALKF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAINNLDNINENVNASKSRIKDTDFAKETTALTKSQILTQASSS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|260767762|ref|ZP_05876697.1| flagellar hook-associated protein FlgL [Vibrio furnissii CIP
           102972]
 gi|260617271|gb|EEX42455.1| flagellar hook-associated protein FlgL [Vibrio furnissii CIP
           102972]
 gi|315179406|gb|ADT86320.1| flagellar hook-associated protein FlgL [Vibrio furnissii NCTC
           11218]
          Length = 397

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 38/397 (9%), Positives = 110/397 (27%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +           ++ +G+              I    Q++  
Sbjct: 1   MFNRISSFHNYQAVQNDLRRQESKIHHNQAQLASGKKLLSAADNPLATHYIQNVSQQQEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + + +  LV  RL   +  +SS +         ++ ++ G          A  L +  
Sbjct: 61  LRQYMDAIVLVRNRLEHQEVIVSSAEDFTDKAKRNVMEMINGSLSPEDRAARARELEEIA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+  AN+ DE                      +++    D   +  +  + +      
Sbjct: 121 NNFLNLANVQDESGNYIFAGTKPTTQPFFRDNAGNVSYGGDDYQRKMKISNSLEMPFNTP 180

Query: 182 HLEVSSMNAQQMTDF--------------IKQLEDKFSDDEYWANNWSNASDHNIKYRIK 227
             ++         D+               K       DD  +   + + ++    Y+++
Sbjct: 181 GSKLFMEIENPFGDYEPNYQLREGSELLLEKANNSNPDDDGEYKVTFVDMTNGKFGYQLE 240

Query: 228 DTEGIDVSANVNMRGIRDI---------------------------MFVAVIGTEFLSKN 260
               +  +   N +                                         F   +
Sbjct: 241 RNGRVVDTDEFNPKTGIQYEDLTIHVKGQLTAGDAISLTPRQSFSVFDTFKDAINFSKAS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +     ++M          + + R  +G     ++ +     +    +    S+  
Sbjct: 301 VSDASATAKLQQMTQEFHTAFIHMNKARTDIGARLSTLDIQEEQHADFKISLAKSKSQFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + +     ++ S     K + L++ NY+
Sbjct: 361 DLDYAEAVIEFNENSRALQASQQAFGKTKDLTLFNYI 397


>gi|323491435|ref|ZP_08096619.1| flagellin [Vibrio brasiliensis LMG 20546]
 gi|323314304|gb|EGA67384.1| flagellin [Vibrio brasiliensis LMG 20546]
          Length = 377

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 47/367 (12%), Positives = 106/367 (28%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            T  ++T+           +      +  E + +G   +      A +      E +   
Sbjct: 1   MTITVNTNVSAMTAQRHLSKATDLLNQSLERLSSGNRINSAKDDAAGLQISNRLESQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  ++    ++Q M    +    G     +       +    
Sbjct: 61  LDVAMRNANDGISIMQTAEGAMNETTNLLQRMRDLSLQSANGSNSRAERDALQEEMSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       + S        +     + S   M    L+    S +A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFSSSAFQIGASSGEAVQVSLKNMRSDSLDMGGFSYIAAG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +   AQ     + +  +     E    N     D        + +   VSA+VN  
Sbjct: 181 KADSNWQVAQGSNTLVMEYTNAQGQQETININAKVGDDIEELATYINGQTDKVSASVNEE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   I       +  +S + +                  D ++    ++ +S +   L  
Sbjct: 241 GQLQIFMAGKQASGTVSFSGSLANQLSMNLAGYEAVDNIDISQAGGAQRAVSIIDTALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  +    S+    +      Q+       ++S  
Sbjct: 301 VDSHRAELGAMQNRFNHAINNLSNVNENLSASNSRIKDTDYAKETTQMVKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|260767760|ref|ZP_05876695.1| flagellin protein FlaD [Vibrio furnissii CIP 102972]
 gi|260617269|gb|EEX42453.1| flagellin protein FlaD [Vibrio furnissii CIP 102972]
 gi|315179408|gb|ADT86322.1| Flagellin C [Vibrio furnissii NCTC 11218]
          Length = 377

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 40/361 (11%), Positives = 89/361 (24%), Gaps = 18/361 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNSATGAQQSSMERLSSGFRINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSSNGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         + K              S + M          S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFATKSFQIGADNGEAVMLSLNNMRSDNRMMGGTSYKAEN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D    L DK   ++    N     D        + +   + A+V+  
Sbjct: 181 GKDKDWSVQSGANDLTITLNDKLDGEKTIQINAKAGDDIEELATYINGQTDMIKASVDQE 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +                          + ++ +  D       ++ ++ V   L  
Sbjct: 241 GKLQLFTDNNKVDGEVSFGGSLAGELGIQEGKGVTVDTIDVTSVGGAQQSVAVVDAALKF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAVNNLDNINENVNASKSRIKDTDFAKETTALTKSQILGQASSS 360

Query: 344 I 344
           +
Sbjct: 361 V 361


>gi|261253607|ref|ZP_05946180.1| flagellar hook-associated protein FlgL [Vibrio orientalis CIP
           102891]
 gi|260936998|gb|EEX92987.1| flagellar hook-associated protein FlgL [Vibrio orientalis CIP
           102891]
          Length = 397

 Score =  142 bits (357), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 32/397 (8%), Positives = 102/397 (25%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +           ++ +G+              I    Q+K  
Sbjct: 1   MLNRISSFHNYQSVQNDLRRSEAKVHHNQAQLASGKKLMKASDDPLATHYIQNIGQQKEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   +  L   RL   +  +S+ ++   D    ++ ++ G             + +  
Sbjct: 61  LRQYTDAIVLTRNRLEHHEVIISNAEEFTDDAKRTVMEMINGSLSPEDRLAKRREIEELA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+   N+ DE           +           +     D   +  +  + +  +   
Sbjct: 121 NNFLNLVNVQDESGNYIFAGTKPKNQPFFRDKDGDVTYAGDDYQRKMKISNSLEMPINNP 180

Query: 182 HLE----------------------------VSSMNAQQMTDFIKQLEDKFSDDEYWANN 213
             +                              + N    +++     D       +   
Sbjct: 181 GSKLFMEIDNPFGSYEPQYNLKEASELLLERAINTNPDDQSEYKVTFVDMPDGKYGYQLE 240

Query: 214 WSNASDHNIKYRIKDTE-------------GIDVSANVNMRGIRDIMFVAVIGTEFLSKN 260
              +      +   +                      ++ R    I           S +
Sbjct: 241 RDGSVVKADVFNPAEGIKFEELTIQVKGQLTKGDEITLDRRDTYSIFDTFKEAMNLSSGS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      ++          + + R  +G     ++ +    ++    +    S   
Sbjct: 301 VSDSSNTAKLHQITQEFHAAFIHLNKARTDVGARLSTLDIQEEQHEDFKMTLAKSKSNFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + +     ++ S     K + L++ NY+
Sbjct: 361 DLDYADAIIEFNENSRALQASQQAFGKTKDLTLFNYI 397


>gi|312109476|ref|YP_003987792.1| flagellar hook-associated protein 3 [Geobacillus sp. Y4.1MC1]
 gi|311214577|gb|ADP73181.1| flagellar hook-associated protein 3 [Geobacillus sp. Y4.1MC1]
          Length = 298

 Score =  142 bits (357), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 33/354 (9%), Positives = 95/354 (26%), Gaps = 57/354 (16%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++   +   M        +   K  E++VTG+               + + ++   + 
Sbjct: 1   MRVTQFMLANNMLRNLSNSYERLGKYQEQLVTGKKISRPSDDPVVAMKGIAYREDLARVK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +   V   + ++   L  +   +Q +   +V               A  +    + 
Sbjct: 61  QYQRNIGEVHNWIDSADDALDKVGLALQRVQELVVQASTDTATPEDRKKIADEIDQIQKH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V  AN    G+Y+F+G ++      GY         + +         + +  +     
Sbjct: 121 IVDVANTKVGGKYIFNGADTKNPLFIGYPDGMGGLGLNPNAN-----TSDVEIEVFDGIK 175

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
              +++ + +   I ++ D         N+  N    ++                     
Sbjct: 176 LDVNIDGKTLFTGIIEMLDNLKTVLNDPNSTGNTISSHLSQV------------------ 217

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                                A+        S +    + +                   
Sbjct: 218 --------------------EAQQDALLAARSELGAKQNRV--------------EMMEN 243

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L  +  I    +S +  +E       L T  +    +  +  ++ + +++++L
Sbjct: 244 RLSTQEVIATKLMSNNEDIEYEKTITDLITQESVHRAALSVGARIIQPTLVDFL 297


>gi|23100182|ref|NP_693649.1| flagellin [Oceanobacillus iheyensis HTE831]
 gi|22778414|dbj|BAC14683.1| flagellin [Oceanobacillus iheyensis HTE831]
          Length = 338

 Score =  142 bits (357), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 29/347 (8%), Positives = 88/347 (25%), Gaps = 19/347 (5%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +      +              E++ +G   +      A +    +   + N + 
Sbjct: 1   MIINHNISALNAHRQLGANQGGVQGSLEKLSSGLQINKAGDDAAGLAISEKMRGQINGLE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               +       + T++  L+    I+Q M    V                  +    E 
Sbjct: 61  MATKNAQDGISLIQTAEGALNETHSILQRMRELAVQSSSDTNTEADRAELQKEVDQLAEE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               ++ T+         + S     G  +  +++    +         ++ +  +   +
Sbjct: 121 ITRISSDTEFNTQTLLDGDFSATFQIGANSGQNISISVGEMSAGALKVGDTYTATSATEI 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           E S  +     D I   +D         +  +                       +  G 
Sbjct: 181 EFSDGSTATFEDAINVGDDLSGTPATEDDVQAAG-------------------YYDGAGN 221

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
             +        +       + +        ++T+   +  +  QR+ LG  +  +     
Sbjct: 222 LVVAADEAFAADTTGSVGINISNRDQADAAITTIDSAIQTVSAQRSNLGAVQNRLEHTIN 281

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            L      +    S+   V+      + +      + +  +  +  +
Sbjct: 282 NLGTSAENLTAAESRIRDVDMAKEMMEFTKNNILSQAAQSMLAQANQ 328


>gi|168335504|ref|ZP_02693585.1| flagellin domain protein [Epulopiscium sp. 'N.t. morphotype B']
          Length = 411

 Score =  142 bits (357), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 27/401 (6%), Positives = 96/401 (23%), Gaps = 54/401 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+ +             +   + E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINTNLMAINSQRNLGINQGEQGSVMEKLSSGLRINRAGDDAAGLAISEKMRNQIKGLQ 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  L+   ++++ M    +  +     +          +     
Sbjct: 61  QSSRNAEDGISLIQTAEGALAETHEMLKRMREMAIQSMNDTYTDEDREKLNLETQQLITE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSL------ 177
               A   +  +      + +   L     K+     +            S         
Sbjct: 121 XDELAVKAEFNEQKLLTGDPTGTGLKSVADKNKSLADALRVYYSAVGTYESVLGMAYSVE 180

Query: 178 ------------------LAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASD 219
                             ++   ++ S  +  +    +  + +          + +    
Sbjct: 181 AQLPLQIALQSVIDLEQKISALEVKASGESPAESQKVLTDVSNLRISLAALNASIAAIEA 240

Query: 220 HNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTE------------------------ 255
              +Y+         + ++    +  +                                 
Sbjct: 241 TAAEYKEMAASYDIKAISIEAGLVTSVAKSLQATMNEKVGPNEFTFQVGANNGQTITLAI 300

Query: 256 ------FLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKN 309
                  L  + T       +   L+T+   +  +  QRA LG  +  +      L N  
Sbjct: 301 KAMDAIALGLSATKIDSPESSGIALTTIDAAVEIVSRQRAELGAVQNRLEHTVKNLNNTA 360

Query: 310 NIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
             + +  S+    +        + +    + S  +  +  +
Sbjct: 361 ENLQSAESQIRDADMAAEMVDFTRINILSQASQAMLAQANQ 401


>gi|168333625|ref|ZP_02691885.1| flagellar hook-associated protein FlgL [Epulopiscium sp. 'N.t.
           morphotype B']
          Length = 381

 Score =  142 bits (357), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 33/381 (8%), Positives = 105/381 (27%), Gaps = 25/381 (6%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  I+ + +            +   K++ +M T +  +            L+   +   
Sbjct: 1   MSMRITNNMVQYGAMNALFNNMEQLDKIYMQMSTLKKIERPSDDPIIAGRSLKLRIDVTE 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
             +   +       +  S   +S+M++I++++   L     G             +    
Sbjct: 61  AEQYEQNTKEAMSWMEISDGAISNMEEILKEVKTRLNQASTGALTQEDKEKILSDILQLS 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           E      N +  G+++FSG    +       T  +    S   +      +   + L   
Sbjct: 121 EQIKDELNTSYAGRFVFSGHKIDQPVYYDVDTTLAKNITSSIDIQLSEDMKVGINGLTLT 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
              V               E+  ++  +             K  +   E    ++  N  
Sbjct: 181 SPMVVPKATTLGGTPYAAGEEVPANTIFNPGEVVPKGSFIPKGTVFTAETEIPASTANPD 240

Query: 242 GIRDIMFVAVIG------------------TEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
            + +     +                         + + D     +    +  +   +  
Sbjct: 241 VVGNTADQDIRYEIGVGIELEINETHLSDIFVGNYEKVVDNIVEAVEMDDIERLSALIED 300

Query: 284 IIEQRAVL-------GISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLIN 336
           I + R+ L       G  +  +   +  +          +S++  V+      + +  + 
Sbjct: 301 IDKTRSALSERMADGGSRQVRLELTQRKMAEDQVTFTELLSETEDVDIEEIFVEFNAQMM 360

Query: 337 KIEMSYMITTKLQKLSILNYL 357
             + +   ++++   ++ +Y+
Sbjct: 361 VYQSALKASSQVVMNTLADYI 381


>gi|19910965|dbj|BAB87732.1| flagellin protein FliC(S) [Clostridium septicum]
          Length = 377

 Score =  142 bits (357), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 30/361 (8%), Positives = 92/361 (25%), Gaps = 27/361 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +      +         + K  E++ +G   +      A ++   +   +   + 
Sbjct: 1   MIINHNMNAMNAHRNMATNTVATGKSMEKLSSGLRINRAGDDAAGLSISEKMRGQIRGLE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   ++      + T++  L+    I+Q M    V               +  L    + 
Sbjct: 61  QASRNSQDGISLIQTTEGALNETHSILQRMRELSVQASNDTNTAEDRGQLSKELDQLTQE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               ++ T   +         E          +  +     + +   +    +       
Sbjct: 121 IDRISSQTQFNKMDVLNGKGDEPFKANIQVGANSNQAIEIAINKMDYKSLFSAQRVEATT 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDE-------------------YWANNWSNASDHNIKY 224
            V+     + T  +K   D  + +                      + N        ++ 
Sbjct: 181 AVADGVELKKTANVKLTVDGKTVEVKADPKEDKTLTKEEFISELNKSINADKDLAGKVEA 240

Query: 225 RIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNV--------LTKKMLST 276
              D +      + +   ++  +  +  GT+          +          +    +  
Sbjct: 241 SFVDNKLTISRVDGSEEKMKVKVENSTGGTDLGLVETDSAMKEYKVDFKSHLVATSSIKE 300

Query: 277 VQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLIN 336
           + + +  +  QR+ LG  +  +      + N    +    S+   V+        S    
Sbjct: 301 IDRAIEKVSTQRSQLGAYQNRLEHTIKNVDNAAENLQAAESRVRDVDMANEMMTFSKNNI 360

Query: 337 K 337
            
Sbjct: 361 L 361


>gi|86146145|ref|ZP_01064471.1| flagellin [Vibrio sp. MED222]
 gi|85836092|gb|EAQ54224.1| flagellin [Vibrio sp. MED222]
          Length = 392

 Score =  142 bits (357), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 42/383 (10%), Positives = 102/383 (26%), Gaps = 35/383 (9%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+              + + K  E + +G   +      A +        +   
Sbjct: 1   MAINVSTNVSAMTAQRYLNSAAEGTQKSMERLSSGYKINSAKDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDMAVKNANDGISIAQTAEGAMNESTNILQRMRDLSLQSSNGSNTKSERVAIQEEVSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 A  T  G           +              + + M         KS    +
Sbjct: 121 TELNRIAETTSFGGNKLLNGTFGSQSFQIGADSGEAVMLTMNNMRTDTEAMGGKSYSVAE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S    +     + + +D+F D +  +      +D        + +  DV A+V   
Sbjct: 181 GKDTSWRVGEDSVLTM-KYQDQFGDVQDLSITAKKGNDMEELATYLNGQSPDVQASVGEG 239

Query: 242 G----------------------------------IRDIMFVAVIGTEFLSKNLTDGARN 267
           G                                   ++I   +      ++ N  D    
Sbjct: 240 GKLQLFASSQKVDGNVEFGGSLAEELGLGSGKDAEGKEIPGSSKAIVTDVTVNDIDVTSV 299

Query: 268 VLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTA 327
             +   +S +   L  +   RA LG  +   +     L+N N  ++   S+    +    
Sbjct: 300 AGSNNAVSIIDGALKAVDSNRASLGAFQNRFDHAISNLENINENVNASKSRIKDTDYAKE 359

Query: 328 HAQLSTLINKIEMSYMITTKLQK 350
              ++      + S  I  + ++
Sbjct: 360 TTAMTKSQILQQASTSILAQAKQ 382


>gi|218708814|ref|YP_002416435.1| flagellin [Vibrio splendidus LGP32]
 gi|218321833|emb|CAV17805.1| Flagellin C [Vibrio splendidus LGP32]
          Length = 392

 Score =  142 bits (356), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 41/383 (10%), Positives = 102/383 (26%), Gaps = 35/383 (9%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+              + + K  E + +G   +      A +        +   
Sbjct: 1   MAINVSTNVSAMTAQRYLNSAAEGTQKSMERLSSGYKINSAKDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDMAVKNANDGISIAQTAEGAMNESTNILQRMRDLSLQSSNGSNTKSERVAIQEEVSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 A  T  G           +              + + M         KS    +
Sbjct: 121 TELNRIAETTSFGGNKLLNGTFGSQSFQIGADSGEAVMLTMNNMRTDTEAMGGKSYSVAE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S    +     + + +D+F D +  +      +D        + +  D+ A+V   
Sbjct: 181 GKDTSWRVGEDSVLTM-KYQDQFGDVQDLSITAKKGNDMEELATYLNGQSPDIQASVGEG 239

Query: 242 G----------------------------------IRDIMFVAVIGTEFLSKNLTDGARN 267
           G                                   ++I   +      ++ N  D    
Sbjct: 240 GKLQLFASSQKVDGNVEFGGSLAEELGLGSGKDAEGKEIPGSSKAIVTDVTVNDIDVTSV 299

Query: 268 VLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTA 327
             +   +S +   L  +   RA LG  +   +     L+N N  ++   S+    +    
Sbjct: 300 AGSNNAVSIIDGALKAVDSNRASLGAFQNRFDHAISNLENINENVNASKSRIKDTDYAKE 359

Query: 328 HAQLSTLINKIEMSYMITTKLQK 350
              ++      + S  I  + ++
Sbjct: 360 TTAMTKSQILQQASTSILAQAKQ 382


>gi|54294170|ref|YP_126585.1| flagellar hook-associated protein FlgL [Legionella pneumophila str.
           Lens]
 gi|53754002|emb|CAH15473.1| flagellar hook-associated protein FlgL [Legionella pneumophila str.
           Lens]
          Length = 411

 Score =  142 bits (356), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 39/411 (9%), Positives = 105/411 (25%), Gaps = 57/411 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST+ I++R         +   +L ++  +G               I   +Q  ++I 
Sbjct: 1   MRISTNQIYQRGLDNLLTQQERLSRLQDQQASGIRVRTPSDDPVASAQIELIKQRISNIE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       L   +  LS+    +  +    +               A   +     
Sbjct: 61  LLQNNRQAADSALRLEEGILSNTVNSLHRLREIQIQSGNPSLSEEDRKTLAVEAQVLLNQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            + +AN  D         + S                  +      +  +    +     
Sbjct: 121 LLDYANTKDSNGSYMFSGSKSLTQPVSLNLSGQYVYNGDNTQRFQAVTTSLLVAVNDTGD 180

Query: 184 -----------------EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRI 226
                             V+             + +     + +   ++  S  N+   +
Sbjct: 181 NVFMRIPSGNGRFAIRETVTPNTGTASVSSGSVINEAAFVPDNYTMTFALNSQGNLVVMV 240

Query: 227 ----------------------------------------KDTEGIDVSANVNMRGIRDI 246
                                                   K  +   +S   N      +
Sbjct: 241 IGTLSGNVIPPSGLPDDAPLYQEGSAISFNGMEMVVSGLPKAGDSFSISPAKNESIFSTV 300

Query: 247 MFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQ 306
             +     +    ++   A      ++L+ +   L  I+  ++ LG     +        
Sbjct: 301 QRMINNLNKPYVSSVEKAATQTENNQLLAQIDSALGHILSVQSDLGARLNQLETAEKANN 360

Query: 307 NKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +  +I    + K   ++      +L+  +  ++ + +  T++Q LS+ N+L
Sbjct: 361 DYLDISAATLKKLREIDPVAVATELNLQLVNLQAAQLSFTRIQGLSLFNFL 411


>gi|254230133|ref|ZP_04923528.1| flagellar hook-associated protein 3 [Vibrio sp. Ex25]
 gi|262394932|ref|YP_003286786.1| flagellar hook-associated protein FlgL [Vibrio sp. Ex25]
 gi|151937326|gb|EDN56189.1| flagellar hook-associated protein 3 [Vibrio sp. Ex25]
 gi|262338526|gb|ACY52321.1| flagellar hook-associated protein FlgL [Vibrio sp. Ex25]
          Length = 397

 Score =  142 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 42/397 (10%), Positives = 110/397 (27%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             T IS+   ++ +    +          E++ +G+              I    Q++  
Sbjct: 1   MLTRISSFHNYQSVQNDLRRQENKVHHNQEQLASGKKLLKPSDDPLASHYIQNISQQQEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L S  LV  RL   + ++++ +    +     + ++ G             L +  
Sbjct: 61  LQQYLSSIVLVRNRLENHEVNIANAENFADESKRLTMEMINGAFSAEDRQAKKRELEEIA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+   N  DE           +          S+     D   +  +    +  +   
Sbjct: 121 NNFLNLVNSQDESGNYVFAGTKPKSQPFYRDKDGSVQYAGDDYQRKMKVSSMLEMPMNDP 180

Query: 182 HLEVSSMNAQQMTDF--------------IKQLEDKFSDDEYWANNWSNASDHNIKYRIK 227
             ++         D+               +       DD  +   + + ++    Y+++
Sbjct: 181 GSKLFMEIPNPFGDYQPNYDLQNGSELLLNRATNVDTKDDAAYRVTFVDMNNGKFGYQLE 240

Query: 228 DTE---------------------------GIDVSANVNMRGIRDIMFVAVIGTEFLSKN 260
                                             S  +  R    I         +  K+
Sbjct: 241 RNGKVVDADEFSPEKGIEYKGLKVHVKGQITPGDSIEIEKRAEFSIFDTFKDAMAWSDKS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      +M          + + R   G     ++ +    ++ N  +    S   
Sbjct: 301 VSDTSATAKLHQMTEEFHAAFIHLNKARTDAGARLSTLDIQEQNHEDFNLSLAKAKSNFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + S     ++ S     K + L++ NY+
Sbjct: 361 DLDYSKAVIEFSENSRALQASQQAFGKTKDLTLFNYI 397


>gi|182418320|ref|ZP_02949615.1| flagellar hook-associated protein 3 [Clostridium butyricum 5521]
 gi|237666729|ref|ZP_04526714.1| flagellar hook-associated protein 3 [Clostridium butyricum E4 str.
           BoNT E BL5262]
 gi|182377702|gb|EDT75246.1| flagellar hook-associated protein 3 [Clostridium butyricum 5521]
 gi|237657928|gb|EEP55483.1| flagellar hook-associated protein 3 [Clostridium butyricum E4 str.
           BoNT E BL5262]
          Length = 347

 Score =  142 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 39/354 (11%), Positives = 117/354 (33%), Gaps = 7/354 (1%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ S +        +    +   L  ++ TG++     +        ++   E +   
Sbjct: 1   MRITNSMLVSNYMNNMQRNLGNMSTLQNQLATGKTIQRASENPYIAVRTMQLNAEISANK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + +  +  L T+   L     I+  +    V    G    N+       + +  + 
Sbjct: 61  QYNSNITDASNWLDTTDTALGQANNIMARIKELSVKAGNGSYSENEIGAIKDEIVEKVKE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
           F    N + +G ++F G  S+ KP+      +          +     ++        + 
Sbjct: 121 FGQVLNTSFDGNFIFGGSKSTSKPVGVDDNGNISFIDKNGNPIDMDKIKDVNDPNKIVYD 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           ++SS    +++  +    +K + +     +        I         +           
Sbjct: 181 QISSSLKTEISQGVTVEYNKTAVEILNYKDSKGNDTSVIN-------TMSDLVKCLGVAS 233

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
            +      +     + N +D A   ++ KM   +    S + + R+ +G  +  +   + 
Sbjct: 234 GETKGTITLSDGTTTINGSDDALKYISGKMTEDITAIASNVSQIRSNVGAMQNRMESAKT 293

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             ++++  + + +S +  ++      + S L      +   ++K+   ++L+Y+
Sbjct: 294 TNEDQSYNMTSILSNTDDIDFAEKTMEYSILQTVYIATLQTSSKILNKTLLDYM 347


>gi|124268052|ref|YP_001022056.1| flagellin-related hook-associated protein [Methylibium
           petroleiphilum PM1]
 gi|124260827|gb|ABM95821.1| flagellin-related hook-associated protein [Methylibium
           petroleiphilum PM1]
          Length = 404

 Score =  142 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 26/395 (6%), Positives = 75/395 (18%), Gaps = 45/395 (11%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+ +                   + + +G   +      A +            
Sbjct: 1   MAMSVNTNIVSLNAQRNLGTSQSSLATSMQRLSSGLRVNSAKDDAAGLAIAERMNASVRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +     + +       T++  L  +  ++Q M    V         +        +    
Sbjct: 61  LNVAARNANDGISLAQTAEGALGKVGDMLQRMRELAVQSGNATNSADDRKALQAEVTQLR 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T          + +                                     
Sbjct: 121 DEIDRVAKQTTFNGRKLLDGSFTAAAFQVGAGAGDNITVGSLTNASASNLSKITYAEISS 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D I   + + + D+   N          +          V+  +N +
Sbjct: 181 GDLAKDDTDITTLDAIADGDLQITIDDGGDNELVVEVGAIAQASSGLERLGQVAEAINRK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT--------------------------------------- 262
                +   ++  +  +  L                                        
Sbjct: 241 TSDTGVSAYLVANDDGTYKLDIKASRLDADGAPLSVEFTGFDTTTTGLDEGDVPAAVTDA 300

Query: 263 ------DGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYI 316
                            +  +   L  +   R  LG  +         +Q +        
Sbjct: 301 IGIDALSIETESDVWVSIKKIDSALDQVNSARGTLGAIQSRFENAVSNIQIQAENTAASR 360

Query: 317 SKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKL 351
            + +  +  +  A LS      +    +  +  +L
Sbjct: 361 GRIMDADFASETANLSRSQILQQAGTAMVAQANQL 395


>gi|19910963|dbj|BAB87730.1| flagellin protein FliB(S) [Clostridium septicum]
          Length = 375

 Score =  142 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 32/359 (8%), Positives = 94/359 (26%), Gaps = 25/359 (6%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +      +         + K  E++ +G   +      A ++   +   +   + 
Sbjct: 1   MIINHNMNAMNAHRNMATNTVATGKSMEKLSSGLRINRAGDDAAGLSISEKMRGQIRGLE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   ++      + T++  L+    I+Q M    V               +  L    + 
Sbjct: 61  QASRNSQDGISLIQTTEGALNETHSILQRMRELSVQASNDTNTAEDRGQLSKELDQLTQE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPL-----------------NGYFTKDSLAKKSFDQML 166
               ++ T   +      +   K                     Y +  S  +      +
Sbjct: 121 IDGISSQTQFNKMDVLNGDEPFKANIQVGANSNQAIEIAINKMDYKSLFSAQRIEGSVAV 180

Query: 167 QGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRI 226
              ++      +       S        D     +++F  +   + N S      ++   
Sbjct: 181 ADGVQLKDGKDVTLTVDGKSVTVKADPKDDKTLTKEEFISELNKSINASKDLAGKVEASF 240

Query: 227 KDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNV--------LTKKMLSTVQ 278
            D +      + +   ++  +  +  GT+          +          +    +  + 
Sbjct: 241 VDNKLTISRVDGSEEKMKVKVENSAGGTDLGIAEKDTTMKEYKVDFKSHLVATSSIKEID 300

Query: 279 QGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINK 337
           + +  +  QR+ LG  +  +      + N    +    S+   V+        S     
Sbjct: 301 KAIEKVSTQRSQLGAYQNRLEHTIKNVDNAAENLQAAESRVRDVDMANEMMTFSKNNIL 359


>gi|323496566|ref|ZP_08101620.1| flagellin [Vibrio sinaloensis DSM 21326]
 gi|323318410|gb|EGA71367.1| flagellin [Vibrio sinaloensis DSM 21326]
          Length = 377

 Score =  142 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 95/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNSANNAQQTSMERLSSGSKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         + K              + + M          S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYATKSFQIGADNGEAVMLTLNDMRSDNSGMGGTSYQAEN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +        D    L  K  ++E    +     D        + +   V A+VN  
Sbjct: 181 AKDKNWTVQAGSNDLSITLTAKGGEEETINISAKAGDDIEELATYINGQTDMVKASVNED 240

Query: 242 GIRDIMFVAVI------------------GTEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +                          + ++ +  D       ++ ++ +   L  
Sbjct: 241 GQLQVFAGNNKVEGDVSFGGGLAGELGMQDGQAVTVDTIDVTSVGGAQESVAIIDTALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       ++      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAINNLDNINENVNASKSRIKDTDFAKETTSMTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|54308104|ref|YP_129124.1| flagellar hook-associated protein FlgL [Photobacterium profundum
           SS9]
 gi|46912530|emb|CAG19322.1| hypothetical flagellar hook-associated protein FlgL [Photobacterium
           profundum SS9]
          Length = 396

 Score =  142 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 41/396 (10%), Positives = 126/396 (31%), Gaps = 40/396 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             + I+    +  ++           +  +++ +G+              I  ++Q+   
Sbjct: 1   MISRIANFHHYNAVSNDMNRQQIKVQENQQQLASGKRLLTAGDDPVASIYIQNFDQQNTQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           I + + S ++   RL+  +A ++ ++ ++ D     ++++ G   ++    +   ++  +
Sbjct: 61  IDQSVKSITMARNRLNNEEAAITEVENLLDDAKRKSMMMVNGSLSSDDRVAHKQDMQGIF 120

Query: 122 ESFVTFANMTDEGQYL-FSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
           +SF+   N  DE     F+G   S++P       D        Q +          +   
Sbjct: 121 DSFMNLVNSRDESGNYVFAGTQYSQQPFFRDNNGDVAYVGDSYQRMAKIAPSVDVPINDA 180

Query: 181 QH-------------------------LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWS 215
                                      L   + N         +++   S        + 
Sbjct: 181 GDKLFLEVANPFGDYQPDYALESGSLLLLSQAKNGNDADQSEYRVDFSTSSGSTSYELYQ 240

Query: 216 NASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGT--------------EFLSKNL 261
           + +  +             +  ++++G         +                     ++
Sbjct: 241 DGALVSTAPFDPHKGIQWNTLQIDLKGEIKNGDSIALNRQENVSVFDAFKRGINLSDSDV 300

Query: 262 TDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIG 321
           +D +      ++   + QG   I   R+ +G   + ++ +    Q+   +++        
Sbjct: 301 SDASATAELHQVAEELAQGFKHINRARSEVGTRLQTLDRQEDMHQDFKIVMNEARGTLED 360

Query: 322 VEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           ++  TA  +L+  +  ++ S     K + L++ NY+
Sbjct: 361 LDYATAVIELNQNMMALQASQQAFAKTKDLNLFNYI 396


>gi|156975440|ref|YP_001446347.1| flagellin [Vibrio harveyi ATCC BAA-1116]
 gi|156527034|gb|ABU72120.1| hypothetical protein VIBHAR_03171 [Vibrio harveyi ATCC BAA-1116]
          Length = 376

 Score =  142 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 38/366 (10%), Positives = 95/366 (25%), Gaps = 17/366 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+           +  +   K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNQAAEGQQKSMERLSSGYKINSAKDDAAGLQISNRLNAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +        ++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDMAVKNANDGISIAQVAEGAMNESTNILQRMRDLSLQSANGSNSRSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +              S   +         KS  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYGTQSFQIGADSGEAVMLSMGNLRSDTSAMGGKSYSAED 180

Query: 182 HLEVSSMNAQQMTDFIK-----------QLEDKFSDDEYWANNWSNASDHNIKYRIKDTE 230
             + S          +             +  K  DD      + N    ++K  + +  
Sbjct: 181 GKDASWAVGDNTELKMTYTNKQGEEKELTINAKQGDDIEQLATYINGQSEDVKASVGEDG 240

Query: 231 GIDVSANVNMRGIRDIMFVAVI------GTEFLSKNLTDGARNVLTKKMLSTVQQGLSGI 284
            + V A              +         + ++    D      +++ ++ +   L  +
Sbjct: 241 KLQVFAATQKVTGDVEFSGNLAGEIGFGDAKDVTVKDIDVTTVAGSQEAVAIIDGALKSV 300

Query: 285 IEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMI 344
             QRA LG  +   N     L N N  ++   S+    +       ++      + S  I
Sbjct: 301 DSQRASLGAFQNRFNHAISNLDNINENVNASNSRIKDTDYAKETTAMTKSQILQQASTSI 360

Query: 345 TTKLQK 350
             + ++
Sbjct: 361 LAQAKQ 366


>gi|148979885|ref|ZP_01815763.1| flagellin [Vibrionales bacterium SWAT-3]
 gi|145961577|gb|EDK26878.1| flagellin [Vibrionales bacterium SWAT-3]
          Length = 377

 Score =  142 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 37/367 (10%), Positives = 90/367 (24%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLASGSKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSSNGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +              +   M     +   KS     
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYGTQSFQIGADNGEAVMLNLKDMRSDNAQMGGKSYQTEN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D      D F   +    +     D        + +   V A+V   
Sbjct: 181 AKDKDWNVQAGSNDLKLSFTDNFGQAQEIDISAKAGDDIEELATYINGQQDSVKASVTED 240

Query: 242 GIRDIMFVAVIGTEF------------------LSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +       +                    ++ +  D       ++ ++ +   L  
Sbjct: 241 GKLQMFAGNNKVSGDVSFSGGLAGELGIQASKEVTVDTIDVTSVGGAQESVAIIDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   +     L N N  ++   S+    +      Q++      + S  
Sbjct: 301 VDSHRAELGAFQNRFDHAISNLDNINENVNASKSRIKDTDFAKETTQMTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|163750563|ref|ZP_02157801.1| flagellar hook-associated protein FlgL [Shewanella benthica KT99]
 gi|161329718|gb|EDQ00707.1| flagellar hook-associated protein FlgL [Shewanella benthica KT99]
          Length = 404

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 47/404 (11%), Positives = 119/404 (29%), Gaps = 50/404 (12%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST+ +F +      +    +  + E++ +G+  +           I    Q+   + 
Sbjct: 1   MRISTAQMFNQNINSVLDRQSATNSIMEQLSSGKRVNTAGDDPVAAIGIDNLYQQNALVD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +    T  L+ +++ L S + +V      ++  + G   +N+    A  LR S E 
Sbjct: 61  QFVKNIDYATSHLALTESKLGSAEALVSSTKDQVLRAINGTVTDNERQTIADELRSSLEE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +  AN  DE          +      + T  ++       + Q  +             
Sbjct: 121 LLAIANSKDESGNYLFSGYETGTQPFAFNTSGNIVYSGDSGVRQSIVASGVTVGTNSPGD 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDD-------------------EYWANNWSNASDHNIKY 224
                    M DF        S D                   E +  ++++     ++ 
Sbjct: 181 SAFMNAPNAMGDFSVNYLPGQSGDFIVESAKLAPPAVHIPVAPEGYTFDFTDNLAGGVQL 240

Query: 225 RIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKML---------- 274
            + D+ G  +    N      + F  +           D        ++           
Sbjct: 241 EVFDSAGTSLQVVANFDPSSPVDFNGISVKLDGMPAANDSFTMAPATEVSIFDTLNQAIA 300

Query: 275 ---------------------STVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIID 313
                                 ++  G + I   R + G S K++   +    ++  I  
Sbjct: 301 ILEDPTKVNTPQGNSELAQILDSIDSGRNRIDFDRGIAGNSLKSVESYKSGHADEKLINS 360

Query: 314 TYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           + +S    ++   A ++       +     + +++   ++ +Y+
Sbjct: 361 SALSLLEDLDYAAAISEFEKQQLALNAVSTLFSRVSSTTLFDYI 404


>gi|33592146|ref|NP_879790.1| flagellin [Bordetella pertussis Tohama I]
 gi|33571790|emb|CAE41297.1| flagellin [Bordetella pertussis Tohama I]
 gi|332381562|gb|AEE66409.1| flagellin [Bordetella pertussis CS]
          Length = 391

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 32/381 (8%), Positives = 86/381 (22%), Gaps = 32/381 (8%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+ +         +         E + +G   +      A       +      
Sbjct: 1   MAAVINTNYLSLVAQNNLNKSQSALGSAIERLSSGLRINSAKDDAAGQAIANRFTANVKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q +    V    G    +        +    
Sbjct: 61  LTQAARNANDGISIAQTTEGALNEINNNLQRIRELTVQASNGTNSASDIDSIQQEVNQRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKP--------------------------------LN 149
           E     A  TD         N+++                                    
Sbjct: 121 EEINRIAEQTDFNGIKVLKSNATDMTLSIQVGAKDNETIDIKIDRNSNWNLYDAVGTVPG 180

Query: 150 GYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEY 209
           G    ++    +    +   +     S        V++                + D   
Sbjct: 181 GTVNGEARTVNALGFDVLSAVTTTIASDTVTFDAAVAAAEQAAGAAAGDGSVVSYGDAAN 240

Query: 210 WANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVL 269
                   +   +       +    +A  +  G                 +  +   +  
Sbjct: 241 PQYAVVVDNAGTLTSYALTFDKDGKAALGDQLGAVASQAAEAAVGVNDVASGDNVTVSGG 300

Query: 270 TKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHA 329
               LS +   +  + EQR+ LG  +         L N    +    S+    +  T  +
Sbjct: 301 NANALSKLDDAMKAVDEQRSSLGAIQNRFESTVANLNNTITNLSAARSRIEDSDYATEVS 360

Query: 330 QLSTLINKIEMSYMITTKLQK 350
            ++      +    +  +  +
Sbjct: 361 NMTKNQILQQAGTSVLAQANQ 381


>gi|307609984|emb|CBW99513.1| flagellar hook-associated protein FlgL [Legionella pneumophila
           130b]
          Length = 411

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 39/411 (9%), Positives = 105/411 (25%), Gaps = 57/411 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST+ I++R         +   +L ++  +G               I   +Q  ++I 
Sbjct: 1   MRISTNQIYQRGLDNLLTQQERLSRLQDQQASGIRVRTPSDDPVASAQIELIKQRISNIE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       L   +  LS+    +  +    +               A   +     
Sbjct: 61  LLQNNRQAADSALRLEEGILSNTVNSLHRLREIQIQSGNPSLSEEDRKTLAVEAQALLNQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            + +AN  D         + S                  +      +  +    +     
Sbjct: 121 LLDYANTKDSNGSYMFSGSKSLTQPVSLNLSGQYVYNGDNTQRFQAVTTSLLVAVNDTGD 180

Query: 184 -----------------EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRI 226
                             V+             + +     + +   ++  S  N+   +
Sbjct: 181 NVFMRIPSGNGRFAIRETVTPNTGTASVSSGSVINEAAFVPDNYTMTFALNSQGNLVVMV 240

Query: 227 ----------------------------------------KDTEGIDVSANVNMRGIRDI 246
                                                   K  +   +S   N      +
Sbjct: 241 SGTLSGNVIPPSGLPDDAPLYQEGSAISFNGMEMVVSGLPKAGDSFSISPAKNESIFSTV 300

Query: 247 MFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQ 306
             +     +    ++   A      ++L+ +   L  I+  ++ LG     +        
Sbjct: 301 QRMINNLNKPYVSSVEKAATQTENNQLLAQIDSALGCILSVQSDLGARLNQLETAEKANN 360

Query: 307 NKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +  +I    + K   ++      +L+  +  ++ + +  T++Q LS+ N+L
Sbjct: 361 DYLDISAATLKKLREIDPVAVATELNLQLVNLQAAQLSFTRIQGLSLFNFL 411


>gi|260772314|ref|ZP_05881230.1| flagellin protein FlaD [Vibrio metschnikovii CIP 69.14]
 gi|260611453|gb|EEX36656.1| flagellin protein FlaD [Vibrio metschnikovii CIP 69.14]
          Length = 377

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 97/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRYLNSATNAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  +     I+Q +    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISMAQTAEGAMQETTNILQRIRDLSLQSANGSNSKSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K              + + M    ++    S +A  
Sbjct: 121 DELNRIAETTSFGGNRLLNGTFQTKAFQIGSNSGEAVMLTLNDMRSDNVKMGGTSYVAAT 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +     +    +    L D    ++    +     D        + +   V A+VN +
Sbjct: 181 EADKDWTVSDGNNELTLTLNDVNGVEQTINISAKVGDDIEELATYINGQTDMVQASVNEK 240

Query: 242 ------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
                             G      +A+   + ++ N  D       ++ ++ V   L  
Sbjct: 241 GQLQIFSGEHKVTGDVTFGGALATELAMGPAQAVTVNTIDVTSVGGAQESVAIVDAALQY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAINNLDNINENVNASKSRIKDTDFAKETTALTKAQILGQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|292492370|ref|YP_003527809.1| flagellar hook-associated protein 3 [Nitrosococcus halophilus Nc4]
 gi|291580965|gb|ADE15422.1| flagellar hook-associated protein 3 [Nitrosococcus halophilus Nc4]
          Length = 400

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 53/400 (13%), Positives = 118/400 (29%), Gaps = 46/400 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ISTS   +R      +      K+ +++ TG+         A    +L+  +    ++
Sbjct: 1   MRISTSLFQQRSIDGILDQQAQVSKIQQQLATGRRILTPADDPAAAARLLDVRETFEQLS 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +    T RLS  +  L+ +  ++Q +    V    G  +N    + A  +R   + 
Sbjct: 61  QFQRNADRATARLSQEETALAGVGDLLQRVRELAVQANNGAQNNENRVMMAKEVRQRLDE 120

Query: 124 FVTFANMTDEGQ-YLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
            +  AN  D    YLF+G     +P+       +       + +Q            G  
Sbjct: 121 ILGLANAQDASGEYLFAGFKGRTQPIIREGGNFTYQGDQGQRQIQISPSVQVADSDPGSE 180

Query: 183 LEVSSMNAQQMTDFIKQLED---------------------------------------- 202
           + ++               +                                        
Sbjct: 181 VFLAIREGNGTFVTEADPSNSGSGVIGPGSVSGTFVPGDYTLRFSQPQSSDSLTFEVLDS 240

Query: 203 -----KFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFL 257
                   +           +   +     D +   + ++ +      +          +
Sbjct: 241 QNNVVTSGNFVSGGAITFGGAQVRVTGTPGDGDRFTIRSSAHQDMFTTVQRFIDALERPV 300

Query: 258 SKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYIS 317
           S   +    N    + L+ + Q L  + E RA +G     I+ ER   ++ +  +    S
Sbjct: 301 SDTASQARFNNDMNRTLTDLDQALGKVSEIRAGVGARLNAIDSERQMNEDVSLQMAKLQS 360

Query: 318 KSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
               ++   A   L+  +  +E +     +LQ LS+ + L
Sbjct: 361 SLNDLDLAEAIGHLNQQLTALEAAQRTYVRLQGLSLFSLL 400


>gi|148358813|ref|YP_001250020.1| flagellar hook associated protein type 3 FlgL [Legionella
           pneumophila str. Corby]
 gi|296106858|ref|YP_003618558.1| flagellar hook-associated protein 3 FlgL [Legionella pneumophila
           2300/99 Alcoy]
 gi|148280586|gb|ABQ54674.1| flagellar hook associated protein type 3 FlgL [Legionella
           pneumophila str. Corby]
 gi|295648759|gb|ADG24606.1| flagellar hook-associated protein 3 FlgL [Legionella pneumophila
           2300/99 Alcoy]
          Length = 411

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 39/411 (9%), Positives = 105/411 (25%), Gaps = 57/411 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST+ I++R         +   +L ++  +G               I   +Q  ++I 
Sbjct: 1   MRISTNQIYQRGLDNLLTQQERLSRLQDQQASGIRVRTPSDDPVASAQIELIKQRISNIE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       L   +  LS+    +  +    +               A   +     
Sbjct: 61  LLQNNRQAADSALRLEEGILSNTVNSLHRLREIQIQSGNPSLSEEDRKTLAVEAQALLNQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            + +AN  D         + S                  +      +  +    +     
Sbjct: 121 LLDYANTKDSNGSYMFSGSKSLTQPVSLNLSGQYVYNGDNTQRFQAVTTSLLVAVNDTGD 180

Query: 184 -----------------EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRI 226
                             V+             + +     + +   ++  S  N+   +
Sbjct: 181 NVFMRIPSGNGRFAIRETVTPNTGTASVSSGSVINEAAFVPDNYTMTFALNSQGNLVVMV 240

Query: 227 ----------------------------------------KDTEGIDVSANVNMRGIRDI 246
                                                   K  +   +S   N      +
Sbjct: 241 SGTLSGNVIPPSGLPDDAPLYQEGSAISFNGMEMVVSGLPKAGDSFSISPAKNESIFSTV 300

Query: 247 MFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQ 306
             +     +    ++   A      ++L+ +   L  I+  ++ LG     +        
Sbjct: 301 QRMINNLNKPYVSSVEKAATQTENNQLLAQIDSALGHILSVQSDLGARLNQLETAEKANN 360

Query: 307 NKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +  +I    + K   ++      +L+  +  ++ + +  T++Q LS+ N+L
Sbjct: 361 DYLDISAATLKKLREIDPVAVATELNLQLVNLQAAQLSFTRIQGLSLFNFL 411


>gi|294140192|ref|YP_003556170.1| flagellar hook-associated protein FlgL [Shewanella violacea DSS12]
 gi|293326661|dbj|BAJ01392.1| flagellar hook-associated protein FlgL [Shewanella violacea DSS12]
          Length = 404

 Score =  141 bits (355), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 43/404 (10%), Positives = 116/404 (28%), Gaps = 50/404 (12%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST+ +F +      +    + K+ +++ +G+  +           I    Q+   + 
Sbjct: 1   MRISTAQMFNQSITSVLDKQSATSKVLDQLSSGKRVNTAGDDPVAAIGIDNLYQQNALVN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +    T  L+ +++ L S + +V  +   ++  + G   +      A  +R S E 
Sbjct: 61  QFIKNIDYATGHLAVAESKLGSAESLVSSIKDQVLRGVNGSLTDIDRVTIANEMRSSLEE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            ++ AN  DE        N +      + T  ++       + Q  +             
Sbjct: 121 LLSIANSRDESGKYIFSGNQTSTQPFAFDTAGNIVYSGDSGVRQAVVASGVTVGTNLPGD 180

Query: 184 EVSSMNAQQMTDFIKQLEDK-------------------FSDDEYWANNWSNASDHNIKY 224
            V    A  + DF                              E +   +++     +  
Sbjct: 181 SVFMNAANAIGDFSVNYLPAQVGEFSVESAKIVTPGAHVPVAPEGYTFTFTDNGVGGVNL 240

Query: 225 RIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGAR------------------ 266
            + D+         N      + F  +      +    D                     
Sbjct: 241 EVFDSAATSQVVVANFDPTNPVSFNGIEVKVDGTPVPGDSFTMSPQTEVSIFDTINQAIS 300

Query: 267 -------------NVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIID 313
                        +    ++L  +  G   I   R + G   K +   +    ++  +  
Sbjct: 301 LIEDPNKVNTPQGSAELAQLLDNMASGTKQIDFDRGIAGNDLKRVESYQSSHADEKLVNS 360

Query: 314 TYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           + +S    ++  +A  +       +     + +++   ++ +Y+
Sbjct: 361 SALSLLEDLDYASAITEFEKQQLALNAVSTLFSRVGSTTLFDYI 404


>gi|197335705|ref|YP_002156693.1| flagellar hook-associated protein 3 [Vibrio fischeri MJ11]
 gi|197317195|gb|ACH66642.1| flagellar hook-associated protein 3 [Vibrio fischeri MJ11]
          Length = 397

 Score =  141 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 36/396 (9%), Positives = 120/396 (30%), Gaps = 41/396 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +                ++ +G+                   Q+K  
Sbjct: 1   MLNRISSFHNYQAVQNDISRQEAKVHHTSAQLASGKKLLTAGDDPVAALYAQNLTQKKEE 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +L   RL   +  +++ ++   D    ++ ++ G         +A  L+   
Sbjct: 61  LRQYTDTITLARNRLERHEVAIANAEQFADDAKRSVMEMINGSLAPEDRYAHAQDLKGIA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+   NM DE           +          ++A    +   +  +  + +  +   
Sbjct: 121 SNFLNLTNMLDESGNYLFSGTKPKTQPFFKSNDGTVAYAGDEYQRKLKVSGSIEVAVNDA 180

Query: 182 HLEVSSMNAQQMTDF--------------IKQLEDKFSDDEYWANNWSNASDHNIKYRIK 227
             ++ +       D+               +     ++D   +  ++S +++    Y++ 
Sbjct: 181 GSKLFTEIKNPFGDYDPQYALQEGSELLLSQATNTNYTDPATYEVSFSASANGQYNYQLS 240

Query: 228 DTEGIDVSANVNMR---------------------------GIRDIMFVAVIGTEFLSKN 260
               +  +A  +                                 I       +E    +
Sbjct: 241 KDGSVVKNAQFDPSEGIKYEGVDIQIRGQLKSGDVITLEPKKTISIFDSFKKASELALND 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           + D +     +++          + + RA +G  +  ++++    Q+ +  +   +S   
Sbjct: 301 VADASTTAELQQVTDEFHAAFIHLSQARAEVGTRQNTLDQQEQQHQDFDLTLSKSLSSIE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNY 356
            ++   A  + +     ++ S     K++ +++ NY
Sbjct: 361 DLDYAQAVIEFNENTRALQASQQAFGKVKDITLFNY 396


>gi|260774947|ref|ZP_05883848.1| flagellin protein FlaD [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609202|gb|EEX35360.1| flagellin protein FlaD [Vibrio coralliilyticus ATCC BAA-450]
          Length = 377

 Score =  141 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 96/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             +       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVAAMTAQRYLNSASNAQQSSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISMAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         S K              + + M          S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFSTKSFQIGADNGEAVMLTLNNMRSDNSMMGGNSYSAAN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D    L D F + +    N     D        + +   V A+V   
Sbjct: 181 AKDKDWAVQAGSNDLTIALTDVFGEQQNITINAKEGDDIEELATYINGQTDMVKASVGDD 240

Query: 242 ------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
                             G      +++   + ++ +  D      +++ ++ V   L  
Sbjct: 241 GNLQVFTDNNRVTGDVTFGGALAGELSMGPAQAVTVDTIDVTTVAGSQEAVAIVDSALKF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   +     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFSHAINNLDNINENVNASKSRIKDTDFAKETTALTKAQILSQASSS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|269961609|ref|ZP_06175971.1| Flagellin B [Vibrio harveyi 1DA3]
 gi|269833650|gb|EEZ87747.1| Flagellin B [Vibrio harveyi 1DA3]
          Length = 376

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 98/367 (26%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+           +  +   K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNQAAEGQQKSMERLSSGYKINSAKDDAAGLQISNRLNAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +        ++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDMAVKNANDGISIAQVAEGAMNESTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +              S   +         KS  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYGTQSFQIGADSGEAVMLSMGNLRSDTSAMGGKSYAAED 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S       T+      +K  +++    N     D        + +  DV A+V   
Sbjct: 181 GKDASW-TVSDKTELKMSYTNKQGEEKELTINAKQGDDIEQLATYINGQSEDVKASVGED 239

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +   +   T  +  +                    D      +++ ++ +   L  
Sbjct: 240 GKLQVFAASQKVTGDVEFSGNLAGEIGFGDAKDVTVKDIDVTSVAGSQEAVAIIDGALKS 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +   N     L N N  ++   S+    +       ++      + S  
Sbjct: 300 VDSQRASLGAFQNRFNHAISNLDNINENVNASNSRIKDTDYAKETTAMTKSQILQQASTS 359

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 360 ILAQAKQ 366


>gi|260772281|ref|ZP_05881197.1| flagellar hook-associated protein FlgL [Vibrio metschnikovii CIP
           69.14]
 gi|260611420|gb|EEX36623.1| flagellar hook-associated protein FlgL [Vibrio metschnikovii CIP
           69.14]
          Length = 397

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 43/397 (10%), Positives = 113/397 (28%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +           ++ +G+              I    Q++  
Sbjct: 1   MLNRISSFHNYQSVQNDLRRQENKVHHNQAQLASGKKLLSAGDNPLATHYIQNVTQQEEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L +  LV  RL   +  +S+ ++        ++ ++ G          A  +++  
Sbjct: 61  LRQYLDAIVLVRNRLEHQEVIISNAEEFTDKAKRMVMEMINGSLSPEDRETQARQIQEIA 120

Query: 122 ESFVTFANMTDEGQY-LFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
            +F+  AN+ DE    +F+G     +P       +        Q                
Sbjct: 121 NNFLNLANVQDETGNFIFAGTRPKNQPFFRDNQGNVTYYGDDYQRKMRISNNLEMPFNTP 180

Query: 181 QHLEVSSMN----------------------AQQMTDFIKQLEDKFSDD----------- 207
            +     +N                      A    D           D           
Sbjct: 181 GNQMFMDINNPFGDFEPEYALQEGSELLLERATNSDDGDNASYTVTFVDMLNGGFAYQLE 240

Query: 208 -------EYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKN 260
                      +  +      +   IK +     S  +N R    +        E+   +
Sbjct: 241 RDGEVVEVNDFDPRTGVQYQGLTINIKGSITAGDSITLNPRKTFTVFDSFKKAIEYSKGS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      ++   +      + + R+ +G     ++ +    ++    +    S+  
Sbjct: 301 VSDASTTGKLHQITEELHTAFIHLNQVRSDVGARLSTLDLQEDQHEDFKISLARSKSQFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + +     ++ S +   K + L++ NYL
Sbjct: 361 DLDYSQAVIEFNENSRALQASQLAFGKAKDLTLFNYL 397


>gi|168335502|ref|ZP_02693583.1| flagellin domain protein [Epulopiscium sp. 'N.t. morphotype B']
          Length = 411

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/401 (8%), Positives = 92/401 (22%), Gaps = 54/401 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+ +             +   + E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINTNLMAINSQRNLDVNQNELGGVMEKLSSGLRINRAGDDAAGLAISEKMRNQIKGLY 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  L+   ++++ M    +  +     N          +     
Sbjct: 61  QAGRNAQDGISLIQTAEGALAENHEMLKRMREMAIQAMNDTYTNEDRKKLNLEAQQLITE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A   +  +      + + K L     K  L   +            SK   A    
Sbjct: 121 VDELAVKAEFNEQKLLTGDPTGKGLAAVANKRELLASALANYYIKVGSYESKLGSAYAIE 180

Query: 184 ---------------------------------------------------EVSSMNAQQ 192
                                                                S    + 
Sbjct: 181 ASTKMEQVAQSVLDLEEKISALEVKASGEKPAAAQLVLKDVSHLRIILAQRNASIAAMES 240

Query: 193 MTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSAN---VNMRGIRDIMFV 249
               +K+         ++    S            + +              G    + +
Sbjct: 241 SATTLKESAAILQASAFYIEATSVTDAAKQLQATMNEQVGPHEFTLQVGANNGQTINLSI 300

Query: 250 AVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKN 309
             +    L  + T       +   LS++   +  +  QRA LG  +  +      L N  
Sbjct: 301 KAMNATALGLSATKIDSPESSGIALSSIDAAVEIVSRQRAELGAVQNRLEHTVKNLNNTA 360

Query: 310 NIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
             + +  S+    +        +      + S  +  +  +
Sbjct: 361 ENLQSAESQIRDTDMAAEMVFFTRTNILSQASQAMLAQANQ 401


>gi|107100542|ref|ZP_01364460.1| hypothetical protein PaerPA_01001567 [Pseudomonas aeruginosa PACS2]
          Length = 399

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/381 (9%), Positives = 88/381 (23%), Gaps = 35/381 (9%)

Query: 6   ISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAER 65
           ++T+             +       + + TG   +      A +        + N +   
Sbjct: 10  VNTNIASLNTQRNLNNSSASLNTSLQRLSTGSRINSAKDDAAGLQIANRLTSQVNGLNVA 69

Query: 66  LHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFV 125
             + +       T++  L     I+Q M    +    G   +++     G ++   +   
Sbjct: 70  TKNANDGISLAQTAEGALQQSTNILQRMRDLSLQSANGSNSDSERTALNGEVKQLQKELD 129

Query: 126 TFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEV 185
             +N T  G       +            + +     D+M    L         G  +  
Sbjct: 130 RISNTTTFGGRKLLDGSFGVASFQVGSAANEIISVGIDEMSAESLNGTYFKADGGGAVTA 189

Query: 186 SSMNAQQMTDFIKQLEDKFS-----------------------------------DDEYW 210
           ++ +               +                                   D   +
Sbjct: 190 ATASGTVDIAIGITGGSAVNVKVDMKGNETAEQAAAKIAAAVNDANVGIGAFSDGDTISY 249

Query: 211 ANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLT 270
            +         I   +      D  +                     +    D +     
Sbjct: 250 VSKAGKDGSGAITSAVSGVVIADTGSTGVGTAAGVAPSATAFAKTNDTVAKIDISTAKGA 309

Query: 271 KKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQ 330
           +  +  + + +  I  QRA LG  +   +     L+N    +     +    +     A 
Sbjct: 310 QSAVLVIDEAIKQIDAQRADLGAVQNRFDNTINNLKNIGENVSAARGRIEDTDFAAETAN 369

Query: 331 LSTLINKIEMSYMITTKLQKL 351
           L+      +    I  +  +L
Sbjct: 370 LTKNQVLQQAGTAILAQANQL 390


>gi|261252311|ref|ZP_05944884.1| flagellin protein FlaF [Vibrio orientalis CIP 102891]
 gi|260935702|gb|EEX91691.1| flagellin protein FlaF [Vibrio orientalis CIP 102891]
          Length = 377

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/367 (12%), Positives = 102/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  +  E + +G   +      A +      E +   
Sbjct: 1   MAITVNTNVSAMTAQRHLTNATDLLNQSLERLASGNRINSAKDDAAGLQISNRLESQMRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  ++    ++Q M    +    G     +       +    
Sbjct: 61  LDVAMRNANDGISIMQTAEGAMNETTNLLQRMRDLSLQSANGSNSRAERDALQEEMGALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       + S        +     + S   M    L+    S +A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGSFSSSSFQIGASSGEAVQVSLKNMRSDSLDMGGFSYIAAG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S   +Q   D   Q  +     E       +  D        + +   +SA+VN  
Sbjct: 181 KADSSWQVSQGSQDLTMQYTNAQGQQESINITAKSGDDIEELATYINGQTDKLSASVNEE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   I          +S +                    D +     ++ +S +   L+ 
Sbjct: 241 GQLQIFMAGKETAGTISFSGGLASELNMNLAGYEAVDNIDISEVGGAQRAVSVLDTALNY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  +    S+    +      Q+       ++S  
Sbjct: 301 VDSHRAELGAMQNRFNHAINNLSNVNENLSASNSRIKDTDYAKETTQMVKQQILQQVSTS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|167628880|ref|YP_001679379.1| flagellar hook-associated protein 3, putative [Heliobacterium
           modesticaldum Ice1]
 gi|167591620|gb|ABZ83368.1| flagellar hook-associated protein 3, putative [Heliobacterium
           modesticaldum Ice1]
          Length = 309

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 44/354 (12%), Positives = 107/354 (30%), Gaps = 46/354 (12%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++ + + +       ++     K   ++ TG+              I+        + 
Sbjct: 1   MRVTQAMMSKSFLTGLYDVAGKMDKTQFQLSTGRQYRLPEDAPMENVQIMTHRSTLVQVN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + + S +   L  S + LS +  ++Q +   ++    G T        A  + +  + 
Sbjct: 61  KYMKNTSEIQTWLENSDSALSEVNNVLQRVRELILQADNGTTTTEAKKATADEISELNDH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               +N T  G+Y+F+G N+   P                     +   N    +     
Sbjct: 121 LKNVSNTTIAGRYIFAGTNTDRPPCAKDTNGYW-----------KWNGNNGDINVEIDAK 169

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
            V +MN++    F++   +                                        +
Sbjct: 170 AVVAMNSKGTNVFVRNDFNWP-----------------------------------GSPV 194

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
            +         + L+K L D          L+   + L G+ E+RA +G     I+  + 
Sbjct: 195 PEPEKNLFNFLDSLTKTLKDANTTEDLDTYLAITDKFLDGVNEERASVGARANRIDFTKS 254

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L+     I   +S     +    +  +    N    +     ++ + S++++L
Sbjct: 255 RLEEFQLHITEALSDREDADMAQVYTNMRMQENVFRAALSAGARIIQPSLVDFL 308


>gi|17366567|sp|Q56574|FLAC_VIBAN RecName: Full=Flagellin C
 gi|1272429|gb|AAB09437.1| flagellin C [Listonella anguillarum]
          Length = 377

 Score =  140 bits (353), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 96/367 (26%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             +       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNSASNAQQLSMERLSSGFKINNAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G             +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSSNGSNSKADRVAIQEEITALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K              S + M         KS  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFETKSFQIGADNGEAVMLSLNNMRSDNAMMGGKSYQAAN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D    L DK + ++    +  +  D        + +   + A+V+  
Sbjct: 181 GQDKDWTVKAGANDLTITLTDKRTGEQTINLSAKDGDDIEELATYINGQTDMLKASVDDE 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   I   +                      + ++ +  D      +++ ++ V   L  
Sbjct: 241 GKLQIFTDSNRIDGVATFGGSLAGELSFQAAKDVTVDTIDVTSVGGSQESVAIVDAALQF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAQLGAFQNRFNHAINNLDNINENVNASKSRIKDTDFAKETTALTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|2443634|gb|AAC33159.1| hook associated protein [Vibrio cholerae]
          Length = 397

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 36/397 (9%), Positives = 112/397 (28%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +    +      ++ +G+              I    Q++  
Sbjct: 1   MLNRISSFHNYQAVQNDIRRQESEVFNNQAQLASGKKLLSASDNPLATHYIQNVGQQEEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L +  LV  RL   +  +S+ ++        ++ ++ G          A +L++  
Sbjct: 61  LRQYLDAIVLVRNRLEHQEVIISNTEEFSDSAKRTVMEMINGSLSPEDRVARARVLQEMA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+  AN+ DE           +        + ++     D   +  +  + +      
Sbjct: 121 NNFINLANVQDESGNYIFAGTKPKNQPFFRDNQGNVTYAGDDYQRKMKISNSLEIPFNNP 180

Query: 182 HLEVS----------------------------SMNAQQMTDFIKQLEDKFSDDEYWANN 213
             +V                             ++N      +     D       +   
Sbjct: 181 GSKVFMEIPNPFGSYEPNYALQEGSELLLERAVNLNPDDTASYRVTFVDMPEGKNGYQLE 240

Query: 214 WSNASDHNIKYRIKDTEGI-------------DVSANVNMRGIRDIMFVAVIGTEFLSKN 260
            + +     ++  K                    +  +  R    +         +   +
Sbjct: 241 RNGSVVQAGEFDAKTGIQFEELNIQVKGQISKGDAIELTPRTTFSVFDTFRDAIRYAEGS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      +++         + + R  +G     ++ +    ++    +    S   
Sbjct: 301 VSDASNTAKLHQLVEEFHTAFIHLNKTRTDIGARLSTLDIQEEQHEDFKISLAKSKSTFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + +     +E S     K + L++ NY+
Sbjct: 361 DLDYAEAVIEFNENSRALEASQKAFGKTKDLTLFNYI 397


>gi|54297189|ref|YP_123558.1| flagellar hook-associated protein FlgL [Legionella pneumophila str.
           Paris]
 gi|53750974|emb|CAH12385.1| flagellar hook-associated protein FlgL [Legionella pneumophila str.
           Paris]
          Length = 411

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/411 (9%), Positives = 105/411 (25%), Gaps = 57/411 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST+ I++R         +   +L ++  +G               I   +Q  ++I 
Sbjct: 1   MRISTNQIYQRGLDNLLTQQERLARLQDQQASGIRVRTPSDDPVASAQIELIKQRISNIE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       L   +  LS+    +  +    +               A   +     
Sbjct: 61  LLQNNRQAADSALRLEEGILSNTVNSLHRLREIQIQSGNPSLSEEDRKTLAVEAQALLNQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            + +AN  D         + S                  +      +  +    +     
Sbjct: 121 LLDYANTKDSNGSYMFSGSKSLTQPVSLNLSGQYVYNGDNTQRFQAVTTSLLVAVNDTGD 180

Query: 184 -----------------EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRI 226
                             V+             + +     + +   ++  S  N+   +
Sbjct: 181 NVFMRIPSGNGRFAIRETVTPNTGTASVSSGSVINEAAFVPDNYTMTFALNSQGNLVVMV 240

Query: 227 ----------------------------------------KDTEGIDVSANVNMRGIRDI 246
                                                   K  +   +S   N      +
Sbjct: 241 SGTLSGNVIPPSGLPDDAPLYQEGSAISFNGMEMVVSGLPKAGDSFSISPAKNESIFSTV 300

Query: 247 MFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQ 306
             +     +    ++   A      ++L+ +   L  I+  ++ LG     +        
Sbjct: 301 QRMINNLNKPYVSSVEKAATQTENNQLLAQIDSALGRILSVQSDLGARLNQLETAEKANN 360

Query: 307 NKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +  +I    + K   ++      +L+  +  ++ + +  T++Q LS+ N+L
Sbjct: 361 DYLDISAATLKKLREIDPVAVATELNLQLVNLQAAQLSFTRIQGLSLFNFL 411


>gi|514988|dbj|BAA06987.1| flagellin [Serratia marcescens]
          Length = 348

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 32/351 (9%), Positives = 87/351 (24%), Gaps = 11/351 (3%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+         +         E + +G   +      A       +      
Sbjct: 1   MAQVINTNSLSLMAQNNLNKSQSSLGTAIERLSSGLRINSAKDDAAGQAISDRFTANIKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q++    V    G    +        +    
Sbjct: 61  LTQASRNANDGISLAQTTEGALNEVNDNLQNIRRLTVQAQNGSNSTSDLKSIQDEITQRM 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 +  TD         +       G    +++                  +     
Sbjct: 121 SEINRISEQTDFNGVKVLSSDQKLTIQVGANDGETIDIDL-----------QGLTGFDVT 169

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                  +A      +K         +   +  +  +          T+       +   
Sbjct: 170 ENGTKIGSAIADKAMVKDDTGTDVAFDLGESFQTGGALEKATLVSGKTKDGKEGYYIQTT 229

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
                              +T GA     K  L+T+ + L+ +   R+ LG  +   +  
Sbjct: 230 DAATGAKTYATAKIDDKGVVTKGADVTDVKDPLATLDKALAQVDGLRSSLGAVQNRFDSV 289

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLS 352
              L +  N +    S+    +  T  + +S      +    +  +  + +
Sbjct: 290 ISNLNSTVNNLSASQSRIQDADYATEVSNMSRAHILQQAGTSVLAQANQST 340


>gi|119775443|ref|YP_928183.1| flagellar hook-associated protein FlgL [Shewanella amazonensis
           SB2B]
 gi|119767943|gb|ABM00514.1| flagellar hook-associated protein FlgL [Shewanella amazonensis
           SB2B]
          Length = 401

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 49/403 (12%), Positives = 124/403 (30%), Gaps = 51/403 (12%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ISTS +F +      +   ++ KL E++ +G+  +           I    Q++  + 
Sbjct: 1   MRISTSQMFTQNTNNILQKQTETAKLLEQLSSGKKVNTSGDDPVAALGIDNLNQQQALVD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + L +       L  +++ L S +++V  +   ++  + G    ++  + A  +R S + 
Sbjct: 61  QFLKNIDYAKNHLGIAESKLGSAEELVTGLREQILRGVNGGLSPSERQMIADEMRGSLQE 120

Query: 124 FVTFANMTDEGQY-LFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
            +  AN  DE    +FSG  +  +P       + +                +        
Sbjct: 121 LLNVANTRDESGNFMFSGFKTDTEPFAFDGAGNMVYSGDAGVRDAMISRGIAMGTNVPGD 180

Query: 183 ------------------------------------------------LEVSSMNAQQMT 194
                                                              S     ++ 
Sbjct: 181 MAFMTSPNALGDYTVNYLSSQAGDFKVQSAAITNPAAHVEDTYTFNFIDNGSGGVNLEVR 240

Query: 195 DFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGT 254
           D    L    ++ +       N  D  ++      + I ++    +     I     +  
Sbjct: 241 DSANGLVTTVNNFDATNPVSFNGIDVKLEGTPAAGDSISLAPQAEVSIFDTINKAIALIE 300

Query: 255 EFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDT 314
           +     +   A      ++L+    GL+ +   R+V G + K++         +  +  +
Sbjct: 301 DD--SRMNSPAGIAELAQLLNDTDSGLNQLSTARSVAGNNLKSLESYAGRHAEEQVVNTS 358

Query: 315 YISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            +S    ++  TA  +       +     + +++  +S+ +YL
Sbjct: 359 ALSLLEDLDYATAITEFEKQQLALNAVSNVFSRVGSVSLFDYL 401


>gi|264676588|ref|YP_003276494.1| flagellin-like protein [Comamonas testosteroni CNB-2]
 gi|262207100|gb|ACY31198.1| flagellin-like protein [Comamonas testosteroni CNB-2]
          Length = 392

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 34/383 (8%), Positives = 85/383 (22%), Gaps = 33/383 (8%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+                     + + +G   +      A +        +   
Sbjct: 1   MAMTINTNIQSLNAQRNLGTSQSSLSTSMQRLSSGLRINSAKDDAAGLAIAERMSAQVRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  LS++   +Q +    V                  +    
Sbjct: 61  LNQAQRNANDGVSLAQTAEGALSTIGGNLQRIRELAVQSRNATNSTEDRAALQKEVDQLK 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFT-------------------KDSLAKKSF 162
           E     A  T          + +++                            S A    
Sbjct: 121 EEIDRVATTTSFNGTKLLNGSFTDQEFQVGANQGQVIKVGDFVNAQIDKLGTWSAAADVK 180

Query: 163 DQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNI 222
                                +++ +      D  +      +  +   +    A+   +
Sbjct: 181 TYSNAAGTGPTIADDKLALSFDINGVTIGVAADTSRTTGQGVTALKAAFDTAVAANPEKL 240

Query: 223 KYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLT--------------DGARNV 268
           K    D  G    AN +       +              T              D +   
Sbjct: 241 KGMSMDAAGKITVANADQSASISNLVGMTALALGTETVTTVVAKGASQTGFDKLDVSTIA 300

Query: 269 LTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAH 328
            +   +  +   L  +   RA LG  +         L   +  +    S+ +  +  +  
Sbjct: 301 GSDNAIVAMDAALKDVNSARADLGAIQNRFESVVSNLSVNSENLSASKSRIMDADFASET 360

Query: 329 AQLSTLINKIEMSYMITTKLQKL 351
           A LS      +    +  +  +L
Sbjct: 361 ANLSRSQILQQAGTAMVAQANQL 383


>gi|126652478|ref|ZP_01724650.1| flagellar hook-associated protein L [Bacillus sp. B14905]
 gi|126590749|gb|EAZ84864.1| flagellar hook-associated protein L [Bacillus sp. B14905]
          Length = 315

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 22/354 (6%), Positives = 89/354 (25%), Gaps = 55/354 (15%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++ S +   M            KL +++ +G                + + ++   + 
Sbjct: 16  MRVTQSMLSSNMLRNLNNSYGKMSKLQDQINSGSKITRPSDDPVIAVKGMGYRRDLAKVE 75

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       L ++   L+ + + ++ +   ++        +         +    + 
Sbjct: 76  QYTRNMITAGSWLDSTDESLNQVGEQMKRVRELVIQAATDSNTSEDRDKIKKEIDQIRQQ 135

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                                                                       
Sbjct: 136 LQD------------------------------------------------VGNTNIGGS 147

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
            + S        FI    +  ++ E       +    ++    KD           +  +
Sbjct: 148 YIFSGTRTNEPLFIGGAINPNTNQESVKVEIYDGIQLSVNTPGKDLFNNIDDMMGKISDL 207

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                        +   ++    N         +    + ++E +A +G  +  +     
Sbjct: 208 LGDPTKTGEEIASMLGGVSSSTTN-------DDITAMHNKVLEAQADIGARQNRVEMMEN 260

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L  +   +   +  +  V+   A  ++ T  +  + +  + +K+ + ++++++
Sbjct: 261 RLGVREVNVTKQLRDNESVDYAKAITEMVTHESIHQAALSVGSKIIQQTLVDFI 314


>gi|153834140|ref|ZP_01986807.1| polar flagellin A [Vibrio harveyi HY01]
 gi|148869510|gb|EDL68508.1| polar flagellin A [Vibrio harveyi HY01]
          Length = 376

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 98/367 (26%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+           +  +   K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNQAAEGQQKSMERLSSGYKINSAKDDAAGLQISNRLNAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +        ++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDMAVKNANDGISIAQVAEGAMNESTNILQRMRDLSLQSANGSNSRSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +              S   +         KS  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYGTQSFQIGADSGEAVMLSMGNLRSDTSAMGGKSYAAED 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S       T+      +K  +++    N     D        + +  DV A+V   
Sbjct: 181 GKDASW-TVSDKTELKMSYTNKQGEEKELTINAKQGDDIEQLATYINGQSDDVKASVGED 239

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +   +   T  +  +                    D      +++ ++ +   L  
Sbjct: 240 GKLQVFAASQKVTGDVEFSGNLAGEIGFGDAKDVTVKDIDVTSVAGSQEAVAIIDGALKS 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +   N     L N N  ++   S+    +       ++      + S  
Sbjct: 300 VDSQRASLGAFQNRFNHAISNLDNINENVNASNSRIKDTDYAKETTAMTKSQILQQASTS 359

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 360 ILAQAKQ 366


>gi|56460245|ref|YP_155526.1| flagellin [Idiomarina loihiensis L2TR]
 gi|56179255|gb|AAV81977.1| Flagellin [Idiomarina loihiensis L2TR]
          Length = 404

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 49/404 (12%), Positives = 107/404 (26%), Gaps = 50/404 (12%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +ST+  F+R     +       ++   +                + +L   ++     
Sbjct: 1   MRLSTNLFFQRGLDSLQTSQSQLDRIQLMLTKQTKILSPADDPIGNSQVLALNEKIGQNE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   ++  +   L   ++ L+S+   +Q      V    G  D       A  LRD   S
Sbjct: 61  QFERNSVTLENNLRREESVLNSITDAIQKARTLAVQAGNGSYDQTNRKAIAAELRDIESS 120

Query: 124 FVTFANMTDEGQ-YLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLE----------- 171
                N  DE   Y+F+G  +  KP+       S             L            
Sbjct: 121 IFDLTNAQDESGEYIFAGYQNRTKPMEFDDATQSYQYVGDQGQRTIQLSPTLYLPANDPG 180

Query: 172 ---------------------------ENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKF 204
                                       +  +L+A     +++ +    T      +   
Sbjct: 181 NKAFSNVSKRVDFELTGGNDYIEKVEVTDRNTLIADTEARIAAGDPTNFTVNFTGPDTYE 240

Query: 205 SDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFL------- 257
            DD          +D  ++Y     E    +           +   V             
Sbjct: 241 IDDGVNPVVAGTITDGKVEYNGMSLELDKDNMPAAGDSFSYSIGEPVSRNLLTQLGDLAD 300

Query: 258 ----SKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIID 313
               S   + G         L      +  + + +A +G     ++  ++   +   +  
Sbjct: 301 VLEESGPESKGFHESEIAFALDDFNTVIGDLTDTQASVGARLNVMDNAKLSNADIEIVNK 360

Query: 314 TYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
              S    V+   A   L         +  + T++ +LS+ +Y+
Sbjct: 361 KARSDISDVDYSEAMTDLVKNETIYSAAQQVFTRISRLSLFDYI 404


>gi|319427082|gb|ADV55156.1| flagellar hook-associated protein 3 [Shewanella putrefaciens 200]
          Length = 403

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 46/405 (11%), Positives = 131/405 (32%), Gaps = 53/405 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +S++ IF +      +    + K+ E++ +G+  +           I    Q    + 
Sbjct: 1   MRLSSAQIFNQSITSVLQKQTATSKILEQLSSGKKVNTAGDDPVAALGIDNLNQRNALVD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +    T RL+ +++ L S + +   +   +V  + G   +++  + A  ++ S E 
Sbjct: 61  QFMKNIDYATNRLAVTESKLGSAENLTSSIREQVVRAVNGTLADSERQMIADEMKGSLEE 120

Query: 124 FVTFANMTDEGQYL-FSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
            ++ AN  DE     FSG ++ ++P     +       S D  ++  L ++  +L     
Sbjct: 121 LLSIANSKDESGNYMFSGYSTDKEPFAFDNSIPPKIVYSGDSGIRNSLVQSGVALGTNVP 180

Query: 183 LEVS--------------------------------------------------SMNAQQ 192
            + +                                                       Q
Sbjct: 181 GDSAFMKAPNGLGDYSVNYLASQQGEFSVKTAKIADASTYLADTYTFNFIDNGLGGTNLQ 240

Query: 193 MTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVI 252
           + D         ++ +       N  +  +  +    +   +     +     I     +
Sbjct: 241 VLDSANNPVANVTNFDATTPVSFNGIEVKVSGKPSAGDSFTMEPQAEVSIFDTISSAIAL 300

Query: 253 GTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNII 312
             +  S             ++L+ +  G++ I   R+V G + K +   +     +  + 
Sbjct: 301 IEDPNS--ANTPQGRAQLAQILNNIDSGVNQISSARSVAGNNLKAVESYKETHTEEKVVN 358

Query: 313 DTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            + +S+   ++  +A  +       +     + +K+  +S+ +++
Sbjct: 359 TSALSRLEDLDYASAITEFEKQQLALNAVSSVFSKVGSVSLFDFI 403


>gi|15642189|ref|NP_231821.1| flagellar hook-associated protein FlgL [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121726564|ref|ZP_01679813.1| flagellar hook-associated protein FlgL [Vibrio cholerae V52]
 gi|147674282|ref|YP_001217707.1| flagellar hook-associated protein FlgL [Vibrio cholerae O395]
 gi|153213628|ref|ZP_01948901.1| flagellar hook-associated protein FlgL [Vibrio cholerae 1587]
 gi|153817065|ref|ZP_01969732.1| flagellar hook-associated protein FlgL [Vibrio cholerae NCTC 8457]
 gi|153820859|ref|ZP_01973526.1| flagellar hook-associated protein FlgL [Vibrio cholerae B33]
 gi|153829327|ref|ZP_01981994.1| flagellar hook-associated protein FlgL [Vibrio cholerae 623-39]
 gi|227082314|ref|YP_002810865.1| flagellar hook-associated protein FlgL [Vibrio cholerae M66-2]
 gi|229507733|ref|ZP_04397238.1| flagellar hook-associated protein FlgL [Vibrio cholerae BX 330286]
 gi|229512072|ref|ZP_04401551.1| flagellar hook-associated protein FlgL [Vibrio cholerae B33]
 gi|229513834|ref|ZP_04403296.1| flagellar hook-associated protein FlgL [Vibrio cholerae TMA 21]
 gi|229519208|ref|ZP_04408651.1| flagellar hook-associated protein FlgL [Vibrio cholerae RC9]
 gi|229522139|ref|ZP_04411556.1| flagellar hook-associated protein FlgL [Vibrio cholerae TM
           11079-80]
 gi|229528805|ref|ZP_04418195.1| flagellar hook-associated protein FlgL [Vibrio cholerae 12129(1)]
 gi|229607237|ref|YP_002877885.1| flagellar hook-associated protein FlgL [Vibrio cholerae MJ-1236]
 gi|254286495|ref|ZP_04961452.1| flagellar hook-associated protein FlgL [Vibrio cholerae AM-19226]
 gi|254849319|ref|ZP_05238669.1| flagellar hook-associated protein FlgL [Vibrio cholerae MO10]
 gi|255747111|ref|ZP_05421056.1| flagellar hook-associated protein FlgL [Vibrio cholera CIRS 101]
 gi|262161345|ref|ZP_06030455.1| flagellar hook-associated protein FlgL [Vibrio cholerae INDRE 91/1]
 gi|262167784|ref|ZP_06035486.1| flagellar hook-associated protein FlgL [Vibrio cholerae RC27]
 gi|262191682|ref|ZP_06049858.1| flagellar hook-associated protein FlgL [Vibrio cholerae CT 5369-93]
 gi|298500432|ref|ZP_07010237.1| flagellar hook-associated protein 3 [Vibrio cholerae MAK 757]
 gi|9656745|gb|AAF95335.1| flagellar hook-associated protein FlgL [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121631017|gb|EAX63396.1| flagellar hook-associated protein FlgL [Vibrio cholerae V52]
 gi|124115827|gb|EAY34647.1| flagellar hook-associated protein FlgL [Vibrio cholerae 1587]
 gi|126512333|gb|EAZ74927.1| flagellar hook-associated protein FlgL [Vibrio cholerae NCTC 8457]
 gi|126521651|gb|EAZ78874.1| flagellar hook-associated protein FlgL [Vibrio cholerae B33]
 gi|146316165|gb|ABQ20704.1| flagellar hook-associated protein FlgL [Vibrio cholerae O395]
 gi|148875168|gb|EDL73303.1| flagellar hook-associated protein FlgL [Vibrio cholerae 623-39]
 gi|150423444|gb|EDN15388.1| flagellar hook-associated protein FlgL [Vibrio cholerae AM-19226]
 gi|227010202|gb|ACP06414.1| flagellar hook-associated protein FlgL [Vibrio cholerae M66-2]
 gi|227014086|gb|ACP10296.1| flagellar hook-associated protein FlgL [Vibrio cholerae O395]
 gi|229332579|gb|EEN98065.1| flagellar hook-associated protein FlgL [Vibrio cholerae 12129(1)]
 gi|229341064|gb|EEO06069.1| flagellar hook-associated protein FlgL [Vibrio cholerae TM
           11079-80]
 gi|229343897|gb|EEO08872.1| flagellar hook-associated protein FlgL [Vibrio cholerae RC9]
 gi|229349015|gb|EEO13972.1| flagellar hook-associated protein FlgL [Vibrio cholerae TMA 21]
 gi|229352037|gb|EEO16978.1| flagellar hook-associated protein FlgL [Vibrio cholerae B33]
 gi|229355238|gb|EEO20159.1| flagellar hook-associated protein FlgL [Vibrio cholerae BX 330286]
 gi|229369892|gb|ACQ60315.1| flagellar hook-associated protein FlgL [Vibrio cholerae MJ-1236]
 gi|254845024|gb|EET23438.1| flagellar hook-associated protein FlgL [Vibrio cholerae MO10]
 gi|255735513|gb|EET90913.1| flagellar hook-associated protein FlgL [Vibrio cholera CIRS 101]
 gi|262023849|gb|EEY42548.1| flagellar hook-associated protein FlgL [Vibrio cholerae RC27]
 gi|262028656|gb|EEY47310.1| flagellar hook-associated protein FlgL [Vibrio cholerae INDRE 91/1]
 gi|262032421|gb|EEY50983.1| flagellar hook-associated protein FlgL [Vibrio cholerae CT 5369-93]
 gi|297541125|gb|EFH77179.1| flagellar hook-associated protein 3 [Vibrio cholerae MAK 757]
          Length = 397

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 36/397 (9%), Positives = 111/397 (27%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +           ++ +G+              I    Q++  
Sbjct: 1   MLNRISSFHNYQAVQNDIRRQESKVFNNQAQLASGKKLLSASDNPLATHYIQNVGQQEEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L +  LV  RL   +  +S+ ++        ++ ++ G          A +L++  
Sbjct: 61  LRQYLDAIVLVRNRLEHQEVIISNTEEFSDSAKRTVMEMINGSLSPEDRVARARVLQEMA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+  AN+ DE           +        + ++     D   +  +  + +      
Sbjct: 121 NNFINLANVQDESGNYIFAGTKPKNQPFFRDNQGNVTYAGDDYQRKMKISNSLEIPFNNP 180

Query: 182 HLEVS----------------------------SMNAQQMTDFIKQLEDKFSDDEYWANN 213
             +V                             ++N      +     D       +   
Sbjct: 181 GSKVFMEIPNPFGSYEPNYALQEGSELLLERAVNLNPDDTASYRVTFVDMPEGKNGYQLE 240

Query: 214 WSNASDHNIKYRIKDTEGI-------------DVSANVNMRGIRDIMFVAVIGTEFLSKN 260
            + +     ++  K                    +  +  R    +         +   +
Sbjct: 241 RNGSVVQAGEFDAKTGIQFEELNIQVKGQISKGDAIELTPRTTFSVFDTFRDAIRYAEGS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      +++         + + R  +G     ++ +    ++    +    S   
Sbjct: 301 VSDASNTAKLHQLVEEFHTAFIHLNKTRTDIGARLSTLDIQEEQHEDFKISLAKSKSTFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + +     +E S     K + L++ NY+
Sbjct: 361 DLDYAEAVIEFNENSRALEASQKAFGKTKDLTLFNYI 397


>gi|153825353|ref|ZP_01978020.1| flagellar hook-associated protein FlgL [Vibrio cholerae MZO-2]
 gi|149741037|gb|EDM55106.1| flagellar hook-associated protein FlgL [Vibrio cholerae MZO-2]
          Length = 397

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 36/397 (9%), Positives = 109/397 (27%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +           ++ +G+              I    Q++  
Sbjct: 1   MLNRISSFHNYQAVQNDIRRQESKVFNNQAQLASGKKLLSASDNPLATHYIQNVGQQEEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L +  LV  RL   +  +S+ ++        ++ ++ G          A +L++  
Sbjct: 61  LRQYLDAIVLVRNRLEHQEVIISNTEEFSDSAKRTVMEMINGSLSPEDRVARARVLQEMA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+  AN+ DE           +        + ++     D   +  +  + +      
Sbjct: 121 NNFINLANVQDESGNYIFAGTKPKNQPFFRDNQGNVTYAGDDYQRKMKISNSLEIPFNNP 180

Query: 182 HLEVS----------------------------SMNAQQMTDFIKQLEDKFSDDEYW--- 210
             +V                             ++N      +     D       +   
Sbjct: 181 GSKVFMEIPNPFGSYEPNYALQEGSELLLERAVNLNPDDTASYRVTFVDMPEGKNGYQLE 240

Query: 211 ---ANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEF-------LSKN 260
              +   +   D     + ++              I           +           +
Sbjct: 241 RNGSVVQAGEFDAKTGIQFEELNIQVKGQISKGDAIELRPRTTFSVFDTFRDAIRYAEGS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      +++         + + R  +G     ++ +    ++    +    S   
Sbjct: 301 VSDASNTAKLHQLVEEFHTAFIHLNKTRTDIGARLSTLDIQEEQHEDFKISLAKSKSTFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + +     +E S     K + L++ NY+
Sbjct: 361 DLDYAEAVIEFNENSRALEASQKAFGKTKDLTLFNYI 397


>gi|114330368|ref|YP_746590.1| flagellar hook-associated protein FlgL [Nitrosomonas eutropha C91]
 gi|114307382|gb|ABI58625.1| flagellar hook-associated protein 3 [Nitrosomonas eutropha C91]
          Length = 299

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 36/354 (10%), Positives = 98/354 (27%), Gaps = 55/354 (15%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +ST++++++      +      KL +++ +G+                E  Q      
Sbjct: 1   MRVSTNTLYDQGTRSMLQQQSSLFKLQQQLSSGKRIMTPSDDPIGAARAHELSQSLALNT 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       L    + L S+  ++Q +    V        +N+  + A  LR  +E 
Sbjct: 61  QYADNRYRAMDSLQQVDSTLGSVSNVIQSVRTMAVAAGNPAYSDNERQMMAVELRGHFEH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +  AN  DE                   +   +  +   +     +  + +  ++    
Sbjct: 121 LLGLANTKDEQGNYLFSGFKGNTQPFVEQSAGVVTYQGDQEQRLIQVSGSRQLPVSETGD 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
            V     Q +   +              N                               
Sbjct: 181 AVFEPGGQNLFQTVDNFISALKTPGGMPNGAVG--------------------------- 213

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                                    + +++ + +   L+     RA +G   + I+  + 
Sbjct: 214 ------------------------NVLQELDTALDNVLTK----RAAVGSRLQEIDALQQ 245

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             ++        +S+   ++   A + +      +E +    T++ +LS+ N +
Sbjct: 246 IGEDTAVQYQQSLSRLQDLDFAQAISDMVRQQALLEAAQKSFTRVSELSLFNVI 299


>gi|17366561|sp|Q56571|FLAD_VIBAN RecName: Full=Flagellin D
 gi|1272425|gb|AAB09434.1| flagellin D [Listonella anguillarum]
          Length = 377

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/362 (10%), Positives = 89/362 (24%), Gaps = 18/362 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             +       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNGASNAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G             +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKADRVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K              S + M          S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFETKSFQIGADNGEAVMLSLNNMRSDNAMMGGTSYQAAN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D    L+D    D+    +     D        + +   V A+V+  
Sbjct: 181 GKDKDWSVQAGSNDLQITLKDTSGTDQTINISAKEGDDIEELATYINGQTDMVKASVDDE 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +   +                      + ++ ++ D       ++ ++ V   L  
Sbjct: 241 GKLQVFAGSNKVEGPVTFAGGLAGELGMQAGQAVTVDVIDVTSVGGAQESVAIVDAALQF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   +     L N N  +    S+    +       L+      + S  
Sbjct: 301 VDSHRAQLGAFQNRFSHAISNLDNINENVSASKSRIKDTDFAKETTALTKSQILSQASSS 360

Query: 344 IT 345
           + 
Sbjct: 361 VL 362


>gi|90411013|ref|ZP_01219027.1| flagellin [Photobacterium profundum 3TCK]
 gi|90328226|gb|EAS44537.1| flagellin [Photobacterium profundum 3TCK]
          Length = 382

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/372 (9%), Positives = 83/372 (22%), Gaps = 23/372 (6%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+           + + D  +  E + TG   +      A +        +   
Sbjct: 1   MAVTVNTNVSAMTAQRYLNKASGDLSQSMERLSTGSKINSAKDDAAGLQISNRLVAQTRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  L     I+Q M    +    G   ++        +    
Sbjct: 61  LNVAMRNANDGISIAQTAEGALQESTSILQRMRDLSLQSSNGANSDDDRVAIQQEVGALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G          E                   +         +   A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGQFGEAAFQIGADSGEAIIMGLTSVRADDSRMGGQMFRATG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTE----------- 230
             + +          I                             +              
Sbjct: 181 MADENWQAGAGDKISINVAGLADPISVDLIEGDDIEEVATRINGQQSGVSASVRDNGELQ 240

Query: 231 ------------GIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQ 278
                            A         +   A   +E ++    D       ++ + T+ 
Sbjct: 241 LFSENGAVTLDSTNTQLAQGKDAAGAPVDLFAGSASEAMTVQQVDVKSVGGAQEAVGTID 300

Query: 279 QGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKI 338
             L  I  QRA LG  +  +      L N +  +    S+    +      +++      
Sbjct: 301 SALKYIDSQRADLGAKQNRLGHTINNLANVSENVSASNSRIRDTDFAKESTEMAKNQILQ 360

Query: 339 EMSYMITTKLQK 350
           + S  I  + ++
Sbjct: 361 QASTSILAQAKQ 372


>gi|212634355|ref|YP_002310880.1| flagellar hook-associated protein FlgL [Shewanella piezotolerans
           WP3]
 gi|212555839|gb|ACJ28293.1| Flagellin [Shewanella piezotolerans WP3]
          Length = 400

 Score =  140 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 43/400 (10%), Positives = 112/400 (28%), Gaps = 46/400 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST+ +F +      +    + K+ E++ +G+              I   +Q+   + 
Sbjct: 1   MRISTAQMFNQTTTNVMKSQSATSKIMEQLASGKKVSTAGDDPVAAIGIDNLKQQGAVVD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +    + RL+ S++ + + + +V+ M   ++  + G   +      A  +R S E 
Sbjct: 61  QFIKNIDYASNRLAVSESKIGNAENVVESMREQMLRSVNGTLSDADRQTIADEMRGSLEE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            ++ AN  DE          +      +     +       +    +             
Sbjct: 121 LLSIANSKDESGNSLFAGFKTNTEPFAFDNNGKVVYSGDSGIRDSVVASGVTVGSNIPGD 180

Query: 184 EVSSMNAQQMTDFIKQ---------------------------LEDKFSDDEYWANNWSN 216
            V    A  + D+                                D   +     +    
Sbjct: 181 SVFMNAANAIGDYSVNYSSTQQGKFSVESAKITDPTLPVTGNYTFDFVDNGAGGLDVNVT 240

Query: 217 ASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEF-------------------L 257
            S   +           ++ +     ++                                
Sbjct: 241 DSAGTVTTIPNFDATQPLTVDGIELQLKGTPQAGDSFELAPEQNSNIFDTLNSAIALLED 300

Query: 258 SKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYIS 317
              L          ++L+ V  G   +   R+V G S K++       + +  +  + +S
Sbjct: 301 GSKLNSPQGQAEMAQLLNNVSSGQEQMATSRSVAGNSLKSLENYTSTHKEEQLVNQSALS 360

Query: 318 KSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
               ++   A  +       +     + +K+  +S+ +YL
Sbjct: 361 LLEDLDYAEAITEFEKQQMSLNAVSSVFSKVGSMSLFDYL 400


>gi|183179572|ref|ZP_02957783.1| flagellar hook-associated protein FlgL [Vibrio cholerae MZO-3]
 gi|183012983|gb|EDT88283.1| flagellar hook-associated protein FlgL [Vibrio cholerae MZO-3]
          Length = 397

 Score =  140 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 35/397 (8%), Positives = 111/397 (27%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +           ++ +G+              I    Q++  
Sbjct: 1   MLNRISSFHNYQAVQNDIRRQESKVFNNQAQLASGKKLLSASDNPLATHYIQNVGQQEEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L +  LV  RL   +  +++ ++        ++ ++ G          A +L++  
Sbjct: 61  LRQYLDAIVLVRNRLEHQEVIIANTEEFSDSAKRTVMEMINGSLSPEDRVARARVLQEMA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+  AN+ DE           +        + ++     D   +  +  + +      
Sbjct: 121 NNFINLANVQDESGNYIFAGTKPKNQPFFRDNQGNVTYAGDDYQRKMKISNSLEIPFNNP 180

Query: 182 HLEVS----------------------------SMNAQQMTDFIKQLEDKFSDDEYWANN 213
             +V                             ++N      +     D       +   
Sbjct: 181 GSKVFMEIPNPFGSYEPNYALQEGSELLLERAVNLNPDDTASYRVTFVDMPEGKNGYQLE 240

Query: 214 WSNASDHNIKYRIKDTEGI-------------DVSANVNMRGIRDIMFVAVIGTEFLSKN 260
            + +     ++  K                    +  +  R    +         +   +
Sbjct: 241 RNGSVVQAGEFDAKTGIQFEELNIQVKGQISKGDAIELTPRTTFSVFDTFRDAIRYAEGS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      +++         + + R  +G     ++ +    ++    +    S   
Sbjct: 301 VSDASNTAKLHQLVEEFHTAFIHLNKTRTDIGARLSTLDIQEEQHEDFKISLAKSKSTFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + +     +E S     K + L++ NY+
Sbjct: 361 DLDYAEAVIEFNENSRALEASQKAFGKTKDLTLFNYI 397


>gi|59712474|ref|YP_205250.1| flagellar hook-associated protein FlgL [Vibrio fischeri ES114]
 gi|46394803|gb|AAS91568.1| flagellar hook-associated protein 3 [Vibrio fischeri ES114]
 gi|59480575|gb|AAW86362.1| flagellar hook-associate protein 3, FlgL [Vibrio fischeri ES114]
          Length = 397

 Score =  140 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 36/396 (9%), Positives = 120/396 (30%), Gaps = 41/396 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +                ++ +G+                   Q+K  
Sbjct: 1   MLNRISSFHNYQAVQNDISRQEAKVHHNSAQLASGKKLLTAGDDPVAALYAQNLTQKKEE 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +L   RL   +  +++ ++   D    ++ ++ G         +A  L+   
Sbjct: 61  LRQYTDTITLARNRLERHEVAIANAEQFADDAKRSVMEMINGSLAPEDRYAHAQDLKGIA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+   NM DE           +          ++A    +   +  +  + +  +   
Sbjct: 121 SNFLNLTNMLDESGNYLFSGTKPKTQPFFKANDGTVAYAGDEYQRKLKVSGSIEVAVNDA 180

Query: 182 HLEVSSMNAQQMTDF--------------IKQLEDKFSDDEYWANNWSNASDHNIKYRIK 227
             ++ +       D+               +     ++D   +  ++S +++    Y++ 
Sbjct: 181 GSKLFTEIKNPFGDYDPQYALQEGSELLLSQATNTNYTDPATYEVSFSASANGQYNYQLS 240

Query: 228 DTEGIDVSANVNMR---------------------------GIRDIMFVAVIGTEFLSKN 260
               +  +A  +                                 I       +E    +
Sbjct: 241 KDGSVVKNAQFDPSEGIKYEGVDIQIRGQLKSGDVITLEPKKTISIFDSFKKASELALND 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           + D +     +++          + + RA +G  +  ++++    Q+ +  +   +S   
Sbjct: 301 VADASTTAELQQVTDEFHAAFIHLSQARAEVGTRQNTLDQQEQQHQDFDLTLSKSLSSIE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNY 356
            ++   A  + +     ++ S     K++ +++ NY
Sbjct: 361 DLDYAQAVIEFNENTRALQASQQAFGKVKDITLFNY 396


>gi|258621056|ref|ZP_05716090.1| Flagellar hook-associated protein 3 [Vibrio mimicus VM573]
 gi|262166275|ref|ZP_06034012.1| flagellar hook-associated protein FlgL [Vibrio mimicus VM223]
 gi|262170832|ref|ZP_06038510.1| flagellar hook-associated protein FlgL [Vibrio mimicus MB-451]
 gi|258586444|gb|EEW11159.1| Flagellar hook-associated protein 3 [Vibrio mimicus VM573]
 gi|261891908|gb|EEY37894.1| flagellar hook-associated protein FlgL [Vibrio mimicus MB-451]
 gi|262025991|gb|EEY44659.1| flagellar hook-associated protein FlgL [Vibrio mimicus VM223]
          Length = 397

 Score =  140 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 42/397 (10%), Positives = 111/397 (27%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +           ++ +G+              I    Q++  
Sbjct: 1   MLNRISSFHNYQAVQNDIRRQESKVFNNQAQLASGKKLLSASDNPLATHYIQNVGQQEEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L +  LV  RL   +  +S+ ++        ++ ++ G          A +L++  
Sbjct: 61  LRQYLDAIVLVRNRLEHQEVIISNTEEFSDSAKRTVMEMINGSLSPEDRVARARVLQEMA 120

Query: 122 ESFVTFANMTDEGQ-YLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEE-------- 172
            +F+  AN+ DE   Y+F+G     +P       +        Q                
Sbjct: 121 SNFLNLANVQDESGNYIFAGTKPKNQPFFRDNQGNVTYAGDDYQRKMKISNSLEIPFNNP 180

Query: 173 -----------------------------NSKSLLAGQHLEVSSMNAQQMTDFIKQLEDK 203
                                             L         +    M D     + +
Sbjct: 181 GSKVFMEIPNPYGSYEPNYTLQEGSELLLERAVNLNPDDTSSYRITFVDMPDGKNGYQLE 240

Query: 204 FSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEF---LSKN 260
            +     A  +   +    +      +G     +      RD   V     +       +
Sbjct: 241 RNGSVVQAGEFDPKTGIQFEELNIQVKGQITKGDAIDLTPRDTFSVFDTFRDAIRYAEGS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      +++         + + R  +G     ++ +    ++    +    S   
Sbjct: 301 VSDASNTAKLHQLVEEFHTAFIHLNKTRTDIGARLSTLDIQEEQHEDFKISLAKSKSTFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + +     ++ S     K + L++ NY+
Sbjct: 361 DLDYAEAVIEFNENSRALDASQKAFGKTKDLTLFNYI 397


>gi|238920293|ref|YP_002933808.1| flagellin [Edwardsiella ictaluri 93-146]
 gi|182342509|gb|ACB87394.1| flagellin 4 [Edwardsiella ictaluri]
 gi|238869862|gb|ACR69573.1| flagellin [Edwardsiella ictaluri 93-146]
          Length = 356

 Score =  140 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 29/351 (8%), Positives = 85/351 (24%), Gaps = 3/351 (0%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+ +  +      +         E + +G   +      A       +    N 
Sbjct: 1   MAQVINTNILSLQAQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANRFTANING 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q++    V    G    +        +    
Sbjct: 61  LTQASRNANDGISLAQTTEGALNEVNDNLQNIRRLTVQAQNGSNSESDLQSIQDEITQRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  TD         + +     G     ++                        
Sbjct: 121 DEINRISAQTDFNGVKVLSKDQTLTIQVGADDGQTIGINLSKIDATTLKLNTFDVTNNKN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            +  +      +           S +        + +D               +  V   
Sbjct: 181 RVGSAIEAGTSINYTNAGKAATGSLELTKGQTLVSGTDATGAATYYLKGVDAATGKVTYS 240

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
            ++  +               D       +  L+ V   L+ + + R+ LG  +   +  
Sbjct: 241 SVKFTVDAKDA---TKVTVAADKDVTKDIQTPLADVDSALAQVDKLRSGLGAVQNRFDSV 297

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLS 352
              L +    +    S+    +  T  + +S      +    +  K  + +
Sbjct: 298 ISNLDSTVTNLSASRSRIQDADYATEVSDMSRAQILQQAGTAVLAKANQST 348


>gi|229524185|ref|ZP_04413590.1| flagellar hook-associated protein FlgL [Vibrio cholerae bv.
           albensis VL426]
 gi|229337766|gb|EEO02783.1| flagellar hook-associated protein FlgL [Vibrio cholerae bv.
           albensis VL426]
          Length = 397

 Score =  140 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 36/397 (9%), Positives = 111/397 (27%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +           ++ +G+              I    Q++  
Sbjct: 1   MLNRISSFHNYQAVQNDIRRQESKVFNNQAQLASGKKLLSASDNPLATHYIQNVGQQEEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L +  LV  RL   +  +S+ ++        ++ ++ G          A +L++  
Sbjct: 61  LRQYLDAIVLVRNRLEHQEVIISNTEEFSDSAKRTVMEMINGSLSPEDRVARARVLQEMA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+  AN+ DE           +        + ++     D   +  +  + +      
Sbjct: 121 NNFINLANVQDESGNYIFAGTKPKNQPFFRDNQGNVTYAGDDYQRKMKISNSLEIPFNNP 180

Query: 182 HLEVS----------------------------SMNAQQMTDFIKQLEDKFSDDEYWANN 213
             +V                             ++N      +     D       +   
Sbjct: 181 GSKVFMEIPNPFGSYEPNYALQEGSELLLERAVNLNPDDTASYRVTFVDMPEGKNGYQLE 240

Query: 214 WSNASDHNIKYRIKDTEGI-------------DVSANVNMRGIRDIMFVAVIGTEFLSKN 260
            + +     ++  K                    +  +  R    +         +   +
Sbjct: 241 RNGSVVQAGEFDAKTGIQFEELNIQVKGQISKGDAIELTPRTTFSVFDTFRDAIRYAEGS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      +++         + + R  +G     ++ +    ++    +    S   
Sbjct: 301 VSDASNTAKLHQLVEEFHTAFIHLNKTRTDIGARLSTLDIQEEQHEDFKISLAKSKSTFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + +     +E S     K + L++ NY+
Sbjct: 361 DLDYAEAVIEFNENSRALEASQKAFGKTKDLNLFNYI 397


>gi|238796921|ref|ZP_04640425.1| Flagellin [Yersinia mollaretii ATCC 43969]
 gi|238719181|gb|EEQ10993.1| Flagellin [Yersinia mollaretii ATCC 43969]
          Length = 373

 Score =  140 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 30/363 (8%), Positives = 92/363 (25%), Gaps = 14/363 (3%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+         +         + + +G   +      A       +      
Sbjct: 1   MAQVINTNSLSLVAQNNLNKSQSSLGTAIQRLSSGVRINSAKDDAAGQAISNRFTANITG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q++         G    +        +    
Sbjct: 61  LTQASRNANDGISIAQTTEGALNEVNDNLQNIRRLTAQAQNGTNSESDRKSIQDEINARM 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 +  T+         + +     G     ++         +    +      A  
Sbjct: 121 AEINRISEQTEFNGVKVLSKDQTLSIQVGANDGQTIDIALSQMNAETLGMDGFDITAATA 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKF--------------SDDEYWANNWSNASDHNIKYRIK 227
             +  +   +          D                + +     + + A+ +    + K
Sbjct: 181 GAKAITAGTEVTDGTSTVTLDAAAIKDMKEAAFGVDGTGEISLVTDETGATFYAAVGKEK 240

Query: 228 DTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQ 287
           D   +  S             V      F         +    K  L T+ + ++ + E 
Sbjct: 241 DGTEVSTSLTATFVAEVPGPPVVPASVTFAKDADLTTDQLDAMKGPLKTIDEAMAKVDEL 300

Query: 288 RAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTK 347
           R+ LG ++   +     L +  N +    S+ +  +  +  + +S           +  +
Sbjct: 301 RSGLGAAQNRFDSVISNLNSTVNNLTESRSRILDADFASEVSNMSRANILQSAGITVLAQ 360

Query: 348 LQK 350
             +
Sbjct: 361 ANQ 363


>gi|38050179|gb|AAR10708.1| phase 1 flagellin [Salmonella enterica]
          Length = 413

 Score =  140 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 34/403 (8%), Positives = 91/403 (22%), Gaps = 54/403 (13%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+         +         E + +G   +      A       +      
Sbjct: 1   MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANRFTSNIKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +++   + +       T++  L+ +   +Q +    V    G    +        +    
Sbjct: 61  LSQASRNANDGISIAQTTEGALNEINNNLQRVRELSVQAANGSNSGSDLKSIQDEIDQRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKK--------------SFDQMLQ 167
                 A  TD         +       G    +++                    + + 
Sbjct: 121 NEINRVAEQTDFNGKKVLSQDGQLTIQVGANDGETITIDLQKIDKTELGLDKLDVTKGIA 180

Query: 168 GFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIK 227
             +   +  +   +       NA+              DD   A  ++   D        
Sbjct: 181 TTVSSGASVVGDVKIAAADFDNAKATGGPAADKLSLTKDDTAAAKYYAATVDTTTGKISF 240

Query: 228 DTEGIDVSANVNMRGIRDIMF--------------------------------------- 248
           D++    ++      +  +                                         
Sbjct: 241 DSDKDVTASAGTPTAVSTLSREVKFDGADLKADQSLVKYKDDKGKDLYAIQTLDKDGNAS 300

Query: 249 -VAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQN 307
             +V  +                   L+ +   L  +   R+ LG  +         L N
Sbjct: 301 FKSVTFSSDGKTTEGAAVALAANVDPLAKIDDALKTVDAFRSQLGAVQNRFESAITNLGN 360

Query: 308 KNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
             N + +  S+    +  T  + +S      +    +  +  +
Sbjct: 361 TVNNLSSARSRIEDSDYATEVSNMSRAQILQQAGTSVLAQANQ 403


>gi|326886209|gb|AEA08751.1| flagellin D [Listonella anguillarum]
          Length = 377

 Score =  140 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 39/362 (10%), Positives = 89/362 (24%), Gaps = 18/362 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             +       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNSASNAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G             +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKADRVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K              S + M          S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFETKSFQIGADNGEAVMLSLNNMRSDNAMMGGTSYQAAN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D    L+D    D+    +     D        + +   V A+V+  
Sbjct: 181 GKDKDWSVQAGSNDLQITLKDTSGTDQTINISAKEGDDIEELATYINGQTDMVKASVDDE 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +   +                      + ++ ++ D       ++ ++ V   L  
Sbjct: 241 GKLQVFAGSNKVEGPVTFAGGLAGELGMQAGQAVTVDVIDVTSVGGAQESVAIVDAALQF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   +     L N N  +    S+    +       L+      + S  
Sbjct: 301 VDSHRAQLGAFQNRFSHAISNLDNINENVSASKSRIKDTDFAKETTALTKSQILSQASSS 360

Query: 344 IT 345
           + 
Sbjct: 361 VL 362


>gi|225375841|ref|ZP_03753062.1| hypothetical protein ROSEINA2194_01473 [Roseburia inulinivorans DSM
           16841]
 gi|225212276|gb|EEG94630.1| hypothetical protein ROSEINA2194_01473 [Roseburia inulinivorans DSM
           16841]
          Length = 392

 Score =  140 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 31/379 (8%), Positives = 89/379 (23%), Gaps = 35/379 (9%)

Query: 9   SSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHS 68
           +      N +         K  E++ +G   +      A +T   +  ++   + +   +
Sbjct: 6   NLQAMNANRMLNVTTGQQAKSTEKLSSGYRINRAADDAAGLTISEKMRKQIKGLDQASTN 65

Query: 69  NSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFA 128
                  + T++  L+ +  ++Q M    V    G    +        +          +
Sbjct: 66  AQDGVSAVQTAEGALTEVHSMLQRMNELAVQSANGTNAQSDRDAIQAEITQLTTEIDRVS 125

Query: 129 NMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEV--- 185
             T   +      +S       ++    +     D  L+G      K  +A         
Sbjct: 126 ETTKFNEIYLLKGDSKTTKDVTFYKSGYVTNDDMDLFLEGSTTAIDKKDIADAVASGKKL 185

Query: 186 -------------------------------SSMNAQQMTDFIKQLEDKFSDDEYWANNW 214
                                           +   +   +  K+       ++      
Sbjct: 186 YTEAAKAAGQKQADDKLAKKGTDYAYLTKIYDNTGKELSAEEAKKATGDLFANKEHTVKV 245

Query: 215 SNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFL-SKNLTDGARNVLTKKM 273
              +D+     +      ++    +      I       +           +        
Sbjct: 246 KTKTDYLTTNTVNGELSFNLHVGADSEADNKIGVSIETMSSLGIGVKDLKVSTEDDATVA 305

Query: 274 LSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLST 333
           + T+   +  +  QR+ LG  +  +      L N         S+    +        S 
Sbjct: 306 IDTIAAAIQKVSSQRSALGAVQNRLEHTIDNLDNVVENTTAAESRIRDTDMAEEMVNYSK 365

Query: 334 LINKIEMSYMITTKLQKLS 352
                +    +  +  + +
Sbjct: 366 NNILAQAGQSMLAQANQST 384


>gi|496298|gb|AAA93096.1| thermoregulated motility protein [Yersinia enterocolitica (type
           O:8)]
          Length = 364

 Score =  140 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 38/354 (10%), Positives = 87/354 (24%), Gaps = 6/354 (1%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              I+T+S+         +         E + +G   +      A       +    N +
Sbjct: 1   MAVINTNSLSLLTQNNLNKSQSSLGTAIERLSSGLRINSAKDDAAGQAIANRFTSNINGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
                + +       T++  L  +   +Q +    V         +        +    E
Sbjct: 61  TVAARNANDGISLSQTAEGALGEINNNLQRVRDLTVQAQNSSNSASDIDSIQSEVNQRME 120

Query: 123 SFVTFANMTDEGQYL-FSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                   TD            ++   +   +KD+      D         +     +  
Sbjct: 121 EINRVTKQTDFNGIKVLDNRTKTDSSYDFRRSKDNEQISIGDWCKFWLESGDRADGTSSD 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDT-----EGIDVSA 236
            +   +   +   D  +   D  +     A     A D        D            A
Sbjct: 181 TVNTYAFTKKAALDTAQTDYDTANTAYLAAVKSGVAGDITTTKATLDGKNTALATAVKDA 240

Query: 237 NVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEK 296
                 +   +         +                L+ + + L  +  QR+VLG S+ 
Sbjct: 241 TAVNEAVNGKVRTVAAKGFDVLNGTVAADGKATGTTPLADIDKALKAVDTQRSVLGASQN 300

Query: 297 NINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
                   L N  N + +  S+    +  T  + +S      +    +  +  +
Sbjct: 301 RFESTITNLNNTVNNLTSARSRIQDADYSTEVSNMSRAQILQQAGTSVLAQANQ 354


>gi|157376209|ref|YP_001474809.1| flagellar hook-associated protein FlgL [Shewanella sediminis
           HAW-EB3]
 gi|157318583|gb|ABV37681.1| flagellar hook-associated protein 3 [Shewanella sediminis HAW-EB3]
          Length = 396

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 42/398 (10%), Positives = 121/398 (30%), Gaps = 46/398 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST+ +F +      +    + K+ +++ +G+  +           I    Q+   + 
Sbjct: 1   MRISTAQMFNQGITSVLDRQSATSKILDQLSSGKKVNTAGDDPVAAVGIDNLNQQNALVD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +    T  L+ +++ L + +K+V      ++  + G   +++  + A  LR + + 
Sbjct: 61  QFVKNIEYATNHLAITESKLGTAEKLVGSSRELVIRAVNGGLADSERQMIADELRGTLDE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            ++ AN  DE        N +      +    ++     + + Q  +             
Sbjct: 121 LLSVANTKDESGNYMFSGNETGTQAFAFDATGNIVYSGDNGVRQSVVASGVTIGTNIPGD 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDD------------------------------------ 207
                    M D+        + D                                    
Sbjct: 181 SAFMNAPSGMGDYSANYLATQAGDFKVESAKITNPAVHVEQTYTFTMVGADLEIRDATNT 240

Query: 208 --------EYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSK 259
                   +       N  +  +       +   +S   N+     I     +       
Sbjct: 241 LVQTEVNFDSSNPIVYNGLEVKLDGMPAAGDSFSISPAANVSIFDTINEAITLLESP--N 298

Query: 260 NLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKS 319
            +          ++L+ +  G++ I  +R V G + K++    +    +  +  + +S  
Sbjct: 299 KINTPQGMAELAQVLNNIDSGVNQISIERGVAGNNLKSLESHNMTHVEEKVVNSSALSML 358

Query: 320 IGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             ++  +A  +       +     + +K+  +S+ +Y+
Sbjct: 359 EDLDYASAITEYEKQQLALNAVSNVFSKVGSVSLFDYI 396


>gi|124268051|ref|YP_001022055.1| flagellin-related hook-associated protein [Methylibium
           petroleiphilum PM1]
 gi|124260826|gb|ABM95820.1| flagellin-related hook-associated protein [Methylibium
           petroleiphilum PM1]
          Length = 404

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 29/395 (7%), Positives = 80/395 (20%), Gaps = 45/395 (11%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+ I                   + + +G   +      A +        +   
Sbjct: 1   MAQTINTNVISLNAQRNLNTSQSSLATSMQRLSSGLRVNSAKDDAAGLAIAERMNTQVRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +     + +       T++  L  +  ++Q M    V         +        +    
Sbjct: 61  LNVAARNANDGISLAQTAEGALGKLGDMLQRMRELAVQSANATNSADDRKALQAEVNQLR 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T          + +                         +           
Sbjct: 121 DEIDRVAKQTSFNGKKLLDGSFTAATFQVGANSGDAITVGSLTNATAAVLSKITYAEGAS 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                          I   + + + D   AN          +   +      ++  +N +
Sbjct: 181 ADLTLDGTTITDLAAIADGDLQITIDGGGANEQIVEVGPIAEASTETERLGQIAEAINRK 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT--------------------------------------- 262
                +   ++  +  +  L                                        
Sbjct: 241 TTDTGVSAYLVKNDDGTFKLDIKASKLDAAGAALAVEFTGFTTATTGLDEGDAIAEVADD 300

Query: 263 ------DGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYI 316
                 +   +  T   +  +   L  I   R  LG  +         +Q +   +    
Sbjct: 301 IGLSDLNIETDSATWVSIKKIDSALDQINGARGTLGALQSRFENAVSNIQIQAENLSAAR 360

Query: 317 SKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKL 351
            + +  +     A LS      +    +  +  +L
Sbjct: 361 GRIMDADFAMETANLSRAQILQQAGTAMVAQANQL 395


>gi|262404533|ref|ZP_06081088.1| flagellar hook-associated protein FlgL [Vibrio sp. RC586]
 gi|262349565|gb|EEY98703.1| flagellar hook-associated protein FlgL [Vibrio sp. RC586]
          Length = 397

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 42/397 (10%), Positives = 110/397 (27%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +           ++ +G+              I    Q++  
Sbjct: 1   MLNRISSFHNYQAVQNDIRRQESKVFNNQAQLASGKKLLSASDNPLATHYIQNVGQQEEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L +  LV  RL   +  +S+ ++        ++ ++ G          A +L++  
Sbjct: 61  LRQYLDAIVLVRNRLEHQEVIISNTEEFSDSAKRTVMEMINGSLSPEDRVARARVLQEMA 120

Query: 122 ESFVTFANMTDEGQ-YLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEE-------- 172
            +F+  AN+ DE   Y+F+G     +P       +        Q                
Sbjct: 121 SNFLNLANVQDESGNYIFAGTKPKNQPFFRDNQGNVSYAGDDYQRKMKISNSLEIPFNNP 180

Query: 173 -----------------------------NSKSLLAGQHLEVSSMNAQQMTDFIKQLEDK 203
                                             L         +    M D     + +
Sbjct: 181 GSKVFMEIPNPFGSYEPNYTLQEGSELLLERAVNLNPDDTSAYRVTFVDMPDGKNGYQLE 240

Query: 204 FSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEF---LSKN 260
            +     +  +   +           +G     +      RD   V     +       +
Sbjct: 241 RNGSVVQSGEFDPKTGIQFAELNIQVKGQITKGDAIDLTPRDTYSVFDTFRDAIRYAEGS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      +++         + + R  +G     ++ +    ++    +    S   
Sbjct: 301 VSDASNTAKLHQIVEEFHTAFIHLNKTRTDIGARLNTLDIQEEQHEDFKISLAKSKSTFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + +     +E S     K + L++ NY+
Sbjct: 361 DLDYADAVIEFNENSRALEASQKAFGKTKDLTLFNYI 397


>gi|197335226|ref|YP_002156687.1| A-type flagellin [Vibrio fischeri MJ11]
 gi|197316716|gb|ACH66163.1| A-type flagellin [Vibrio fischeri MJ11]
          Length = 378

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 37/369 (10%), Positives = 98/369 (26%), Gaps = 21/369 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  ++T+                  +  E + +G   +      A +        +   
Sbjct: 1   MSITVNTNVSAMTAQRYLNSATDGVNQSMERLSSGSKINSAKDDAAGLQISNRLNTQTRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  +     I+  +    +    G   +         +    
Sbjct: 61  LDVAVRNANDGISMMQTAEGAMKETSNILSRVRDLALQSSNGSNTDADRQAIQQEVTALS 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       N   K              + + +         K+  A +
Sbjct: 121 DEMNRIAETTSFGGTRLLNGNFGTKSFQVGADSGEAVMLTLNNLRADEANMGGKTFTASE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            +       +     I  + DK  +++    N     D        + +   VSA+V   
Sbjct: 181 GVAAGWTAGKDANMTIT-IADKNGEEQAIEINAKAGDDIEEVATYINGQTDKVSASVGED 239

Query: 242 G--------------------IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
           G                    +     +A       +    D      ++  ++ V   +
Sbjct: 240 GKLQVFAAKDVAEGEISFSGALAKETGMADAEVANKTVGNIDVTTVAGSQNAVAVVDAAM 299

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             +   R+ LG ++  +      L N N  +    S+   V+      +++      + S
Sbjct: 300 KFVDSHRSELGAAQNRMGHTISNLDNINENVSASKSQIKDVDFAKETTEMTKSQILQQAS 359

Query: 342 YMITTKLQK 350
             I  + ++
Sbjct: 360 SSILAQAKQ 368


>gi|238920300|ref|YP_002933815.1| flagellin [Edwardsiella ictaluri 93-146]
 gi|182342505|gb|ACB87390.1| flagellin 1 [Edwardsiella ictaluri]
 gi|238869869|gb|ACR69580.1| flagellin [Edwardsiella ictaluri 93-146]
          Length = 353

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 34/348 (9%), Positives = 91/348 (26%), Gaps = 6/348 (1%)

Query: 5   GISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAE 64
            I+T+ +         +         E + +G   +      A       +    N + +
Sbjct: 4   VINTNILSLEAQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANRFTANINGLTQ 63

Query: 65  RLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESF 124
              + +       T++  L+ +   +Q++    V    G    +        +    +  
Sbjct: 64  ASRNANDGISLAQTTEGALNEVNDNLQNIRRLTVQAQNGTNSESDLQSIQDEITQRLDEI 123

Query: 125 VTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLE 184
              +  TD         + S     G     ++     +  +      +   +  G  + 
Sbjct: 124 NRISAQTDFNGVKVLSKDQSLTIQVGADDGQTIGINLRNMDVGTLGLNSFSVMTKGTRVG 183

Query: 185 VSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIR 244
            +      +T                A   + +         +    I    +       
Sbjct: 184 DTVSVGTMVTPTAGGKMVAVQAVPTAAKGSTASLVSGTSAAGQAGYYIKTVNDSTGVATY 243

Query: 245 DIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVF 304
               +   G       +TD          L+T+ + LS + + R+ LG  +   +     
Sbjct: 244 TTATIDDKGVVTAGTKVTDLQTP------LATLDKALSQVDDLRSGLGAVQNRFDSVISN 297

Query: 305 LQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLS 352
           L +    +    S+    +  T  + +S      +    +  K  + +
Sbjct: 298 LDSTVTNLTASRSRIQDADYATEVSDMSRAQILQQAGTAVLAKANQST 345


>gi|110632638|ref|YP_672846.1| flagellar hook-associated protein FlgL [Mesorhizobium sp. BNC1]
 gi|110283622|gb|ABG61681.1| flagellar hook-associated protein 3 (HAP3) flgL [Chelativorans sp.
           BNC1]
          Length = 349

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 100/357 (28%), Positives = 177/357 (49%), Gaps = 9/357 (2%)

Query: 1   MKTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKN 60
           MK + +STS+I + +      +  D VK  +E+ +G+ +D G  LGAR       ++E +
Sbjct: 1   MKVSFVSTSAISQTLRYQMMRMQADLVKNQKELDSGRLADPGATLGARAGFSFSMDREIS 60

Query: 61  HIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDS 120
            +   + +NSL   RL+ +Q +L+ +  I Q+++  L   L G  D +     A     +
Sbjct: 61  RLENVIDANSLAANRLTATQNNLTQLTDISQELLATLSAALSGVNDTSIVKSGAT---RA 117

Query: 121 YESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
            ES  +  N    G+YLF+GIN+  KP+N +    S  K  FD     F         A 
Sbjct: 118 LESMTSVLNSNFNGEYLFAGINTDVKPINDFTDPASPNKAQFDAQFLAFFG------FAQ 171

Query: 181 QHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNM 240
                S + A Q+ DF+  + +       W++ WS ASD  I  RI   E  + S   N 
Sbjct: 172 NDPAASGITASQIEDFLDTVIEPAFMGTGWSDAWSGASDEKITSRIAANETAETSTTANG 231

Query: 241 RGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINE 300
            G+R +   + + +EFL   L D AR  L ++  S V + +  I   +A +G++E  + +
Sbjct: 232 AGMRKLAMASAVLSEFLEIPLGDEARQTLYQRTTSLVGEAIPAIASVQAEVGLAETRLQD 291

Query: 301 ERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
               + ++ ++  T+I    GV+ + A  +++ ++ +IE+SY +T+++Q+LS+L YL
Sbjct: 292 ATDRISSQIDLFKTFIRDLEGVDPYEASTRVNEILTQIELSYALTSRIQQLSLLRYL 348


>gi|71278519|ref|YP_268229.1| flagellar hook-associated protein FlgL [Colwellia psychrerythraea
           34H]
 gi|71144259|gb|AAZ24732.1| flagellar hook-associated protein FlgL [Colwellia psychrerythraea
           34H]
          Length = 406

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 44/406 (10%), Positives = 108/406 (26%), Gaps = 52/406 (12%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +STS  + +  +L  + + D     E + +G+             ++  +  +   I 
Sbjct: 1   MRVSTSQFYLQSALLMNQKSADVNNQMEHLSSGKRVLTAKDDAVSYGTLSGFNDDLASIE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + ++     S  +   +  + ++      +++   G+  N      A  +R   + 
Sbjct: 61  KYKRNITMAENHNSMQEVIFADAETLLDKFKQDMLLANNGRMSNEDLQSIADQMRHGLDQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +   N  DE          +++         S+       + +  + +N +        
Sbjct: 121 LIDLGNSQDEKGDYIFSGFQTQQKPFSQQVDGSVDYNGDKGVNELQVAKNIQIPTNQTGD 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
                    + DF         +    A   +N  D N                 N   +
Sbjct: 181 AAFLNIDNAIGDFTATYPTVPVNTSGVAVESANVVDRNTYNVSTGPHTFSFDPITNYLTV 240

Query: 244 RDIM----------------------------------------------------FVAV 251
            D                                                        A+
Sbjct: 241 TDSTLPIPAVVFPPAPYVAGQTISFDGIDVTLSGNPLPGDSFVINEKQNISIFETLNNAI 300

Query: 252 IGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNI 311
              E    +       V    +L  +   ++ I  +RA  GI  + +  ++    +    
Sbjct: 301 SWAEQGVVSTNQEQHQVDYNTVLDQLSSAMNHIYSRRADAGIRLQALENQQSKHLDVELN 360

Query: 312 IDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           I    S    ++   A ++       +  S    +K+Q L++ NY+
Sbjct: 361 ISKGKSSIEDLDFAKAISEFEQSKIALTASQQTFSKVQGLTLFNYI 406


>gi|127512286|ref|YP_001093483.1| flagellar hook-associated protein FlgL [Shewanella loihica PV-4]
 gi|126637581|gb|ABO23224.1| flagellar hook-associated protein 3 [Shewanella loihica PV-4]
          Length = 396

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 41/396 (10%), Positives = 112/396 (28%), Gaps = 42/396 (10%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST+ +F +           + K+ +++ +G+  +           I    Q+   + 
Sbjct: 1   MRISTAQMFNQNINSVLNKQSATSKIIDQIASGKRVNTAGDDPVAAIGIDNLNQQNALVD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +    T RL+ +++ L + + +   +   ++  + G   +++  + A  L+ + E 
Sbjct: 61  QFMKNIDYATNRLALTESKLGTAETLTGSVREQILRAVNGSLSDSERQMIADELKGTLEE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V+ AN  DE          +      +    ++       + Q  +             
Sbjct: 121 LVSVANTKDESGNYMFAGYETGNQPFAFNAAGNVVYSGDSGVRQAIVASGVTLGTNVPGD 180

Query: 184 EVSSMNAQQMTDFIKQ----------------LEDKFSDDEYWANNWSNASDHNIKYRIK 227
           +        + DF                    +     D+ ++   + A+         
Sbjct: 181 QAFMNAPSGLGDFSANYLSTQTGDFRVLSAAISDPATYVDDTYSFTMNGANLEIRDSSAT 240

Query: 228 DTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARN-------------------- 267
               +      N      I                                         
Sbjct: 241 LVTTVPNFDAANPINFNGIEVKLDGQPAPGDTFSITPQSQVSVFDTINQAITLLEDPNKV 300

Query: 268 ------VLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIG 321
                     +ML+ +  G++ +   R   G S K I         +  +  + +S    
Sbjct: 301 NTPQGKAELAQMLNNIDSGVNQLSTARGEAGNSLKQIERYSSTHVEEKLVNSSALSMLED 360

Query: 322 VEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           ++  +A  +L      +     + +K+   ++ +Y+
Sbjct: 361 LDYASAITELEKQQLALNAVSSVFSKVGSTTLFDYI 396


>gi|262276409|ref|ZP_06054218.1| flagellar hook-associated protein FlgL [Grimontia hollisae CIP
           101886]
 gi|262220217|gb|EEY71533.1| flagellar hook-associated protein FlgL [Grimontia hollisae CIP
           101886]
          Length = 397

 Score =  139 bits (350), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 41/397 (10%), Positives = 121/397 (30%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             + I++   ++ ++              +E+ TG+              I  + Q+   
Sbjct: 1   MISRIASFHNYQSVSNDLMRQQVKLQDNQDELATGKRVLTAGDDPVSSIYIQNFRQQDKQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + + S +L   R + ++  +   +++V       + ++ G    +    +   L+  Y
Sbjct: 61  LDQYVDSITLARNRQTRAEIAIDDAEQLVDSAKRKTMEMINGSLSEDDRTAHRQDLKGLY 120

Query: 122 ESFVTFANMTDEGQY-LFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
           ++F+   N  DE    LFSG  SS++P       +                         
Sbjct: 121 DNFMNLVNAKDESGNFLFSGTQSSKQPFYRDGALNVRYAGDSYHRTAQVAPAVEVQTSDP 180

Query: 181 QHLEVSSM--------------NAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRI 226
                 ++              +   +     +  +   + EY  +   + +        
Sbjct: 181 GDEVFMTIKNPFGDYQPEYELNSGSLLLLAQAKNSNNTDNAEYAVSFTVDGAGQTTYELT 240

Query: 227 KDTEGIDVSANVNMRGIR--------------------------DIMFVAVIGTEFLSKN 260
           +D   +         G++                          ++      G E   ++
Sbjct: 241 QDGNVVSSGVYDPQTGVQWGTLSLSFEGEMLDGDRIVLERQDTFNVFDAFKKGIELSYES 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           + D +      ++          + + R+ +G     ++ +    ++   +++  +    
Sbjct: 301 IFDASATAELHQVTEQFSAAFKHLNKARSEVGTRLTTLDRQESMHKDFKLVLNRSLGTME 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++  TA   ++  +  ++ S     K + LS+ NY+
Sbjct: 361 DLDYSTAVIDMNENMLALQASQQAFAKTKDLSLFNYI 397


>gi|121535556|ref|ZP_01667364.1| flagellar hook-associated protein 3 [Thermosinus carboxydivorans
           Nor1]
 gi|121305884|gb|EAX46818.1| flagellar hook-associated protein 3 [Thermosinus carboxydivorans
           Nor1]
          Length = 323

 Score =  139 bits (350), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 37/354 (10%), Positives = 103/354 (29%), Gaps = 32/354 (9%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + I         +  +   ++ E++  G++         +    L +        
Sbjct: 1   MRITNNIISYNFLNSLNKALERQNEIQEQLADGKAIHRPSDDPIKTIRSLRFNTNLAMNE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       L T+   LS +  IV       +  + G      F   A  +    + 
Sbjct: 61  QFTQNVKDALSWLETTDGALSDLSSIVIRAKELTIEAV-GPNPTEAFAAIAQEINGLIDH 119

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V  AN     +Y+F+G      P          +                         
Sbjct: 120 AVQVANTKIGDRYIFAGQKDKTTPFERRMVDPDPSV--------------------TGDE 159

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
             + + +  +     ++     + +  + N + A    +    ++ + I ++   +    
Sbjct: 160 FEAVVYSGDINAISMRIYPGAINPQQDSVNVTGADVFGLTSVKENGQTIYIAKAFDQ--- 216

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                   +          +     L+ + ++ + +  + I+  +  +G         + 
Sbjct: 217 --------LLKIKAELEKPNPDVQWLSNQGMAWIDEIHTRILNAQTKIGTRMSMYEMAQN 268

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L+  N  I   IS +  ++   A     T  N    +  +  ++   S++++L
Sbjct: 269 MLEQDNTTITGDISANEDLDMPKAIIDFKTSENVYRSALAVGARIMPASLVDFL 322


>gi|297580836|ref|ZP_06942761.1| flagellar hook-associated protein FlgL [Vibrio cholerae RC385]
 gi|297534662|gb|EFH73498.1| flagellar hook-associated protein FlgL [Vibrio cholerae RC385]
          Length = 397

 Score =  139 bits (350), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 36/397 (9%), Positives = 113/397 (28%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +           ++ +G+              I    Q++  
Sbjct: 1   MLNRISSFHNYQAVQNDIRRQESKVFNNQAQLASGKKLLSASDNPLATHYIQNVGQQEEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L +  LV  RL   +  +S+ ++        ++ ++ G          A +L++  
Sbjct: 61  LRQYLDAIVLVRNRLEHQEVIISNTEEFSDSAKRTVMEMINGSLSPEDRVARARVLQEMA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+  AN+ DE           +        + ++     D   +  +  + +      
Sbjct: 121 NNFINLANVQDESGNYIFAGTKPKNQPFFRDNQGNVTYAGDDYQRKMKISNSLEIPFNNP 180

Query: 182 HLEVS----------------------------SMNAQQMTDFIKQLEDKFSDDEYWANN 213
             +V                             ++N+     +     D       +   
Sbjct: 181 GSKVFMEIPNPFGSYEPNYALQEGSELLLERAVNLNSDDTASYRVTFVDMPEGKNGYQLE 240

Query: 214 WSNASDHNIKYRIKDTEGID-------------VSANVNMRGIRDIMFVAVIGTEFLSKN 260
            + +     ++  K     +              +  +  R    +         +   +
Sbjct: 241 RNGSVVQAGEFDAKTGIQFEELNIQVKGQISKGDTIELTPRTTFSVFDTFRDAIRYAEGS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      +++         + + R  +G     ++ +    ++    +    S   
Sbjct: 301 VSDASNTAKLHQLVEEFHTAFIHLNKTRTDIGARLSTLDIQEEQHEDFKISLAKSKSTFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + +     +E S     K + L++ NY+
Sbjct: 361 DLDYAEAVIEFNENSRALEASQKAFGKTKDLTLFNYI 397


>gi|261211315|ref|ZP_05925603.1| flagellar hook-associated protein FlgL [Vibrio sp. RC341]
 gi|260839270|gb|EEX65896.1| flagellar hook-associated protein FlgL [Vibrio sp. RC341]
          Length = 397

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 43/397 (10%), Positives = 110/397 (27%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +           ++ +G+              I    Q++  
Sbjct: 1   MLNRISSFHNYQAVQNDIRRQESKVFNNQAQLASGKKLLSASDNPLATHYIQNVGQQEEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L +  LV  RL   +  +S+ ++        ++ ++ G          A +L++  
Sbjct: 61  LRQYLDAIVLVRNRLEHQEVIISNTEEFSDSAKRTVMEMINGSLSPEDRVARARVLQEMA 120

Query: 122 ESFVTFANMTDEGQ-YLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEE-------- 172
            +F+  AN+ DE   Y+F+G     +P       +        Q                
Sbjct: 121 SNFLNLANVQDESGNYIFAGTKPKNQPFFRDNQGNVSYAGDDYQRKMKISNSLEIPFNNP 180

Query: 173 -----------------------------NSKSLLAGQHLEVSSMNAQQMTDFIKQLEDK 203
                                             L         +    M D     + +
Sbjct: 181 GSKVFMEIPNPFGSYEPNYALQEGSELLLERAVNLNPDDTAAYRVTFVDMPDGNNGYQLE 240

Query: 204 FSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEF---LSKN 260
            +     A  +   +           +G     +      RD   V     +       +
Sbjct: 241 RNGSVVQAGEFDPKTGIQFNELNIQVKGQITKGDAIDLTPRDTYSVFDTFRDAIRYAEGS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      +++         + + R  +G     ++ +    ++    +    S   
Sbjct: 301 VSDASNTAKLHQIVEEFHTAFIHLNKTRTDIGARLNTLDIQEEQHEDFKISLAKSKSTFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + +     +E S     K + L++ NY+
Sbjct: 361 DLDYADAVIEFNENSRALEASQKAFGKTKDLTLFNYI 397


>gi|153841543|ref|ZP_01993414.1| polar flagellin B/D [Vibrio parahaemolyticus AQ3810]
 gi|149745469|gb|EDM56720.1| polar flagellin B/D [Vibrio parahaemolyticus AQ3810]
          Length = 367

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 44/368 (11%), Positives = 87/368 (23%), Gaps = 20/368 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K                  M          S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTHGAKSFQIGADNGEAVMLELKDMRSDNKMMGGVSYQAES 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   AQ   D    L D F  ++    N     D        + +   V A+V+  
Sbjct: 181 GKGKDWNVAQGKNDLKISLTDSFGQEQEININAKAGDDIEELATYINGQTDLVKASVDQD 240

Query: 242 GIRDIMFVAV-------------------IGTEFLSKNLTDGARNVLTKKMLSTVQQGLS 282
           G   I                           + ++ +  D       ++ ++ +   L 
Sbjct: 241 GKLQIFAGNNKVEGEVSFSGGLSGELGLGDDKKNVTVDTIDVTSVGGAQESVAIIDAALK 300

Query: 283 GIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSY 342
            +   RA LG  +   N     L N N  ++   S+    +               + S 
Sbjct: 301 YVDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTH-DQSQILSQASS 359

Query: 343 MITTKLQK 350
               K  K
Sbjct: 360 SSLRKRNK 367


>gi|33601518|ref|NP_889078.1| flagellin [Bordetella bronchiseptica RB50]
 gi|729510|sp|Q06064|FLAA_BORBR RecName: Full=Flagellin
 gi|289454|gb|AAA22977.1| flagellin [Bordetella bronchiseptica]
 gi|33575954|emb|CAE33033.1| flagellin [Bordetella bronchiseptica RB50]
          Length = 391

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 32/381 (8%), Positives = 85/381 (22%), Gaps = 32/381 (8%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+ +         +         E + +G   +      A       +      
Sbjct: 1   MAAVINTNYLSLVAQNNLNKSQSALGSAIERLSSGLRINSAKDDAAGQAIANRFTANVKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q +    V    G    +        +    
Sbjct: 61  LTQAARNANDGISIAQTTEGALNEINNNLQRIRELTVQASNGTNSASDIDSIQQEVNQRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKP--------------------------------LN 149
           E     A  TD         N+++                                    
Sbjct: 121 EEINRIAEQTDFNGIKVLKSNATDMTLSIQVGAKDNETIDIKIDRNSNWNLYDAVGTVPG 180

Query: 150 GYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEY 209
           G    ++    +    +   +     S        V++                + D   
Sbjct: 181 GTVNGEARTVNALGFDVLSAVTTTIASDTVTFDAAVAAAEQAAGAAVGDGSVVSYGDTAN 240

Query: 210 WANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVL 269
                   +   +       +    +A  +  G                    +   +  
Sbjct: 241 PQYAVVVDNAGTMTSYALTFDKDGKAALGDQLGAVASQAAEAAVGTNDVAAGANVTVSGG 300

Query: 270 TKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHA 329
               LS +   +  + EQR+ LG  +         L N    +    S+    +  T  +
Sbjct: 301 AADALSKLDDAMKAVDEQRSSLGAIQNRFESTVANLNNTITNLSAARSRIEDSDYATEVS 360

Query: 330 QLSTLINKIEMSYMITTKLQK 350
            ++      +    +  +  +
Sbjct: 361 NMTKNQILQQAGTSVLAQANQ 381


>gi|148976403|ref|ZP_01813109.1| flagellin [Vibrionales bacterium SWAT-3]
 gi|145964226|gb|EDK29482.1| flagellin [Vibrionales bacterium SWAT-3]
          Length = 377

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 37/367 (10%), Positives = 90/367 (24%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNNANSAQQTSMERLASGSKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQSMRDLSLQSSNGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +              +   M     +   KS     
Sbjct: 121 DELNRIAETTSFGGNKLLNGTYGTQSFQIGADNGEAVMLNLKDMRSDNAQMVGKSYQTEN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +          D      D F   +    +     D        + +   V A+V   
Sbjct: 181 AKDKDWNVQAGSNDLKLSFTDNFGQAQEIDISAKAGDDIEELATYINGQQDSVKASVTED 240

Query: 242 GIRDIMFVAVIGTEF------------------LSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +       +                    ++ +  D       ++ ++ +   L  
Sbjct: 241 GKLQMFAGNNKVSGDVSFSGGLAGELGIQASKEVTVDTIDVTSVGGAQESVAIIDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   +     L N N  ++   S+    +      Q++      + S  
Sbjct: 301 VDSHRAELGAFQNRFDHAISNLDNINENVNASKSRIKDTDFAKETTQMTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|54308105|ref|YP_129125.1| flagellin [Photobacterium profundum SS9]
 gi|46912531|emb|CAG19323.1| putative flagellin A [Photobacterium profundum SS9]
          Length = 382

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 37/372 (9%), Positives = 82/372 (22%), Gaps = 23/372 (6%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+           + + D  +  E + TG   +      A +        +   
Sbjct: 1   MAVTVNTNVSAMTAQRYLNKASNDLSQSMERLSTGSKINSAKDDAAGLQISNRLVAQTRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  L     I+Q M    +    G   N         +    
Sbjct: 61  LNVAIRNANDGISIAQTAEGALQESTSILQRMRDLSLQSANGANSNEDREAIQQEVGALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G          E                   +         +   A  
Sbjct: 121 DELNRIAETTSFGGRKLLNGQFGEAAFQIGADSGEAIIMGLTSVRADDSRMGGQMFRANG 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +          I                             +      V  N  ++
Sbjct: 181 MTDANWQAGAGDKISINVAGLADPISVDLIEGDDIEEVATRINGQQSGVSASVRDNGELQ 240

Query: 242 GIRDIMFVAVIGTEFLSKNLTDG-----------------------ARNVLTKKMLSTVQ 278
              D   + +           D                              ++ + T+ 
Sbjct: 241 LFSDNGAITLDSANTQLAQGKDASGAPVDLFAGSTSEAVTVQQIKVTSVGGAQEAVGTID 300

Query: 279 QGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKI 338
             L  I  QRA LG  +  +      L N    + T  S+    +      +++      
Sbjct: 301 SALKYIDSQRADLGAKQNRLGHTINNLANTAENVSTSNSRIRDTDFAKESTEMTKNQILQ 360

Query: 339 EMSYMITTKLQK 350
           + S  I  + ++
Sbjct: 361 QASTSILAQAKQ 372


>gi|312882652|ref|ZP_07742389.1| flagellar hook-associated protein FlgL [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309369613|gb|EFP97128.1| flagellar hook-associated protein FlgL [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 397

 Score =  139 bits (349), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 37/397 (9%), Positives = 109/397 (27%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I++   ++ +    +           ++ +G+              I    Q+K  
Sbjct: 1   MLNRIASFHNYQSVQNDLRRTESKVHHNQAQLASGKKLLKASDEPLATHYIQNIGQQKEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   +  L   RL   +  +S+ +  V D    ++ ++ G             +++  
Sbjct: 61  LRQYTDAIGLTRNRLEHEEVVISNAESYVDDAKRTVMEMINGALSPEDRLAKQREIKEIA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+   N+ DE           +         + ++    D   +  +  +    +   
Sbjct: 121 NNFLNLVNIQDETGNYIFAGTKPKNQPFFRNKDNDVSYAGDDYQRKMRISSSLVVPMNDP 180

Query: 182 HLEVSSMNAQQMTDF--------------IKQLEDKFSDDEYWANNWSNASDHNIKYRIK 227
              +         D+               K      +D   +   +         Y+++
Sbjct: 181 GSLLFMEIDNPFGDYKPLYNLQIESELLLEKATNSNPNDQSIYNVTFVEMPSGKFGYQLE 240

Query: 228 DTEGIDVSANVNMRGIRDIMFVAVIG---------------------------TEFLSKN 260
               +  +   +         V++                              E+   +
Sbjct: 241 KDGAVVQADTFDPSIGIQFGDVSIQVKGQITKGDQITLEPRKTYSIFESFRESMEYAEGS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++DG+      ++          + + R  +G     ++ +     + N  +    S   
Sbjct: 301 VSDGSNTAQLHQVTEEFHNAFVHLNKARTDVGSRLSTLDIQEAQHDDFNMTLAKSKSIFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A  + S     +E S     K + L++ NY+
Sbjct: 361 DLDYAEAIIEFSENSRALEASQQAFGKTKDLTLFNYI 397


>gi|332533168|ref|ZP_08409037.1| flagellar hook-associated protein FlgL [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332037450|gb|EGI73904.1| flagellar hook-associated protein FlgL [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 406

 Score =  139 bits (349), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 38/406 (9%), Positives = 105/406 (25%), Gaps = 52/406 (12%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +S + +++       E  +   +  E++ T +         + ++    +  +     
Sbjct: 1   MRLSNNLMYQNNINKILENQQGVSRAQEQVNTQKRILSTSDDPSAMSQASLYSDKIQANE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + ++++ RL+  +  L +++  ++      +    G   +      A  L+    +
Sbjct: 61  QYEKNITMLSSRLTNEETVLDNIKSSLERAHTLTIQAGNGAYSDIDREGIAEELKSIQST 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQ------------------- 164
            +   N   E             P   Y + +   + + DQ                   
Sbjct: 121 VLDLMNAKTEDGKYLFSGYQDNTPAYSYNSANQKYEYAGDQGLHKIKIAEGIDIKSSDNG 180

Query: 165 --------MLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSN 216
                           +          +V      Q   F     D    +  +    + 
Sbjct: 181 FDVFEKVQARLNVSSNDGVVSGGVLDSKVYVKEQGQFDSFHSAEYDPSGANNTYNVITTA 240

Query: 217 ASDHNIKYRIKDT-------------------------EGIDVSANVNMRGIRDIMFVAV 251
            S                                     G         +    +  ++ 
Sbjct: 241 GSPGTYTVEQGGNVLASGDLSDGLVKFNGLEISISPVATGQVDFTLGVPQKENVLNTMSN 300

Query: 252 IGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNI 311
           + T     +L   A   +    L  +  G + +   +A LG      ++        +  
Sbjct: 301 LITGLKDISLDQDAFEQVIADGLLQLDNGRNKVSLTQAGLGGRINAADKISQSNAELDIN 360

Query: 312 IDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
                +  + ++   A  +L+     ++ S     +L  LS+ +YL
Sbjct: 361 NKAARADLVELDMAEAITELTKQETALQASQATFGRLANLSLFDYL 406


>gi|209695747|ref|YP_002263677.1| flagellin [Aliivibrio salmonicida LFI1238]
 gi|208009700|emb|CAQ80001.1| flagellin subunit E [Aliivibrio salmonicida LFI1238]
          Length = 378

 Score =  139 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 32/368 (8%), Positives = 98/368 (26%), Gaps = 19/368 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  ++T+               D  +  E + +G   +      A +        +   
Sbjct: 1   MSITVNTNVSAMTAQRYLNSATSDVNQSMERLSSGSKINSAKDDAAGLQISNRLNTQTRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T++  +     I+  +    +    G   +         +    
Sbjct: 61  LDVAVRNANDGISMMQTAEGAMKETSNILSRVRDLALQSSNGSNTDADRGAIQQEVTALS 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       N   K              + + +         +S  A +
Sbjct: 121 DEMNRIAETTSFGGTRLLNGNFGTKSFQVGADSGEAVMLTLNNLRADEANMGGQSFTAKE 180

Query: 182 HLEVSSMNAQQMTDFI-------------------KQLEDKFSDDEYWANNWSNASDHNI 222
            +       +     I                     +E+  +      +  S +   + 
Sbjct: 181 GVAAGWTAGKDANMTISFTDKSGEDQSVSINAKAGDDIEEVATYINGQTDKVSASVGEDG 240

Query: 223 KYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLS 282
           K ++   +G           + +   ++       +    D      ++  ++ V   + 
Sbjct: 241 KLQVFAAKGTIEGEIAFSGALANETGMSDAVQAQKTVGNIDVTTVAGSQDAVAVVDAAMK 300

Query: 283 GIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSY 342
            +   R+ LG ++  +      L N N  + +  S+   V+      +++      + S 
Sbjct: 301 FVDSHRSELGAAQNRMGHTINNLDNINENVSSAKSQIKDVDFAKETTEMTKAQILQQASS 360

Query: 343 MITTKLQK 350
            I  + ++
Sbjct: 361 SILAQAKQ 368


>gi|323703357|ref|ZP_08115007.1| flagellar hook-associated protein 3 [Desulfotomaculum nigrificans
           DSM 574]
 gi|323531720|gb|EGB21609.1| flagellar hook-associated protein 3 [Desulfotomaculum nigrificans
           DSM 574]
          Length = 307

 Score =  139 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 44/353 (12%), Positives = 101/353 (28%), Gaps = 49/353 (13%)

Query: 5   GISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAE 64
            +S   +   M    ++  + S K  E++ TG++        + ++ ++          +
Sbjct: 3   RVSNILMANNMANYIQKNLQRSAKSQEQISTGKTIIRPSDNPSEISHLMAVNATIAGNEQ 62

Query: 65  RLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESF 124
              +       L+ S   L ++ K +QD     +    G   +         +    ++ 
Sbjct: 63  YARNIQDGLAYLNQSDTALDTVGKYLQDAKTLALQAANGTLTDADREHIKEQVDKLIDAV 122

Query: 125 VTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLE 184
              AN +  G+YLF+G  +   P       D   +  +D   Q    E            
Sbjct: 123 KDIANSSLGGKYLFAGTKNDLPPFRRVDLPDGTTEIHYDGNEQPVTREILFQAPYEVTSA 182

Query: 185 VSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIR 244
            +  N                                                 N+ G +
Sbjct: 183 GAGANG---------------------------------------------VFGNLSGTK 197

Query: 245 DIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVF 304
            I                 G       + L+ +      I+ +R  +G   +++   +  
Sbjct: 198 VIGGPFAALINLKKNLEPGGD----INQSLTELDNAHDAILTKRVGVGARTRHLEAVKEQ 253

Query: 305 LQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           L+++   + + +    G +      +++      + S M  + L   S+L YL
Sbjct: 254 LEDQEVRLKSVLVDIQGADIAKLTIEVAQNQLVHQASLMTASNLLNTSLLQYL 306


>gi|30692048|gb|AAP33170.1| FliC [Pseudomonas aeruginosa]
 gi|126165550|gb|ABN80232.1| FliC [Pseudomonas aeruginosa]
 gi|261863284|gb|ACY01188.1| flagellin [Pseudomonas aeruginosa]
          Length = 394

 Score =  139 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 35/381 (9%), Positives = 88/381 (23%), Gaps = 35/381 (9%)

Query: 6   ISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAER 65
           ++T+             +       + + TG   +      A +        + N +   
Sbjct: 5   VNTNIASLNTQRNLNNSSASLNTSLQRLSTGSRINSAKDDAAGLQIANRLTSQVNGLNVA 64

Query: 66  LHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFV 125
             + +       T++  L     I+Q M    +    G   +++     G ++   +   
Sbjct: 65  TKNANDGISLAQTAEGALQQSTNILQRMRDLSLQSANGSNSDSERTALNGEVKQLQKELD 124

Query: 126 TFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEV 185
             +N T  G       +            + +     D+M    L         G  +  
Sbjct: 125 RISNTTTFGGRKLLDGSFGVASFQVGSAANEIISVGIDEMSAESLNGTYFKADGGGAVTA 184

Query: 186 SSMNAQQMTDFIKQLEDKFS-----------------------------------DDEYW 210
           ++ +               +                                   D   +
Sbjct: 185 ATASGTVDIAIGITGGSAVNVKVDMKGNETAEQAAAKIAAAVNDANVGIGAFSDGDTISY 244

Query: 211 ANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLT 270
            +         I   +      D  +                     +    D +     
Sbjct: 245 VSKAGKDGSGAITSAVSGVVIADTGSTGVGTAAGVAPSATAFAKTNDTVAKIDISTAKGA 304

Query: 271 KKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQ 330
           +  +  + + +  I  QRA LG  +   +     L+N    +     +    +     A 
Sbjct: 305 QSAVLVIDEAIKQIDAQRADLGAVQNRFDNTINNLKNIGENVSAARGRIEDTDFAAETAN 364

Query: 331 LSTLINKIEMSYMITTKLQKL 351
           L+      +    I  +  +L
Sbjct: 365 LTKNQVLQQAGTAILAQANQL 385


>gi|254225808|ref|ZP_04919413.1| flagellar hook-associated protein FlgL [Vibrio cholerae V51]
 gi|125621714|gb|EAZ50043.1| flagellar hook-associated protein FlgL [Vibrio cholerae V51]
          Length = 397

 Score =  139 bits (348), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 36/397 (9%), Positives = 111/397 (27%), Gaps = 41/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +    +           ++ +G+              I    Q++  
Sbjct: 1   MLNRISSFHNYQAVQNDIRRQESKVFNNQAQLASGKKLLSASDNPLATHYIQNVGQQEEQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L +  LV  RL   +  +S+ ++        ++ ++ G          A +L++  
Sbjct: 61  LRQYLDAIVLVRNRLEHQEVIISNTEEFSDSAKRTVMEMINGSLSPEDRVARARVLQEMA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
            +F+  AN+ DE           +        + ++     D   +  +  + +      
Sbjct: 121 NNFINLANVQDESGNYIFAGTKPKNQPFFRDNQGNVTYAGDDYQRKMKISNSLEIPFNNP 180

Query: 182 HLEVS----------------------------SMNAQQMTDFIKQLEDKFSDDEYWANN 213
             +V                             ++N    + +     D       +   
Sbjct: 181 GSKVFMEIPNPFGSYEPNYALQEGSELLLERAVNLNPDDTSSYRVTFVDMPEGKNGYQLE 240

Query: 214 WSNASDHNIKYRIKDTEGI-------------DVSANVNMRGIRDIMFVAVIGTEFLSKN 260
            + +     ++  K                    +  +  R    +         +   +
Sbjct: 241 RNGSVVQAGEFDAKTGIQFEELNIQLKGQISKGDAIELTPRTTFSVFDTFRDAIRYAEGS 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      +++         + + R  +G     ++ +    ++    +    S   
Sbjct: 301 VSDASNTAKLHQLVEEFHTAFIHLNKTRTDIGARLSTLDIQEEQHEDFKISLAKSKSTFE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            ++   A    +     +E S     K + L++ NY+
Sbjct: 361 DLDYAEAVIDFNENSRALEASQKAFGKTKDLTLFNYI 397


>gi|325288762|ref|YP_004264943.1| flagellar hook-associated protein 3 [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324964163|gb|ADY54942.1| flagellar hook-associated protein 3 [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 304

 Score =  139 bits (348), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 42/354 (11%), Positives = 101/354 (28%), Gaps = 51/354 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++ +     + +          KL  +M TG            + + L  +   + +A
Sbjct: 1   MRMTNNMFSRNLLLNLTAAQGKLDKLQNQMSTGLRIFRPSDDPVGIENALRLKGNLSMVA 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       ++T+ + L  + K++Q     ++    G    N+    A  + +  E 
Sbjct: 61  QYQKNAGEALNYMNTTDSVLGDLTKMIQRAQELVLSANNGTNSLNERNAIAQEISEINEQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               AN     +YLF+G  + + P++G     +     FD      +             
Sbjct: 121 VKALANTKVGNKYLFAGTKTEQAPMSGGTWSGNTDSVQFDVGENIKISIMVDGQQLFTTP 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
             +               D   D        S++    +                     
Sbjct: 181 NGTYSLLSATITTPAGTSDGIFDQLLTELGGSDSISGEV--------------------- 219

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                                         L ++ Q L  +   RA LG     +   + 
Sbjct: 220 ------------------------------LDSLDQNLQNVTALRAELGARTNRLESIQS 249

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L + N  +   +S    V+   A    +  +N  + +  +  ++ + S+++++
Sbjct: 250 QLASMNYNLQANLSNVEDVDMAKAITDFTNQVNVYQSALAVGARIIQPSLVDFM 303


>gi|22002042|sp|P21184|FLICA_PSEAE RecName: Full=A-type flagellin
 gi|30692052|gb|AAP33171.1| FliC [Pseudomonas aeruginosa]
 gi|30692057|gb|AAP33172.1| FliC [Pseudomonas aeruginosa]
          Length = 394

 Score =  139 bits (348), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 35/381 (9%), Positives = 88/381 (23%), Gaps = 35/381 (9%)

Query: 6   ISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAER 65
           ++T+             +       + + TG   +      A +        + N +   
Sbjct: 5   VNTNIASLNTQRNLNNSSASLNTSLQRLSTGSRINSAKDDAAGLQIANRLTSQVNGLNVA 64

Query: 66  LHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFV 125
             + +       T++  L     I+Q M    +    G   +++     G ++   +   
Sbjct: 65  TKNANDGISLAQTAEGALQQSTNILQRMRDLSLQSANGSNSDSERTALNGEVKQLQKELD 124

Query: 126 TFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEV 185
             +N T  G       +            + +     D+M    L         G  +  
Sbjct: 125 RISNTTTFGGRKLLDGSFGVASFQVGSAANEIISVGIDEMSAESLNGTYFKADGGGAVTA 184

Query: 186 SSMNAQQMTDFIKQLEDKFS-----------------------------------DDEYW 210
           ++ +               +                                   D   +
Sbjct: 185 ATASGTVDIAIGITGGSAVNVKVDMKGNETAEQAAAKIAAAVNDANVGIGAFSDGDTISY 244

Query: 211 ANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLT 270
            +         I   +      D  +                     +    D +     
Sbjct: 245 VSKAGKDGSGAITSAVSGVVIADTGSTGVGTAAGVTPSATAFAKTNDTVAKIDISTAKGA 304

Query: 271 KKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQ 330
           +  +  + + +  I  QRA LG  +   +     L+N    +     +    +     A 
Sbjct: 305 QSAVLVIDEAIKQIDAQRADLGAVQNRFDNTINNLKNIGENVSAARGRIEDTDFAAETAN 364

Query: 331 LSTLINKIEMSYMITTKLQKL 351
           L+      +    I  +  +L
Sbjct: 365 LTKNQVLQQAGTAILAQANQL 385


>gi|209695755|ref|YP_002263685.1| flagellar hook-associated protein FlgL [Aliivibrio salmonicida
           LFI1238]
 gi|208009708|emb|CAQ80012.1| flagellar hook-associated protein type 3 FlgL [Aliivibrio
           salmonicida LFI1238]
          Length = 397

 Score =  139 bits (348), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 42/396 (10%), Positives = 117/396 (29%), Gaps = 41/396 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IS+   ++ +                ++ +G+                   Q+K  
Sbjct: 1   MLNRISSFHNYQSVQNDISRQEVKLHHNSAQLASGKKLLTAGDDPVAALYAQNLTQKKEE 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   +  L   RL   +  +++ ++   D    ++ ++ G         +A  ++   
Sbjct: 61  LRQYSDTIVLARNRLERHEVAIANAEQFADDAKRSVMEMINGSLAPEDRYAHAQDIKGIA 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           ++F+   NM DE          S+          ++     D      +  + +  +   
Sbjct: 121 DNFLNLTNMLDESGNYLFSGTKSKTQPFFRANDGTVTYAGDDYQRNLKVSGSIEVAVNDA 180

Query: 182 HLEVSSMNAQQMTDF--------------IKQLEDKFSDDEYWANNWSNASDHNIKYRIK 227
             ++ +       D+               K     ++D   +   +S A +    Y++ 
Sbjct: 181 GNKLFTEIKNPFGDYDPQYALQEGSELLLSKAKNMDYTDTSTYQVAFSAADNGQYNYQLS 240

Query: 228 DTEGIDVSANVNMR---------------------------GIRDIMFVAVIGTEFLSKN 260
               +  SA  N                                 I        E   K+
Sbjct: 241 QDGSVVKSAQFNPAEGIKYEGVDIQVRGQLKAGDAITLEPKKTISIFDAFKKAQELSMKD 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
           ++D +      ++          + + RA +G  +  ++++    Q+ +  I   +S   
Sbjct: 301 VSDASSTAELHQVTEEFHAAFIHLSQARAEVGTRQNTLDQQESQHQDFDLTISKSLSSIE 360

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNY 356
            ++   A  + +     ++ S     K++ +++ NY
Sbjct: 361 DLDYAQAVIEFNENTRALQASQQAFGKVKDITLFNY 396


>gi|171059405|ref|YP_001791754.1| flagellar hook-associated protein 3 [Leptothrix cholodnii SP-6]
 gi|170776850|gb|ACB34989.1| flagellar hook-associated protein 3 [Leptothrix cholodnii SP-6]
          Length = 405

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 47/403 (11%), Positives = 106/403 (26%), Gaps = 49/403 (12%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +ST+S +E      +   ++      ++ +G+                    E+    
Sbjct: 1   MRVSTASTYESSINTLQRRQQELSLAQGQLTSGKKIGKPSDDPTGAARAERALIEQTRGE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
             L         ++ S+  L     +VQ     L+    G     +    A  L +    
Sbjct: 61  TTLRVIDASRNAMTLSEGALGDAVDLVQTAREALMAAGNGSYTAGERKAVALQLSELRNQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQ-------------MLQGFL 170
            +  AN  D       G    +               +  Q               Q   
Sbjct: 121 LLNVANQQDGNGGYLFGGQGVQTAPFLDAVGGVDYASTGGQINGATDERLPLSVDGQQIW 180

Query: 171 EENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTE 230
            +             ++ +     +  +  +      + +  ++S  +   ++Y I D++
Sbjct: 181 LQARSGNGVFTTAADAANSGSGWVNAGQVTDPAAYTGKSYEVSFSAGAGGALEYSITDSD 240

Query: 231 GIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLS--------------- 275
           G  +++N      + I  V  +           G          S               
Sbjct: 241 GASIASNQPYSAGKAITDVPGVAFTISGTPSATGTPPDRFTVAPSQPELSVFDALDRALA 300

Query: 276 ---------------------TVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDT 314
                                 + Q LS     RA++G +   ++        +     T
Sbjct: 301 VLNDPNANPGQVMQGVNAGLRDMDQALSSFSSARAMVGETLNRLDGVGDRTDARILSSKT 360

Query: 315 YISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             S +  ++   A +  S      + +     ++QKLS+ NY+
Sbjct: 361 TRSNAEDLDMVEAISDFSNKQTSYQAALQSYAQVQKLSLFNYI 403


>gi|163758034|ref|ZP_02165122.1| flagellar hook-associated protein L [Hoeflea phototrophica DFL-43]
 gi|162284323|gb|EDQ34606.1| flagellar hook-associated protein L [Hoeflea phototrophica DFL-43]
          Length = 350

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 110/357 (30%), Positives = 186/357 (52%), Gaps = 7/357 (1%)

Query: 1   MKTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKN 60
           MKT+ IS  +I   M +       +  KL EE+VTG+ +D GL LGA+ ++ +   ++  
Sbjct: 1   MKTSFISNLAIQNSMRMTISRGQVEIQKLQEEVVTGRFADIGLSLGAKTSTSVSHHRDVQ 60

Query: 61  HIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDS 120
            +     SN+LVT+RLSTSQ  L++M    Q M+   ++   G  D  K  +    +  S
Sbjct: 61  RLETIQDSNALVTQRLSTSQLSLAAMSDAAQQMLEAFIVA-NGTDDEPKLNVMRRDVEAS 119

Query: 121 YESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
            E F +  N +  G+YLFSGIN+  KP++ Y    S AK +FD +  G            
Sbjct: 120 LELFTSSINTSVNGEYLFSGINTDVKPVDDYLEPGSGAKAAFDTLFLGHFG------FTQ 173

Query: 181 QHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNM 240
                + +   QM +FI  + +       W  NWS+ASD NI  RI+  E +D SAN N 
Sbjct: 174 DDPAAAGITTAQMDNFIDNVLEPEFMGPNWNTNWSSASDTNISSRIRTNEVVDSSANANG 233

Query: 241 RGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINE 300
            G+R     A+IG E +   ++   R  + +K +    Q ++GI  +R+ LG+SE  + +
Sbjct: 234 TGMRSFALAAIIGIELMDSPISSEVRASVNEKAIEYAGQAVTGIDNERSNLGVSENRVAK 293

Query: 301 ERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
               ++ +  I+  +++   GV+ + A  ++ +L+ ++E SY +T ++Q+L+++NYL
Sbjct: 294 ANEAIEAQVRIMKLHLNDIEGVDGYEASTRMQSLLTQVETSYTLTARIQQLNLMNYL 350


>gi|251799724|ref|YP_003014455.1| flagellar hook-associated protein 3 [Paenibacillus sp. JDR-2]
 gi|247547350|gb|ACT04369.1| flagellar hook-associated protein 3 [Paenibacillus sp. JDR-2]
          Length = 319

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 40/353 (11%), Positives = 94/353 (26%), Gaps = 38/353 (10%)

Query: 5   GISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAE 64
            ++   +  +M            KL  ++ TG++ +        +T  L +  E     +
Sbjct: 4   RVTQRMMSSQMLGNITNNLNSMNKLQNQLATGKAINKPSDDPIGITFALRYRGEIASNDQ 63

Query: 65  RLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESF 124
              ++      L      +     IVQ     +V    G  +          +   Y   
Sbjct: 64  YTDNSDAALSSLEYMDTTIGQATDIVQRFRELIVKGSNGTLEQTSMTAIQTEVSQLYNQM 123

Query: 125 VTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLE 184
           V   N    G+ +F+G  +  KP                                     
Sbjct: 124 VEIGNSQFNGKQMFNGEQTGVKPY------------------------------------ 147

Query: 185 VSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIR 244
             S                        +  S   + +    +      +      +    
Sbjct: 148 --STLGLDQQSDPSADPPILKAFSNQTDTGSIQYELSPGMTMDVNMTGNDVFGAPVADES 205

Query: 245 DIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVF 304
           D     +      + ++           +L  +   ++ ++  RA +G     +   +  
Sbjct: 206 DTTSDNLFQLMHRAYDMLGSGDQEGLTGLLGQIDTRMNTMLTARAQVGARVNRVEIVQGR 265

Query: 305 LQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           L + +  +     K   V+   A   ++TL N  + S     K+ + S++++L
Sbjct: 266 LSDVDINLQQMQQKVEDVDMAEAITNITTLENVYQASLSAGAKIIQPSLVDFL 318


>gi|294992411|gb|ADF57343.1| flagellin protein FlaA [Roseburia inulinivorans DSM 16841]
          Length = 392

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 31/379 (8%), Positives = 89/379 (23%), Gaps = 35/379 (9%)

Query: 9   SSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHS 68
           +      N +         K  E++ +G   +      A +T   +  ++   + +   +
Sbjct: 6   NLQAMNANRMLNVTTGQQAKSTEKLSSGYRINRAADDAAGLTISEKMRKQIKGLDQASTN 65

Query: 69  NSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFA 128
                  + T++  L+ +  ++Q M    V    G    +        +          +
Sbjct: 66  AQDGVSAVQTAEGALTVVHSMLQRMNELAVQSANGTNAQSDRDAIQAEITQLTTEIDRVS 125

Query: 129 NMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEV--- 185
             T   +      +S       ++    +     D  L+G      K  +A         
Sbjct: 126 ETTKFNEIYLLKGDSKTTKDVTFYKSGYVTNVDMDLFLEGSTTAIDKKDIADAVASGKKL 185

Query: 186 -------------------------------SSMNAQQMTDFIKQLEDKFSDDEYWANNW 214
                                           +   +   +  K+       ++      
Sbjct: 186 YTEAAKAAGQKQADDKLAKKGTDYAYLTKIYDNTGKELSAEEAKKATGDLFANKEHTVKV 245

Query: 215 SNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFL-SKNLTDGARNVLTKKM 273
              +D+     +      ++    +      I       +           +        
Sbjct: 246 KTKTDYLTTNTVNGELSFNLHVGADSEADNKIGVSIETMSSLGIGVKDLKVSTEDDATVA 305

Query: 274 LSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLST 333
           + T+   +  +  QR+ LG  +  +      L N         S+    +        S 
Sbjct: 306 IDTIAAAIQKVSSQRSALGAVQNRLEHTIDNLDNVVENTTAAESRIRDTDMAEEMVNYSK 365

Query: 334 LINKIEMSYMITTKLQKLS 352
                +    +  +  + +
Sbjct: 366 NNILAQAGQSMLAQANQST 384


>gi|146293683|ref|YP_001184107.1| flagellar hook-associated protein FlgL [Shewanella putrefaciens
           CN-32]
 gi|145565373|gb|ABP76308.1| flagellar hook-associated protein 3 [Shewanella putrefaciens CN-32]
          Length = 403

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 47/405 (11%), Positives = 131/405 (32%), Gaps = 53/405 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +S++ IF +      +    + K+ E++ +G+  +           I    Q    + 
Sbjct: 1   MRLSSAQIFNQSITSVLQKQTATSKILEQLSSGKKVNTAGDDPVAALGIDNLNQRNALVD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +    T RL+ +++ L S + +   +   ++  + G   +++  + A  ++ S E 
Sbjct: 61  QFMKNIDYATNRLAVTESKLGSAENLASSIREQVMRAVNGTLADSERQMIADEMKGSLEE 120

Query: 124 FVTFANMTDEGQYL-FSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
            ++ AN  DE     FSG ++ ++P     +       S D  +Q  L ++  +L     
Sbjct: 121 LLSIANSKDESGNYMFSGYSTDKEPFAFDNSTPPKIVYSGDSGIQNSLVQSGVALGTNVP 180

Query: 183 LEVS--------------------------------------------------SMNAQQ 192
            + +                                                       Q
Sbjct: 181 GDSAFMKAPNGLGDYSVNYLASQQGEFSVKTAKIADASTYLADTYTFNFIDNGLGGTNLQ 240

Query: 193 MTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVI 252
           + D         ++ +       N  +  +  +    +   +     +     I     +
Sbjct: 241 VLDSANNPVANIANFDATTPVSFNGIEVKVSGKPSAGDSFTMEPQAEVSIFDTISSAIAL 300

Query: 253 GTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNII 312
             +  S             ++L+ +  G++ I   R+V G + K +   +     +  + 
Sbjct: 301 IEDPNS--ANTPQGRAQLAQILNNIDSGVNQISSARSVAGNNLKAVESYKETHTEEKVVN 358

Query: 313 DTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            + +S+   ++  +A  +       +     + +K+  +S+ +Y+
Sbjct: 359 TSALSRLEDLDYASAITEFEKQQLALNAVSSVFSKVGSVSLFDYI 403


>gi|33596120|ref|NP_883763.1| flagellin [Bordetella parapertussis 12822]
 gi|33573123|emb|CAE36767.1| flagellin [Bordetella parapertussis]
          Length = 392

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 33/382 (8%), Positives = 86/382 (22%), Gaps = 33/382 (8%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+ +         +         E + +G   +      A       +      
Sbjct: 1   MAAVINTNYLSLVAQNNLNKSQSALGSAIERLSSGLRINSAKDDAAGQAIANRFTANVKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q +    V    G    +        +    
Sbjct: 61  LTQAARNANDGISIAQTTEGALNEINNNLQRIRELTVQASNGTNSASDIDSIQQEVNQRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPL------------------NGYFTKDSLAKKSFD 163
           E     A  TD         N+++  L                  N  +           
Sbjct: 121 EEINRIAEQTDFNGIKVLKSNATDMTLSIQVGAKDNETIDIKIDRNSNWNLYDAVGTVPG 180

Query: 164 QMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFI---------------KQLEDKFSDDE 208
             + G     +           +++ +     F                      + D  
Sbjct: 181 GTVNGEARTVNALGFDVLSAVTTTIASSDTVTFDAAVAAAEQAAGAAVGDGSVVSYGDTA 240

Query: 209 YWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNV 268
                    +   +       +    +A  +  G                    +   + 
Sbjct: 241 NPQYAVVVDNAGTMTSYALTFDKDGKAALGDQLGAVASQAAEAAVGTNDVAAGANVTVSG 300

Query: 269 LTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAH 328
                LS +   +  + EQR+ LG  +         L N    +    S+    +  T  
Sbjct: 301 GAADALSKLDDAMKAVDEQRSSLGAIQNRFESTVANLNNTITNLSAARSRIEDSDYATEV 360

Query: 329 AQLSTLINKIEMSYMITTKLQK 350
           + ++      +    +  +  +
Sbjct: 361 SNMTKNQILQQAGTSVLAQANQ 382


>gi|332669183|ref|YP_004452191.1| flagellin domain-containing protein [Cellulomonas fimi ATCC 484]
 gi|332338221|gb|AEE44804.1| flagellin domain protein [Cellulomonas fimi ATCC 484]
          Length = 391

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 29/378 (7%), Positives = 77/378 (20%), Gaps = 32/378 (8%)

Query: 5   GISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAE 64
            I+ +               D  K  E++ +G   +      A +        +   +  
Sbjct: 4   SINQNIAAVNSYRNLSNTQNDLSKSLEKLSSGFRINRAADDAAGLAISEGLRSQVGGLKV 63

Query: 65  RLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESF 124
              +       + T++  L+    I+Q +    V       ++              +  
Sbjct: 64  AARNAQDGISVVQTAEGALTETHAILQRLRDLSVQGANDSNNDKARANIKTEADSLVKEL 123

Query: 125 VTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLE 184
               N T+         ++           D  ++ S D           +   A     
Sbjct: 124 GRIGNSTNFNGTKLLDGSAGTLHFQVGADGDGNSRISVDLSGANVTSIADQLGAATTGST 183

Query: 185 VSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNAS-------------------------- 218
           +  +    +T        +           + AS                          
Sbjct: 184 MDVLTPTNVTGAFTFTTRETVGGNNVDTTITTASVGAAGSIKTVDDLAAALNKDTNFSKN 243

Query: 219 ------DHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKK 272
                   N               N            A            D +     + 
Sbjct: 244 LAASVNSDNQLVVTAKDGAAVFGGNTAGTHASAGTGAAASVALVPGTTGLDFSTADAAQT 303

Query: 273 MLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLS 332
            +  +   +  +   RA LG  +  +      +      +    S+    +  +     +
Sbjct: 304 SIGRIDAQIEAVSTARAGLGAMQNRLEHTIKNINVSVENLSASESRIRDTDMASEMVSFT 363

Query: 333 TLINKIEMSYMITTKLQK 350
                 +    +  +  +
Sbjct: 364 RAQILSQAGTAMLAQANQ 381


>gi|219670197|ref|YP_002460632.1| flagellin domain protein [Desulfitobacterium hafniense DCB-2]
 gi|219540457|gb|ACL22196.1| flagellin domain protein [Desulfitobacterium hafniense DCB-2]
          Length = 385

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 36/362 (9%), Positives = 79/362 (21%), Gaps = 28/362 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +             N ++ K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MIINHNMSAINTYRQLTTNNSNNAKSLEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  L+    I+Q M    V                  +    + 
Sbjct: 61  QAQRNAQDSISLIQTAEGALNETHSILQRMRELAVQASNDTNSTTDRDEIQKEIDQLTDE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               AN T+         +            +       +            S       
Sbjct: 121 IDRIANTTEFNTQKLLDGSKKGLVKAENAKAEIELNTKANITGVSVTTSAGTSATIIITR 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR-- 241
              S       DF        S         S A    I     D   + V  ++ +   
Sbjct: 181 TNDSSTGFAAGDFSIGDPSSTSASLTSGTTISMAGGATITLSGDDLSKLAVGESITISIK 240

Query: 242 --------------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLS 275
                                        + M    IG         D +        + 
Sbjct: 241 AKVDVSNNVEDAFSMQIGANSGQNILVGINNMKAEKIGVRGTDGKALDVSDYKNATAAIK 300

Query: 276 TVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLI 335
           T+   +  +  +R+ LG  +  +      L   +  +    S+   V+            
Sbjct: 301 TINNAIETVSAERSKLGAVQNRLEHTINNLGTSSENLTAAESRIRDVDMAKEMMNFQKNN 360

Query: 336 NK 337
             
Sbjct: 361 IL 362


>gi|168335505|ref|ZP_02693586.1| flagellin domain protein [Epulopiscium sp. 'N.t. morphotype B']
          Length = 411

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 32/401 (7%), Positives = 87/401 (21%), Gaps = 54/401 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+ +             D   + E++ +G   +      A +    +   +   + 
Sbjct: 1   MIINTNLMAINAQRNLGVNQGDQGGIMEKLSSGLRINRAGDDAAGLAISEKMRNQIRGLQ 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  LS   ++++ M    +  +     +          +     
Sbjct: 61  QASRNGEDGISLIQTAEGALSETHEMLKRMREMAIQSMNDTYTDEDRQKLNIEAQQLITE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A  T+  +      + + K L     K      +            +K   A    
Sbjct: 121 IDGLAVKTEFNEQKLLTGDPTGKGLASVAAKRQSLTTALKSFYTKIGSAEAKLGSAYAVE 180

Query: 184 E---------------------------------------------------VSSMNAQQ 192
                                                                S  + + 
Sbjct: 181 ASTKMEQALQSVIDLEQKISALEIKAAGEVPPEGQHVLKSVSDLRISLAQREASIASMEA 240

Query: 193 MTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVI 252
           +   +K+                  S         + +         +           I
Sbjct: 241 VAANLKESAATLRASAVTIEAGLVTSCAKKLQATMNEKVGPNEFTFQVGANNGQTITLGI 300

Query: 253 GTEFLSKNLTDGARNVLTKKMLST---VQQGLSGIIEQRAVLGISEKNINEERVFLQNKN 309
                +       +   T+        +   +  +  QRA LG  +  +      L N  
Sbjct: 301 KAMDSTALGLQATKIDSTESAGIALITIDAAVEIVSRQRAELGAVQNRLEHTVKNLDNTA 360

Query: 310 NIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
             +    S+    +       L+      + S  +  +  +
Sbjct: 361 XNLQAAESQIRDADMAXEMVNLTRTNILSQASQSMLAQANQ 401


>gi|42522142|ref|NP_967522.1| FgL, flagellar protein [Bdellovibrio bacteriovorus HD100]
 gi|39574673|emb|CAE78515.1| FgL, flagellar protein [Bdellovibrio bacteriovorus HD100]
          Length = 361

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 48/360 (13%), Positives = 111/360 (30%), Gaps = 6/360 (1%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+    F ++N    +   D   L  +  T +  +           +L    E+    
Sbjct: 1   MRIADKMSFNQVNQNLTKNRSDMADLQNQAATQKRINKPSDDPLASARVLTARTEERGNT 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEG-KTDNNKFPINAGMLRDSYE 122
           + + + +     L  S   LS + +I+       V        +     + A  +   Y 
Sbjct: 61  QFIKNINNARSFLEFSDQSLSELTEILVRAKELAVSQSNDASGNEESRMVTASEIEQIYN 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPL-----NGYFTKDSLAKKSFDQMLQGFLEENSKSL 177
             +   N     +Y+F G  +   P            D   +   D  +   L  +   L
Sbjct: 121 QSIQIGNRKLGERYIFGGQKTQTTPFNQSGEYFGNDSDMKIQTQKDSFVAMNLPGSKVFL 180

Query: 178 LAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSAN 237
             G   +       +    ++ L+D  + +            + +  R   +E    S  
Sbjct: 181 GRGLGGDGIVRAQYETPTDVQSLKDFQNQEVERQQVNEEVDSNFLTTRGPASESGRQSRA 240

Query: 238 VNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKN 297
                +   + V +  T    +           ++ L T+ Q +S ++  R+ +G     
Sbjct: 241 DRQDPVTGSVGVNLFSTLKNLEISLKTNDKAGVQESLDTLDQAISQVVLARSEVGSRIMA 300

Query: 298 INEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +N     LQ          S+    +     + ++   + ++ +   + KL + S+L++L
Sbjct: 301 VNNTNDSLQKAVVDNKVTASQLEDADAFQVISDINKTDSTLKATLETSGKLIQPSLLDFL 360


>gi|168335506|ref|ZP_02693587.1| flagellin domain protein [Epulopiscium sp. 'N.t. morphotype B']
          Length = 412

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 33/402 (8%), Positives = 95/402 (23%), Gaps = 55/402 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+ +             D   + E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINTNLMAINAQRNLGINQGDQGGIMEKLSSGLRINRAGDDAAGLAISEKMRNQIKGLQ 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   ++      +  ++  LS    +++ M    +  +     +         L+     
Sbjct: 61  QSSENSQDGISLIQVAEGALSETHDMLKRMREMSIQSMNDTYTSEDRKKLDIELKQLITE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEK--------------PLNGYFTKDSLAKKSFDQMLQGF 169
               A+ T+  +      + S K               +  Y+ K    +          
Sbjct: 121 IDGLADKTEFNEQSLLLGDPSGKGRDSVAIRRQSLTIIVGSYYGKMGAYQSLMGAAYSIE 180

Query: 170 LEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSD----------------------- 206
              +  +           ++A ++    +  + K                          
Sbjct: 181 XGSSMLTAQTRLIKLEQDISALEIKAAGESDKAKAQAVLVSVSQKQISLETTKASIAALE 240

Query: 207 ------------------DEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMF 248
                             D    +    A+                            + 
Sbjct: 241 ASSAGKKASAAVKLQSAIDWEATSVVRAANALQATMNQAVGPNEFTFQVGANNDQIISLN 300

Query: 249 VAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNK 308
           +  +    L    T           L+++   +  +  QRA LG  +  +      L N 
Sbjct: 301 IKAMNAIALGLTTTKIDTPESAHIALNSIDAAVEIVSRQRAELGAVQNRLEHTVKNLDNT 360

Query: 309 NNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              + +  S+    +       L+ +    + S  +  +  +
Sbjct: 361 AENLQSAESQIRDADMAEEMVNLTRVNILTQASQSMLAQANQ 402


>gi|209695935|ref|YP_002263865.1| flagellin [Aliivibrio salmonicida LFI1238]
 gi|208009888|emb|CAQ80201.1| flagellin subunit F [Aliivibrio salmonicida LFI1238]
          Length = 385

 Score =  138 bits (346), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/367 (10%), Positives = 100/367 (27%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  ++T+                     E++ +G   +      + +        +   
Sbjct: 9   MSISVNTNISAMTAQRYMNNATAAQADSMEKLSSGLKINSAADDASGLQISNRMTAQTRG 68

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  +     ++Q +    +    G   +              
Sbjct: 69  LNVAVRNANDGMSIAQTAEGAMKETTNVLQRLRDLSLQSSNGSNTDADREAMQEEASSLT 128

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T              K              + + M         KS  A +
Sbjct: 129 DELNRIAETTSFAGTRLINGEFGTKSFQIGADSGEAVAMTLNSMRADEATMGGKSYFAEE 188

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +++    ++ + F  Q  DK  +++       +  D        + +  ++SA+V  +
Sbjct: 189 GRDINWTVGKENSQFNVQYNDKNGNEQKINIAAKSGDDIEELATYINGQTNELSASVTEK 248

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G+  +       +  L+ + +                  +       ++ +  +   L  
Sbjct: 249 GVLQVFMSGETISSPLTFSGSLANELKMGGESDDTVASMNLTTVGGAQRSIDVIDAALQY 308

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +         L N N  I    S+   V+       L+      + S  
Sbjct: 309 VDGNRASLGAFQNRFESAVNNLTNINENISDSNSQIKDVDFAKETTNLTKNQILTQSSSS 368

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 369 ILAQAKQ 375


>gi|308050365|ref|YP_003913931.1| flagellar hook-associated protein 3 [Ferrimonas balearica DSM 9799]
 gi|307632555|gb|ADN76857.1| flagellar hook-associated protein 3 [Ferrimonas balearica DSM 9799]
          Length = 404

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/404 (10%), Positives = 111/404 (27%), Gaps = 50/404 (12%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+  +         L  D+    + + +G+              +   +Q+   I 
Sbjct: 1   MRIATNQFYNLNTTNLLRLQSDTNGTLQHLSSGKKIHTAADDPVASIVLENLKQQSQQIN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + +L   RLS  +  L   + ++ +    +V   +G   +      A  LR++ ++
Sbjct: 61  QYKANINLANNRLSQQEGRLGEYENLIMNSRDLIVQGNDGALSDENKGALAQDLRETRDA 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +  AN  DE      G   +            ++ +      +  + +     +     
Sbjct: 121 ILALANNQDESGNFLFGGYQTGTKPFIEDPNGVVSYQGDSGRREAIVADGISIPVNEAGD 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDD-----------------EYWANNWSNASDHNIKYRI 226
            +         D+     +                        ++  + +    N+  ++
Sbjct: 181 RIFMSVPNASGDYRADYANATMTGEWFVENTEVVNPGAHTAGDFSIQFVDDGAGNVNVQV 240

Query: 227 KDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIE 286
            D      +   +      +          LS +   G    L+ +    +   L  +I+
Sbjct: 241 VDDATPPNTLLPSQPFDATVPLSFNGMEVQLSGHPEIGDAVTLSGQSEVDIFSTLKDVID 300

Query: 287 Q---------------------------------RAVLGISEKNINEERVFLQNKNNIID 313
                                             RA  G   K+++  +   +N   +  
Sbjct: 301 MLETPAGLVGNVAQAQYAQALADMGETMTHASVIRAETGNYLKSLDTYQAQHENLELVAA 360

Query: 314 TYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +  S    ++   A +        +        K+  LS+ NY+
Sbjct: 361 SAQSTIEDLDYAKAISDFEKQSMAMTAVSQTFGKVSGLSLFNYI 404


>gi|92114108|ref|YP_574036.1| flagellin-like protein [Chromohalobacter salexigens DSM 3043]
 gi|91797198|gb|ABE59337.1| flagellin-like protein [Chromohalobacter salexigens DSM 3043]
          Length = 356

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 27/349 (7%), Positives = 82/349 (23%), Gaps = 2/349 (0%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              I+T+           +         E + +G   +      A          +   +
Sbjct: 1   MAVINTNITAMIGQQNLSQSQSALSTSMERLSSGLRINSAADDAAGQAIANRMSSQITGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
           ++   + +       T++  L+ +   +Q +    V    G             +     
Sbjct: 61  SQAQRNANDGISVAQTTEGALNQVNDNLQRVRELTVQAQNGTNSQEDLDSIQDEINQRLG 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                +  T          +       G     ++     +   +     N       + 
Sbjct: 121 EIDRISEETSFNGVDVLASDQEISIQVGSEDGQTITMNLQEVNAETLGLSNFDVSDRAES 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
           +     ++                    ++    +   N        +  +         
Sbjct: 181 VSAGGYDSGSTVAADDATFSFTDSTGAVSDFDGYSVVENDSGTFVRDDQGNYYDATMSVA 240

Query: 243 IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEER 302
             D   V V      +    + + N L+      +   +S +  QR+ LG  +   +   
Sbjct: 241 SADTSSVGVTFDSDSALTADELSTNGLSPLA--DIDAAISNVDSQRSELGAMQNRFDSAI 298

Query: 303 VFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKL 351
             L      + +  S+    +     + ++      +    +  +  +L
Sbjct: 299 TNLSTTETNLSSARSRIEDADYADEVSNMTRNQILQQAGTSVLAQANQL 347


>gi|258621095|ref|ZP_05716129.1| Flagellin B [Vibrio mimicus VM573]
 gi|258586483|gb|EEW11198.1| Flagellin B [Vibrio mimicus VM573]
          Length = 376

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 94/367 (25%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNGAADGMQKSMERLSSGYKINSARDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G   +++       +    
Sbjct: 61  LDMAVKNANDGISIAQTAEGAMNETTNILQRMRDLALQSSNGSNSSSERKAIQEEVSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +   K              S   M         KS  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGSFGNKSFQIGADSGEAVMLSMGNMRSDTQAMGGKSYRAQD 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                          +    DK  + +    N     D        + +  DV A+V   
Sbjct: 181 GKAADWRVGAATDLTL-NYTDKQGNAQAVTINAKQGDDLEELATYINGQTEDVKASVGEG 239

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +   +      ++                      D +    +++ +S +   L  
Sbjct: 240 GKLQLFASSQRVDGDVTIGGGLGGEIGFEAGRDVTVADVDVSTVAGSQEAVSVLDGALKA 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +         L N N  ++   S+    +       ++      + S  
Sbjct: 300 VDSQRASLGAFQNRFGHAISNLDNVNENVNASRSRIRDTDYARETTAMTKAQILQQASTS 359

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 360 VLAQAKQ 366


>gi|221635614|ref|YP_002523490.1| flagellin [Thermomicrobium roseum DSM 5159]
 gi|221157667|gb|ACM06785.1| flagellin [Thermomicrobium roseum DSM 5159]
          Length = 402

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/393 (9%), Positives = 96/393 (24%), Gaps = 45/393 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I  +                  K  E++ +G   +      A ++   +   +   + 
Sbjct: 1   MRIYNNVNAVNAQRNLSITGFALAKSIEKLSSGLRINRAADDAAGLSISEKLRAQIRGVM 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +       + T++  L+ +  ++Q M    V                  L +    
Sbjct: 61  QAMRNAQDGVSMIQTAEGALNEVHSMLQRMRELAVQAANDTLTTEDRRAIYQELDNLRVE 120

Query: 124 FVTFANMTDEGQYLFSGI------------------------------------------ 141
                  T                                                    
Sbjct: 121 VDAIVARTSFNGKNLLDGTLVTTVAAGSEIKVGTTLTGGGETAHVFALDVSGAVPGRTYT 180

Query: 142 ---NSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIK 198
              NS+   L    + D++++      +     +       G  L V+S       +   
Sbjct: 181 FSYNSTTDTLTLTRSGDNVSQSITISNIAAGGSQVLNFSALGIKLTVTSTGGITADNLGA 240

Query: 199 QLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLS 258
            L    +D     N   +A+                   V+          + I     S
Sbjct: 241 ALTAGATDTITTHNGGGSANMQVGPNSTHSFNVNFSDVRVSGTASAMTTLDSAITAFSTS 300

Query: 259 KNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISK 318
            +  + A+    + +++ +   +S + E R+ LG  +  +      L  ++  +    S+
Sbjct: 301 LSGLNSAQVTAAQNLINALDGAISYVNEVRSYLGAVQNRLEHAIANLGVQHENLTASESR 360

Query: 319 SIGVEQHTAHAQLSTLINKIEMSYMITTKLQKL 351
              V+        +      +    + ++   +
Sbjct: 361 IRDVDMAKEMVIFTRNQILQQAGVAVLSQANAM 393


>gi|196039142|ref|ZP_03106449.1| flagellin protein [Bacillus cereus NVH0597-99]
 gi|196030287|gb|EDX68887.1| flagellin protein [Bacillus cereus NVH0597-99]
          Length = 367

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 27/357 (7%), Positives = 97/357 (27%), Gaps = 10/357 (2%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +         ++ + 
Sbjct: 1   MRINTNINSLRTQEYMRQNQSKMSNSMDRLSSGKRINNASDDAAGLAIATRMRARESGLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       + T+ + ++S+  I+  M         G   ++          +  + 
Sbjct: 61  VAANNTQDGMSLIRTADSAMNSVSNILLRMRDIANQSANGTNTDSNKSALQKEFDELQKQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A+ T          +S  K      +          + +        K  +     
Sbjct: 121 ITYIADNTQFNDKNLLKEDSEVKIQTLDSSSSEQQIGINLKAVTLEKLGIDKISIGAAGA 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
              +  A ++        +         +  ++ +     +                  +
Sbjct: 181 AGGAAAAAKIEQKDIDAVNNGIGKLTKDSKDADITAIKEAFDKIKVGMDPAQVTAIDDAL 240

Query: 244 RDIMFVAVIGTEFLS----------KNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGI 293
           +     +                     TD A      + +  + + L+ + + RA LG 
Sbjct: 241 KAFKEGSATDDIVTDIKDALKGATLPKATDAAEKDNALEAVKAIDKALTTVADNRATLGA 300

Query: 294 SEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
           +   ++     L++++  + +  S+    +     ++++      E    + ++  +
Sbjct: 301 TLNRLDFNVNNLKSQSASMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQ 357


>gi|262276404|ref|ZP_06054213.1| flagellin protein FlaD [Grimontia hollisae CIP 101886]
 gi|262220212|gb|EEY71528.1| flagellin protein FlaD [Grimontia hollisae CIP 101886]
          Length = 379

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/369 (10%), Positives = 86/369 (23%), Gaps = 20/369 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAITVNTNVPAMTAQRYLNSSTDSLNASMERLSSGFRINSAKDDAAGLQISNRLISQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  +     I+Q M    +    G   + +       +    
Sbjct: 61  LDVAVRNANDGISMSQTAEGAMEESTNILQRMRDLALQSANGANGSQERGAIQEEIVALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K               F  +          +  A  
Sbjct: 121 DELNRIAETTSFGGAKLLNGTFGTKAFQIGADAGEAVFMEFKNIRADEALMGGATYKATV 180

Query: 182 HLEVS--------------SMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIK 227
              V               ++     T     +  K  DD      + N           
Sbjct: 181 AASVDMAAWTATAGATLSMAITNADGTTATINVSAKAGDDVEEVATYINGQADGQVSASV 240

Query: 228 DTEGIDVSANVNMR------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGL 281
             +G       +         +   + +A       +    D +     ++ +  V   +
Sbjct: 241 TEDGELQVVAASGSDVAFTGALATSLGIAGAAKVDETVQDVDVSTVGGAQRAVGLVDNAM 300

Query: 282 SGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMS 341
             I   RA LG  +  ++     L N N  +    S+   V+      Q +      +  
Sbjct: 301 QYIDSHRAELGAKQNRLSHAIANLDNVNENVSASNSRIRDVDFAKETTQFTKSQILQQSG 360

Query: 342 YMITTKLQK 350
             I  + ++
Sbjct: 361 TSILAQAKQ 369


>gi|258626168|ref|ZP_05721016.1| Flagellin B [Vibrio mimicus VM603]
 gi|262170871|ref|ZP_06038549.1| flagellin B [Vibrio mimicus MB-451]
 gi|258581523|gb|EEW06424.1| Flagellin B [Vibrio mimicus VM603]
 gi|261891947|gb|EEY37933.1| flagellin B [Vibrio mimicus MB-451]
          Length = 376

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 94/367 (25%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNGAADGMQKSMERLSSGYKINSARDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G   +++       +    
Sbjct: 61  LDMAVKNANDGISIAQTAEGAMNETTNILQRMRDLALQSSNGSNSSSERKAIQEEVSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +   K              S   M         KS  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGSFGNKSFQIGADSGEAVMLSMGNMRSDTQAMGGKSYRAQD 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                          +    DK  + +    N     D        + +  DV A+V   
Sbjct: 181 GKTADWRVGAATDLTL-NYTDKQGNAQAVTINAKQGDDLEELATYINGQTEDVKASVGEG 239

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +   +      ++                      D +    +++ +S +   L  
Sbjct: 240 GKLQLFASSQRVDGDVTIGGGLGGEIGFEAGRDVTVADVDVSTVAGSQEAVSVLDGALKA 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +         L N N  ++   S+    +       ++      + S  
Sbjct: 300 VDSQRASLGAFQNRFGHAISNLDNVNENVNASRSRIRDTDYARETTAMTKAQILQQASTS 359

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 360 VLAQAKQ 366


>gi|3098297|gb|AAC63946.1| flagellin [Pseudomonas aeruginosa]
          Length = 390

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/381 (9%), Positives = 88/381 (23%), Gaps = 35/381 (9%)

Query: 6   ISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAER 65
           ++T+             +       + + TG   +      A +        + N +   
Sbjct: 5   VNTNIASLNTQRNLNNSSASLNTSLQRLSTGSRINSAKDDAAGLQIANRLTSQVNGLNVA 64

Query: 66  LHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFV 125
             + +       T++  L     I+Q M    +    G   +++     G ++   +   
Sbjct: 65  TKNANDGISLAQTAEGALQQSTNILQRMRDLSLQSANGSNSDSERTALNGEVKQLQKELD 124

Query: 126 TFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEV 185
             +N T  G       +            + +     D+M    L         G  +  
Sbjct: 125 RISNTTTFGGRKLLDGSFGVASFQVGSAANEIISVGIDEMSAESLNGTYFKADGGGAVTA 184

Query: 186 SSMNAQQMTDFIKQLEDKFS-----------------------------------DDEYW 210
           ++ +               +                                   D   +
Sbjct: 185 ATASGTVDIAIGITGGSAVNVKVDMKGNETAEQAAAKIAAAVNDANVGIGAFSDGDTISY 244

Query: 211 ANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLT 270
            +         I   +      D  +                     +    D +     
Sbjct: 245 VSKAGKDGSGAITSAVSGVVIADTGSTGVGTAAGVTPSATAFAKTNDTVAKIDISTAKGA 304

Query: 271 KKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQ 330
           +  +  + + +  I  QRA LG  +   +     L+N    +     +    +     A 
Sbjct: 305 QSAVLVIDEAIKQIDAQRADLGAVQNRFDNTINNLKNIGENVSAARGRIEDTDFAAETAN 364

Query: 331 LSTLINKIEMSYMITTKLQKL 351
           L+      +    I  +  +L
Sbjct: 365 LTKNQVLQQAGTAILAQANQL 385


>gi|239817135|ref|YP_002946045.1| flagellin [Variovorax paradoxus S110]
 gi|239803712|gb|ACS20779.1| flagellin domain protein [Variovorax paradoxus S110]
          Length = 412

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 32/404 (7%), Positives = 87/404 (21%), Gaps = 53/404 (13%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+                   + + +G   +      A       +      
Sbjct: 1   MAQVINTNSLSLLTQNNLNASQSSLNTAIQRLSSGLRINSAKDDAAGQAIANRFTANIRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L  +   +Q +    V    G    +        ++   
Sbjct: 61  LTQASRNANDGISLAQTTEGALKEVNNNLQRVRELSVQAANGSNSGSDLQSIQDEIKLRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 +  TD         ++    +               ++    L     ++    
Sbjct: 121 GEIDRVSKQTDFNGVKVLSSSAKPLTVQVGANDGETIDIDLKEISSKTLGMQGFNVAGPG 180

Query: 182 HLEV-----------------------------------------------------SSM 188
                                                                    +++
Sbjct: 181 ATAAFAFDGVTGSAAGDAPTVAQLKSLYGSTTAVTTTTVAEKTTDDLSTKLGLAAGGATL 240

Query: 189 NAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMF 248
               + D    L  + S     A   S+  +      +  T      A            
Sbjct: 241 TGNTVADKNGNLFAEVSITPTGAGETSSLINQGFTGAVDGTAMFRYIALDPASADTATTA 300

Query: 249 VAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNK 308
                T   SK      +   T   L  +   L  + + R+ LG  +   +     L   
Sbjct: 301 GTAAFTVDTSKVSVASLQTGSTASPLEAIDAALKQVDDLRSSLGAVQNRFDSVISNLGTA 360

Query: 309 NNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLS 352
              + +  S+    +  T  + ++      +    +  +  + +
Sbjct: 361 ITNLSSSRSRIEDADYATEVSNMTRAQILQQAGTSVLAQANQTT 404


>gi|239828339|ref|YP_002950963.1| flagellar hook-associated protein FlgL [Geobacillus sp. WCH70]
 gi|239808632|gb|ACS25697.1| flagellar hook-associated protein 3 [Geobacillus sp. WCH70]
          Length = 301

 Score =  137 bits (344), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 31/354 (8%), Positives = 93/354 (26%), Gaps = 54/354 (15%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++ S +   M         +  K  E++ TG+  +            + +      + 
Sbjct: 1   MRVTQSMLANNMLKHLSTSYANLGKYQEQLSTGKKINRPSDDPVVAMKGMAYRTNLTEVE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + S     +  S A L    + +Q +   +V       +  +    +  ++   E 
Sbjct: 61  QLKRNFSEAYNWIENSDAALDKATQALQRIRELVVQAGNDTYEATQRQAISQEIKQLTEH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            VT AN     +Y+F+G N+ + P+    T  + +  + +  ++          +    +
Sbjct: 121 LVTIANSKVGDKYIFNGTNTLQPPVQMNGTSITTSNNTEEVKIELAKGIYIAVNVNPTEV 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
                + +    F                                               
Sbjct: 181 FHYDASQKGKGLFSDL----------------------------------------QSLA 200

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
            D+      G +                   + +   ++ +                   
Sbjct: 201 NDLDDPNKTGKDINEYLGYIDQHISKLLSARAELGARMNRV--------------ELMEE 246

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            +  +  I    +S +  V+       L    +    +  +  ++ + +++++L
Sbjct: 247 RIGQQEIIAQKMLSDNEDVDMERVITDLKVQESVHRAALAVGARIIQPTLVDFL 300


>gi|290475010|ref|YP_003467894.1| Flagellin [Xenorhabdus bovienii SS-2004]
 gi|289174327|emb|CBJ81121.1| Flagellin [Xenorhabdus bovienii SS-2004]
          Length = 323

 Score =  137 bits (344), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 29/349 (8%), Positives = 80/349 (22%), Gaps = 36/349 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             + I+T+           +         E + +G   +      A       +      
Sbjct: 1   MASVINTNYSSLLAQNNLSKSQGVLGTAIERLSSGLRINSAKDDAAGQAIANRFTANVKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q +    V    G    +        +    
Sbjct: 61  LTQAARNANDGISIAQTTEGSLNEINNNLQRIRELAVQAQNGTNSESDRKSIQEEVTKRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  T          +++     G    + +A        +     +    L   
Sbjct: 121 DEINRISEQTQFNGVKVLSKDTTLNIQVGANDGEKIAIDLKKIDKETLKLGDFSVELQRT 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             E + +   +      + + K +                                    
Sbjct: 181 SEEKTKITEAEGKVKKAEEDAKKATG---------------------------------- 206

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
                           +          L    L+ +   LS +   R+ LG  +  +   
Sbjct: 207 --AAKTAAEATLKTEQAALEKAKEAGALPADTLAKLDGALSTVDSLRSSLGAVQNRLEST 264

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              L N  N +    S+    +  T  + +S      +    +  +  +
Sbjct: 265 VNNLNNTVNNLSAAKSRIEDADYATEVSNMSRGQILQQAGTSVLAQANQ 313


>gi|119469957|ref|ZP_01612762.1| putative flagellar synthesis; flagellar regulon; hook-associated
           protein [Alteromonadales bacterium TW-7]
 gi|119446667|gb|EAW27940.1| putative flagellar synthesis; flagellar regulon; hook-associated
           protein [Alteromonadales bacterium TW-7]
          Length = 410

 Score =  137 bits (344), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/410 (9%), Positives = 105/410 (25%), Gaps = 56/410 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +S + +++          ++  K  E++ T +         A  +  L++        
Sbjct: 1   MRLSNNLMYQSSLNSILNNQQNVSKAQEQVNTQKRVLTASDDPAAASRALQYTDRIQSNE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + +++  RL+  +  L +++  ++      +    G          A  ++    +
Sbjct: 61  QYSKNITMLNSRLNIEEGALENIKSALERAHTLTIQSGNGVYSAADREGLAEEIKALQST 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +   N   E                   +   L     DQ            + +  + 
Sbjct: 121 VLDLMNSKTEDGKYIFSGYQDNTQTYSLDSSTGLYVYGGDQGQHMIKIAEGVDIKSSDNG 180

Query: 184 EVSSMNAQQMTDFIKQLE-----------------------------DKFSDDEYWANNW 214
             +        D +                                 D  +       N 
Sbjct: 181 FDAFEKVDARLDVVSNDGVVSGGITSSKVYVTEQGQFDTFHKQNYNPDPSAAAGANTLNV 240

Query: 215 SNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKN-------------- 260
              +     Y+I+    I  + N+N   I+       +      +               
Sbjct: 241 ITTAGSPNTYQIEQAGTILATGNINDSVIKFAGMEISVTPVATGQIDITLEAPKKENVLN 300

Query: 261 -------------LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQN 307
                        LT+     +    L  +    + +   +A LG       +      +
Sbjct: 301 SMSELIAGLTNPALTEEEFEQVIADSLVQISNAKNNVSLTQAGLGGRINTAEKVLQSNTD 360

Query: 308 KNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            +    +  S  + ++   A  +L+     ++ S     +L  LS+ +YL
Sbjct: 361 LDINNKSARSDLVDIDITEAITELTKQETALQASQATFGRLANLSLFDYL 410


>gi|194365673|ref|YP_002028283.1| flagellar hook-associated protein FlgL [Stenotrophomonas
           maltophilia R551-3]
 gi|194348477|gb|ACF51600.1| flagellar hook-associated protein 3 [Stenotrophomonas maltophilia
           R551-3]
          Length = 400

 Score =  137 bits (344), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/397 (10%), Positives = 105/397 (26%), Gaps = 43/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            ++ ISTS +F +   L          L +++ TG              + +  ++    
Sbjct: 1   MSSRISTSMMFNQSVSLMMAKQAKLSHLEQQIATGSKIVSAKDDPVGAGAAVGLDRSLAA 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +     +   V  RL   +  L+ +  ++  +    +                  L    
Sbjct: 61  LDRMKLNAGNVQNRLGVQENTLAQVNDLMGRVNDLTIQASNPALSAADKKTLITELNQIR 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEEN-------- 173
           +  ++ AN  D       G  +   P         + +    Q       +         
Sbjct: 121 DGLLSLANADDGTGRYVFGGTNDGDPPFAKINGKVVYRGDQTQRQVEVGPDTYVRDSLPG 180

Query: 174 -------SKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDH------ 220
                              +      +   I +      + + ++  ++ A+ +      
Sbjct: 181 SEIFMRIPTGDGFVDGGAAAGNTGNGVLTNITRDGSDSWNGQSFSVRFTAANQYEVLDGA 240

Query: 221 ----------------------NIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLS 258
                                  I       +  +V    +      +  +         
Sbjct: 241 GNVTGTGTYKAGDNLEVNGVRLQITGAPVAGDSFNVKPATSRDIFDTMDKLIAALDADTG 300

Query: 259 KNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISK 318
                 A+    +  L  V +    +I+ RA  G   K ++      +     + T +S+
Sbjct: 301 TTAKMSAQQNELQNALRDVARASERMIDSRAAGGAQLKALDNAADMREANGVTLKTTLSQ 360

Query: 319 SIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILN 355
              ++   A +Q       ++ +  I +++Q +S+ N
Sbjct: 361 MRDLDYADALSQYQLQSTALQAAQTIFSQMQSMSLFN 397


>gi|229524143|ref|ZP_04413548.1| flagellin protein flaB [Vibrio cholerae bv. albensis VL426]
 gi|229337724|gb|EEO02741.1| flagellin protein flaB [Vibrio cholerae bv. albensis VL426]
          Length = 376

 Score =  137 bits (344), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 93/367 (25%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNGAADGMQKSMERLSSGYKINSARDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G   +++       +    
Sbjct: 61  LDMAVKNANDGISIAQTAEGAMNETTNILQRMRDLALQSSNGSNSSSERRAIQEEVSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +   K              S   M         KS  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGSFGSKSFQIGADSGEAVMLSMGSMRSDTQAMGGKSYRAQD 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                          +    +K  +      N     D        + +  DV A+V   
Sbjct: 181 GKAADWRVGAATDLTL-SYTNKQGEAREVTINAKQGDDLEELATYINGQTEDVKASVGEG 239

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +   +      ++                      D +    +++ +S +   L  
Sbjct: 240 GKLQLFASSQKVNGDVTIGGGLGGEIGFEAGRDVTVANVDVSTVAGSQEAVSILDGALKA 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +         L N N  ++   S+    +       ++      + S  
Sbjct: 300 VDSQRASLGAFQNRFGHAISNLDNVNENVNASRSRIRDTDYARETTAMTKAQILQQASTS 359

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 360 VLAQAKQ 366


>gi|187478162|ref|YP_786186.1| flagellin [Bordetella avium 197N]
 gi|115422748|emb|CAJ49276.1| flagellin [Bordetella avium 197N]
          Length = 377

 Score =  137 bits (344), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 35/367 (9%), Positives = 89/367 (24%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+ +         +         E + +G   +      A       +      
Sbjct: 1   MAAVINTNYLSLVAQNNLNKSQSALGSAIERLSSGLRINSAKDDAAGQAIANRFTANVKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q +    V    G             +    
Sbjct: 61  LTQAARNANDGISIAQTTEGALNEINNNLQRIRQLTVQATNGTNSQTDLDSIQAEVTQRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSL-----AKKSFDQMLQGFLEENSKS 176
           E     +  T                  G    +++        +    L      +++ 
Sbjct: 121 EEITRVSEQTQFNGVKVLAKEGKLSIQVGANDGETIEIDLKQIDAKTLKLDSLTLNSAQD 180

Query: 177 LLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSA 236
             A    +V +                 +           A D +I           V A
Sbjct: 181 AKATVAADVVAFTGTANAAAKVPTVTAVTGTTDLGTAAPAAGDVSIVTDKNGNLWAKVDA 240

Query: 237 NVNMR-------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
                               ++ + +A  GT  ++      A    T+  L+ +   +  
Sbjct: 241 VAGASRKGVAAGDSLYVAIKKEDIAIATDGTATIASVDFSKAAKAQTESPLAAIDSAMQT 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   R+ LG  +         L N  N +    S+    +  T  + ++      +    
Sbjct: 301 VDNLRSDLGAIQNRFESTIANLNNTVNNLSAARSRIEDADYATEVSNMTKAQILQQAGTS 360

Query: 344 ITTKLQK 350
           +  +  +
Sbjct: 361 VLAQANQ 367


>gi|262404488|ref|ZP_06081043.1| flagellin B [Vibrio sp. RC586]
 gi|262349520|gb|EEY98658.1| flagellin B [Vibrio sp. RC586]
          Length = 376

 Score =  137 bits (344), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 93/367 (25%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNGAADGMQKSMERLSSGYKINSARDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G   +++       +    
Sbjct: 61  LDMAVKNANDGISIAQTAEGAMNETTNILQRMRDLSLQSSNGSNSSSERRAIQEEVSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +   K              S   M         KS  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGSFGHKSFQIGADSGEAVMLSMGSMRSDTQAMGGKSYRAQD 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                          +    DK  +      N     D        + +  DV A+V   
Sbjct: 181 GKAADWRVGAATDLTL-NYTDKQGEAREVTINAKQGDDLEELATYINGQTDDVKASVGED 239

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +   +      ++                      D +    +++ +S +   L  
Sbjct: 240 GKMQLFASSQKVNGDVTIGGGLGGEIGFDAGRDVTVANIDVSTVAGSQEAVSVLDGALKA 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +         L N N  ++   S+    +       ++      + S  
Sbjct: 300 VDSQRASLGAFQNRFGHAISNLDNVNENVNASRSRIRDTDYARETTAMTKAQILQQASTS 359

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 360 VLAQAKQ 366


>gi|312884922|ref|ZP_07744612.1| flagellin [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367399|gb|EFP94961.1| flagellin [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 378

 Score =  137 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 43/368 (11%), Positives = 96/368 (26%), Gaps = 19/368 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+           + N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNKANDAQQTSMERLSSGFKINSAKDDAAGMQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           ++  + + +       T++  +     I+Q +    +    G    ++       +    
Sbjct: 61  LSVAVRNANDGISITQTAEGAMDESTNILQRIRDLSLQSANGSNSLSERVALQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         S K              + + M    +    KS LA  
Sbjct: 121 DELNRIAETTSFGGNRLLNGTYSTKSFQIGADNGEAVMLTLNDMRSDNVGMGGKSYLATT 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNM- 240
                         FI + +D    D+          D        + +   V A+V+  
Sbjct: 181 EKNKDWTVEAGTDTFIMKFKDNDGKDQEINITAKEGDDIEEVATYINGQNSSVKASVSDK 240

Query: 241 ------------------RGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLS 282
                              G              ++ +  D       ++ ++ V   L+
Sbjct: 241 GRLQIFAGSNKVDGEVAFSGTLAADLNLPAAGTDVTVHTIDITTVGGAQEAVAIVDTALN 300

Query: 283 GIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSY 342
            +   RA LG  +   N     L N N  ++   S+    +       L+      + S 
Sbjct: 301 YVDSHRAELGAFQNRFNHAISNLDNINENVNASKSRIKDTDFAKETTSLTKSQILSQSSS 360

Query: 343 MITTKLQK 350
            I  + ++
Sbjct: 361 SILAQAKQ 368


>gi|189339466|gb|ABD33726.2| flagellin [Bacillus thuringiensis serovar ostriniae]
          Length = 406

 Score =  137 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/363 (10%), Positives = 106/363 (29%), Gaps = 16/363 (4%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +         ++ + 
Sbjct: 34  MRINTNINSMRTQEYMRQNQAKMSNAMDRLSSGKRINNASDDAAGLAIATRMRARESGLG 93

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       + T+ + L+S+  I+  M         G    +             E 
Sbjct: 94  VAANNTQDGMSLIRTADSALNSVSNILLRMRDIANQSANGTNTGDNQKALDKEFSALKEQ 153

Query: 124 FVTFANMT-DEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
               +  T    + L +G N S           +                     +AG  
Sbjct: 154 IDYISKNTEFNDKKLLNGDNKSIAIQTLDNADTAKQININLADSSTKALNIDTLSIAGTT 213

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
            +  ++ A+ +TD    L+   +  +  A     +    I   +   +    + + N+  
Sbjct: 214 DKTITITAKDLTDNKTTLDALKTAKDDLAKLDDKSDQATIDKAVDAFKTAFNNVDKNLLS 273

Query: 243 IRDIMFVAVIGTEFLSKNLTDGA---------------RNVLTKKMLSTVQQGLSGIIEQ 287
            + I  +    T F   +    A                       + ++   L  I   
Sbjct: 274 DKAIEGITEKMTAFDGTHTAAAAIGAAYTEPTAADIKKSAPNASGAIKSIDAALETIASN 333

Query: 288 RAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTK 347
           RA LG +   ++     L+++++ + +  S+    +     ++++      E    + ++
Sbjct: 334 RATLGATLNRLDFNVNNLKSQSSSMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQ 393

Query: 348 LQK 350
             +
Sbjct: 394 ANQ 396


>gi|261252312|ref|ZP_05944885.1| flagellin protein FlaD [Vibrio orientalis CIP 102891]
 gi|260935703|gb|EEX91692.1| flagellin protein FlaD [Vibrio orientalis CIP 102891]
          Length = 377

 Score =  137 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 45/367 (12%), Positives = 95/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNSANNAQQTSMERLSSGSKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISIAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K +            S + M     +   +S  A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFGTKSMQIGADNGEAVMLSLNNMRSDDSKMGGQSFQAAT 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S   A    D    L D     +    N     D        + +   V A+VN  
Sbjct: 181 AKDSSWTVAAGANDLTVNLTDTDGVAQTITINAKEGDDIEELATYINGQTDMVKASVNED 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +   A                        ++ +  D       ++ +  +   L  
Sbjct: 241 GQLQVFAGADKVDGAVSFSGGLAGELSMGAATNVTVDTIDVTSVGGAQESVGIIDAALKN 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAINNLDNINENVNASKSRIKDTDFAKETTALTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           I  + ++
Sbjct: 361 ILAQAKQ 367


>gi|120318|sp|P13713|FLIC_SERMA RecName: Full=Flagellin
 gi|152827|gb|AAA26556.1| flagellin [Serratia marcescens]
          Length = 351

 Score =  137 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 33/351 (9%), Positives = 92/351 (26%), Gaps = 8/351 (2%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+         +         E + +G   +      A       +      
Sbjct: 1   MAQVINTNSLSLMAQNNLNKSQSSLGTAIERLSSGLRINSAKDDAAGQAISNRFTANIKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q++    V    G    +        +    
Sbjct: 61  LTQASRNANDGISLAQTTEGALNEVNDNLQNIRRLTVQAQNGSNSTSDLKSIQDEITQRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 +  TD         +       G    ++          +    +         
Sbjct: 121 SEINRISEQTDFNGVKVLSSDQKLTIQVGANDGETTDIDLKKIDAKQLGMDTFDVTTKSA 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                     ++T      +   +D    A   +  S  +   +          A  ++ 
Sbjct: 181 KAGAEIATGTKITVDSDATKQADADVTGLAKGQTLVSGTDADGKSAYFIATKDDATGDVA 240

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
             +  +             +TD   +   K  L+T+ + L+ +   R+ LG  +   +  
Sbjct: 241 YTKAKV--------ADDGKVTDSGTDAGVKNPLATLDKALAQVDGLRSSLGAVQNRFDSV 292

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLS 352
              L +  N +    S+    +  T  + +S      +    +  +  + +
Sbjct: 293 INNLNSTVNNLSASQSRIQDADYATEVSNMSRANILQQAGTSVLAQANQST 343


>gi|264676587|ref|YP_003276493.1| flagellin-like protein [Comamonas testosteroni CNB-2]
 gi|262207099|gb|ACY31197.1| flagellin-like protein [Comamonas testosteroni CNB-2]
          Length = 409

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 29/399 (7%), Positives = 74/399 (18%), Gaps = 49/399 (12%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+                     + + +G   +      A +        +   
Sbjct: 1   MAAIINTNIQSLNAQRSLSSSQSQLATSMQRLSSGLRINSAKDDAAGLAIAERMTTQVRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  LSS+   +Q +    V        +         ++   
Sbjct: 61  LTVAMRNANDGISLAQTAEGALSSVGSNLQRIRELAVQSRNATNSDEDRAALDAEVQQLK 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 A  T          + +         +      +     +        S+    
Sbjct: 121 AEISRIARDTSFNGTKLLDGSFTNMAFQVGANQGQTIDVNSIADSRIDKLGTWNSVPTPS 180

Query: 182 HLEVSSMNAQQMTDFIKQLED--------------------------------------- 202
                   A                                                   
Sbjct: 181 KSVAVGTIAGGAATGDTGDYTYELTVDSVAFFSKTVLDTKTADPLVTGQELDAQWAAFAA 240

Query: 203 ----------KFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVI 252
                               +  + +D  I+ +         +      G         +
Sbjct: 241 TSAGQGYKLSGTFSAGTAVISKLDGTDLKIEVKETGATTAKTAPTYGSAGFVGTFSNGKV 300

Query: 253 GTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNII 312
                            +   +  +   L  I   RA LG  +         L      +
Sbjct: 301 TQSKTGFEDLSVKDTQNSDNAIVAMDAALRAINGARADLGAIQSRFETTVENLSVNTENL 360

Query: 313 DTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKL 351
               S+ +  +     A LS      +    +  +  +L
Sbjct: 361 SASRSRIMDADFAAETANLSRTQILQQAGTAMVAQANQL 399


>gi|269796405|ref|YP_003315860.1| flagellin/flagellar hook associated protein [Sanguibacter keddieii
           DSM 10542]
 gi|269098590|gb|ACZ23026.1| flagellin/flagellar hook associated protein [Sanguibacter keddieii
           DSM 10542]
          Length = 390

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 26/377 (6%), Positives = 80/377 (21%), Gaps = 31/377 (8%)

Query: 5   GISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAE 64
            I+ +               D  K  E++ +G   +      A +        +   +  
Sbjct: 4   SINQNIAAVNSYRNLSNTQNDLSKSLEKLSSGFRINRAADDAAGLAISEGLRSQVGGLKV 63

Query: 65  RLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESF 124
              +       + T++  L+    I+Q +    V       +                  
Sbjct: 64  AARNAQDGISVVQTAEGALTETHAILQRVRDLAVQAGNDSNNAEARKNIDTEATQLVSEL 123

Query: 125 VTFANMTDEGQYLFSGIN------SSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLL 178
              +  T+                  +  +      +S             +  +  +  
Sbjct: 124 DRISKSTNFNGTNLLDGTAGGGSGKLQFQVGADGDANSQITVDLSGANIKAIAADLSTGS 183

Query: 179 AGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANV 238
                   +++   +T                    + A+       + D    D + N 
Sbjct: 184 LAVGGTEFTVSTAALTASAYTFSVDNGSGVTSDIAVTLATAPTSVQGLADALAADTNFNA 243

Query: 239 NMRGIRDIMFVAVI-------------------------GTEFLSKNLTDGARNVLTKKM 273
           N                                           ++   D +     +  
Sbjct: 244 NFSVNVIKDANGAATGISVKALNGGDVAVVDPGAGIDGGNQVANTQQGLDFSSAAAAQAS 303

Query: 274 LSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLST 333
           ++ + + +S +   RA LG  +         +      +    S+    +  +     + 
Sbjct: 304 ITKIDEKISSVSTARANLGALQNRFEHTVKNINVSVENLSASESRIRDTDMASEMVNFTR 363

Query: 334 LINKIEMSYMITTKLQK 350
                +    +  +  +
Sbjct: 364 AQILSQAGTSMLAQANQ 380


>gi|254519427|ref|ZP_05131483.1| flagellin protein FliB(S) [Clostridium sp. 7_2_43FAA]
 gi|226913176|gb|EEH98377.1| flagellin protein FliB(S) [Clostridium sp. 7_2_43FAA]
          Length = 381

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/358 (10%), Positives = 92/358 (25%), Gaps = 24/358 (6%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +      +        +S K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MIINHNMNALNAHRNMTGNTVNSGKSMEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  L+    + Q +    V    G  +++        +      
Sbjct: 61  QASRNAQDGISLIQTAEGALTETHSMAQRIRELAVQANNGTNNDDDLSEIQKEITQLNAE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKD---------------SLAKKSFDQMLQG 168
               A  T+             K  +G  T D               + +  +F    + 
Sbjct: 121 ITRVAEKTEFNTKTLLTGKLGVKAADGSVTMDNLKAAGISVDAGGVKTGSTLTFTLDGKN 180

Query: 169 FLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKD 228
            +  +  +      ++  ++ A Q  DF K         +   +N       + K     
Sbjct: 181 SISVSDGTTTQKIAIDPEAIKAGQTLDFDKIGLKMSFSADVNLSNGVGGDTISAKNITTT 240

Query: 229 TEGIDVSANVNMRGI---------RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQ 279
                     N              D +     G       +   +      + +  + Q
Sbjct: 241 GNNTSFQIGANSATTLDISINNMSADALGKGASGRVTDLSKVNVTSAGAGFDENIKVIDQ 300

Query: 280 GLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINK 337
            +  +  QR+ LG  +  +      L   +  +    S+   V+        S     
Sbjct: 301 AIKEVSAQRSQLGAWQNRLEHTINNLNTSSENLTAAESRVRDVDMAKEMMNFSKNNIL 358


>gi|52082071|ref|YP_080862.1| flagellin [Bacillus licheniformis ATCC 14580]
 gi|52787460|ref|YP_093289.1| flagellin [Bacillus licheniformis ATCC 14580]
 gi|319647938|ref|ZP_08002156.1| hag protein [Bacillus sp. BT1B_CT2]
 gi|52005282|gb|AAU25224.1| flagellin protein Hag [Bacillus licheniformis ATCC 14580]
 gi|52349962|gb|AAU42596.1| Hag [Bacillus licheniformis ATCC 14580]
 gi|194360421|gb|ACF57860.1| flagellin [Bacillus licheniformis]
 gi|317390279|gb|EFV71088.1| hag protein [Bacillus sp. BT1B_CT2]
          Length = 310

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 33/348 (9%), Positives = 81/348 (23%), Gaps = 49/348 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +             N  S K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINHNIAALNTLNRLSANNGASQKNMEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLE-GKTDNNKFPINAGMLRDSYE 122
               +       + T++  L+    I+Q +   +V     G             ++   +
Sbjct: 61  MASKNAQDGISLIQTAEGALTETHSILQRVRELVVQAGNTGTQQTEDLTAIQDEIKALKD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                +  T+                         +               +   ++   
Sbjct: 121 EIDGISERTEFNGKKLLDGTFKAPADPANPAAGEKSLVFQIGANATQQISVNIEKMSTDA 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
           L V           +     K  D   +A+N + A+D                       
Sbjct: 181 LGVKDPADTTGRTLVTNQSVKDIDVTKFADNAATATDV---------------------- 218

Query: 243 IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEER 302
                                          L  V   ++ +  QRA LG  +  +    
Sbjct: 219 --------------------------GFDTQLKIVDSAINQVSAQRAKLGAVQNRLEHTI 252

Query: 303 VFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
             L   +  +    S+   V+     ++ +      + S  +  +  +
Sbjct: 253 NNLGASSENLTAAESRIRDVDMAKEMSEFTKNNILSQASQAMLAQANQ 300


>gi|167769546|ref|ZP_02441599.1| hypothetical protein ANACOL_00880 [Anaerotruncus colihominis DSM
           17241]
 gi|167668514|gb|EDS12644.1| hypothetical protein ANACOL_00880 [Anaerotruncus colihominis DSM
           17241]
          Length = 390

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 29/379 (7%), Positives = 102/379 (26%), Gaps = 33/379 (8%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             + ++ +           N    K  E++ +G   +      + +    + + +   + 
Sbjct: 3   MVVRSNIMAVNAQRQLGMNNSQVGKALEKLSSGYRINRAGDDASGLAISEKMKAQIKGLD 62

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               ++      + T++  L+ +  ++  M         G  +++        +    E 
Sbjct: 63  TASLNSQDGISLVQTAEGALTEVHNMLNRMTELATRAANGINEDSNRASLQKEVAKLQEE 122

Query: 124 FVTFANMTDEGQYLFSGINSSEK--------------------------------PLNGY 151
               +  T+         + +                                   ++  
Sbjct: 123 IDRISEGTNFNNLKLLDGSQTYAGNTALIGKGTANGVMGLSVEGGNLSADAEISVNISAD 182

Query: 152 FTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWA 211
            T     K         F    +         +VS +   ++      +   FS D    
Sbjct: 183 KTGTVTVKAGGKATGVKFTVTQTGKGFYSVTADVSGVTDDKIKAAWSGVTANFSVDGPKD 242

Query: 212 NNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTK 271
           +    A +        ++  + +         +  + +  + +  L  +  D +      
Sbjct: 243 DGTYAAGEQKFTAGKNESMQLQIGDTA-DSFNQLKVGIGSMSSAALGVDKVDISNQEGAA 301

Query: 272 KMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQL 331
           K +  ++  +  +  QRA LG ++  +      L   +  + +  S+    +      + 
Sbjct: 302 KAIDIIRNAIDRVSSQRASLGATQNRLEYTINNLDTASENLQSANSRIRDTDMAKMMMEY 361

Query: 332 STLINKIEMSYMITTKLQK 350
           + +    + +  +  +  +
Sbjct: 362 TKMNVLTQSAQAMLAQANQ 380


>gi|149188074|ref|ZP_01866369.1| flagellin [Vibrio shilonii AK1]
 gi|148838062|gb|EDL55004.1| flagellin [Vibrio shilonii AK1]
          Length = 381

 Score =  136 bits (342), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 34/372 (9%), Positives = 85/372 (22%), Gaps = 22/372 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+           + +       E + +G   +      A +        +   
Sbjct: 1   MAVTVNTNVSAMTAQRYLNKSSDALNTSMERLSSGHKINSARDDAAGLQISNRLTAQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G     +            
Sbjct: 61  LDVAMRNANDGISIAQTAEGAMNESTSILQRMRDLAIQSANGTNSPAERVAINEESNALQ 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 A  T  G       +  E                   +          +  A  
Sbjct: 121 AELNRIAETTSFGGRRLLNGSFGEASFQIGANSGEALIMGLTSIRADDFRMGGTTYTANN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                                K  +            D        + +   +SA+V   
Sbjct: 181 GKGADWRVDNTNNQLDISFTTKSGEAVAINITAKQGDDIEQLATYINGQSDKISASVGDN 240

Query: 242 G----------------------IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQ 279
           G                      +   + +        +    D      ++  +S +  
Sbjct: 241 GELQVFVAEPDIDLNQSVTIGGSLATDLDLQTASAAQSTVQDIDMTSVAGSQNAISIIDS 300

Query: 280 GLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIE 339
            L  +  QRA LG  +  ++     L N    +D   S+    +      +++      +
Sbjct: 301 ALKYVDSQRADLGAKQNRLSHSINNLANVQENVDASNSRIKDTDFAKETTEMTKNQILQQ 360

Query: 340 MSYMITTKLQKL 351
               I  + ++L
Sbjct: 361 AGTSILAQAKQL 372


>gi|169831933|ref|YP_001717915.1| flagellar hook-associated protein 3 [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169638777|gb|ACA60283.1| flagellar hook-associated protein 3 [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 310

 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 40/354 (11%), Positives = 110/354 (31%), Gaps = 45/354 (12%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST   ++ +       +  + ++ E++ +G+  +   +  A ++ +L      + I 
Sbjct: 1   MRISTHLFYKNLLSSIHREHLGAARVQEQIASGRRINRLSEDPAALSQVLSLRTATSEIR 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + S  L   RL+ ++  L+   +++QD     V    G    +     A         
Sbjct: 61  DYVLSIDLQRSRLNRAEEALAQATQVMQDARVMAVQGATGTYSPSDLKNLAFE------- 113

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                                                  D+M+   +   + S    +  
Sbjct: 114 --------------------------------------VDRMITALVGFANASRGGVKPE 135

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
            +         + +     +   ++     W      N      D   +     +   G 
Sbjct: 136 GLFERTVVDGQEMVVYTPPEVWLEQVTGEGWGRVLTLNKLVETIDPGQVFQVEAMKDEGG 195

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
             ++   +    F  ++            ++  ++  +  +++ R  LG     + + + 
Sbjct: 196 NPVLRATMFDALFDLRDRLMAGEQSGVAGLIGVLEGHIDTLLQGRGDLGSRGYQLEKLQA 255

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            +Q +N  +   +SK    +   A  +++     ++ +     +L  +S+LNYL
Sbjct: 256 QIQIQNEQLTEVLSKIGDTDVAEAVIRINRHELVLQATLSTAARLMHVSLLNYL 309


>gi|85712263|ref|ZP_01043314.1| Flagellin [Idiomarina baltica OS145]
 gi|85693890|gb|EAQ31837.1| Flagellin [Idiomarina baltica OS145]
          Length = 395

 Score =  136 bits (341), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 32/382 (8%), Positives = 91/382 (23%), Gaps = 36/382 (9%)

Query: 5   GISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAE 64
            ++T+           +      +  + + +G   +      A +        + N +  
Sbjct: 4   YVNTNVSSINAQNQLVKSGNSLDQAFQRLSSGLRINSAADDAAGLQISNRLTSQVNGLNV 63

Query: 65  RLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESF 124
              + +       T++  L     I+Q M    +    G   +         +       
Sbjct: 64  ATRNANDGISLAQTAEGSLQESTNILQRMRELALQSANGSNSSADRQALNKEIGALKSEL 123

Query: 125 VTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLE 184
              ++ T  G       +   K        +     + D      L              
Sbjct: 124 TRISDNTAFGGSKILDGSFGTKEFQIGSEANETISLTLDDYDASNLGGVGAKGKTVTDAF 183

Query: 185 VSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIR 244
            +++           + D   +   +  + +     +      + +  +        G  
Sbjct: 184 DATVLGDAAETLTYAITDSDGNTNSFEVSIAAGDGSDALIEKVNAKANEFGVYAVDDGSG 243

Query: 245 DIMFVAVIGTEFLSKNLTDGARNV------------------------------------ 268
            +   A      ++ +   GA +                                     
Sbjct: 244 GVDLEASNSVTAITVDSDLGANSSYGDASSAPISLSIGAADSLASPKAGGVESIDVLSVE 303

Query: 269 LTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAH 328
             +  +  + Q ++ I  +RA LG  +  +      L   +  +    S+    +     
Sbjct: 304 NAQTAVGVIDQAIADIDSKRADLGAFQNRMQSTISNLSTISENVSAARSRVRDADFAAET 363

Query: 329 AQLSTLINKIEMSYMITTKLQK 350
           A+L+      + S  I  +  +
Sbjct: 364 AKLTQAQIIQQASTTILAQANQ 385


>gi|15214018|sp|Q56826|FLIC_XENNE RecName: Full=Flagellin
 gi|1136224|emb|CAA62509.1| flagellin [Xenorhabdus nematophila]
          Length = 313

 Score =  135 bits (340), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 30/349 (8%), Positives = 80/349 (22%), Gaps = 46/349 (13%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             + I+T+           +         E + +G   +      A       +      
Sbjct: 1   MASVINTNDSALLAQNNLTKSKGILGSAIERLSSGLRINSAKDDAAGQAIANRFTANVKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q +    V    G    +        +    
Sbjct: 61  LTQAARNANDGISIAQTTEGALNEINNNLQRIRELTVQSENGSNSKSDLDSIQKEVTQRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           E     +  T          + +E  +      +        ++    L     S++  +
Sbjct: 121 EEIDRISTQTQFNGIKVLNGDVTEMKIQVGANDNETIGIKLGKINSEKLNLKEFSVVEKE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            +        Q            +     A     A +   K                  
Sbjct: 181 AVAAKPAVPAQPAVPADPKNGVAAKPAVPAQPEVKAQEAVKKTDNP-------------- 226

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
                                           L T+ + L+ + + R+ LG  +  +   
Sbjct: 227 --------------------------------LDTLDKALAQVDDMRSSLGAVQNRLEST 254

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              L N  N +    S+    +     + +S      +    +  +  +
Sbjct: 255 VNNLNNTVNNLSAARSRIEDADYAVEVSNMSRGQILQQAGTSVLAQANQ 303


>gi|15642141|ref|NP_231773.1| flagellin [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121586833|ref|ZP_01676615.1| flagellin FlaB [Vibrio cholerae 2740-80]
 gi|121727199|ref|ZP_01680366.1| flagellin FlaB [Vibrio cholerae V52]
 gi|147674837|ref|YP_001217665.1| flagellin [Vibrio cholerae O395]
 gi|153213294|ref|ZP_01948706.1| flagellin FlaB [Vibrio cholerae 1587]
 gi|153801648|ref|ZP_01956234.1| flagellin FlaB [Vibrio cholerae MZO-3]
 gi|153818803|ref|ZP_01971470.1| flagellin FlaB [Vibrio cholerae NCTC 8457]
 gi|153822605|ref|ZP_01975272.1| flagellin FlaB [Vibrio cholerae B33]
 gi|153825608|ref|ZP_01978275.1| flagellin FlaB [Vibrio cholerae MZO-2]
 gi|153828612|ref|ZP_01981279.1| flagellin FlaB [Vibrio cholerae 623-39]
 gi|227082267|ref|YP_002810818.1| flagellin FlaB [Vibrio cholerae M66-2]
 gi|229507773|ref|ZP_04397278.1| flagellin B [Vibrio cholerae BX 330286]
 gi|229511990|ref|ZP_04401469.1| flagellin B [Vibrio cholerae B33]
 gi|229513793|ref|ZP_04403255.1| flagellin B [Vibrio cholerae TMA 21]
 gi|229519126|ref|ZP_04408569.1| flagellin B [Vibrio cholerae RC9]
 gi|229522095|ref|ZP_04411512.1| flagellin protein flaA [Vibrio cholerae TM 11079-80]
 gi|229528846|ref|ZP_04418236.1| flagellin B [Vibrio cholerae 12129(1)]
 gi|229607318|ref|YP_002877966.1| flagellin [Vibrio cholerae MJ-1236]
 gi|254291379|ref|ZP_04962172.1| flagellin FlaB [Vibrio cholerae AM-19226]
 gi|254849228|ref|ZP_05238578.1| flagellin FlaB [Vibrio cholerae MO10]
 gi|262153491|ref|ZP_06028621.1| flagellin B [Vibrio cholerae INDRE 91/1]
 gi|262167501|ref|ZP_06035207.1| flagellin B [Vibrio cholerae RC27]
 gi|262192271|ref|ZP_06050428.1| flagellin B [Vibrio cholerae CT 5369-93]
 gi|297582040|ref|ZP_06943959.1| flagellin FlaB [Vibrio cholerae RC385]
 gi|298497836|ref|ZP_07007643.1| flagellin FlaB [Vibrio cholerae MAK 757]
 gi|172044516|sp|P0C6C4|FLAB_VIBCH RecName: Full=Flagellin B
 gi|172047633|sp|A5F6C4|FLAB_VIBC3 RecName: Full=Flagellin B
 gi|2271028|gb|AAC01557.1| flagellin [Vibrio cholerae]
 gi|9656694|gb|AAF95287.1| flagellin FlaB [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121549000|gb|EAX59039.1| flagellin FlaB [Vibrio cholerae 2740-80]
 gi|121630444|gb|EAX62837.1| flagellin FlaB [Vibrio cholerae V52]
 gi|124116094|gb|EAY34914.1| flagellin FlaB [Vibrio cholerae 1587]
 gi|124122825|gb|EAY41568.1| flagellin FlaB [Vibrio cholerae MZO-3]
 gi|126510646|gb|EAZ73240.1| flagellin FlaB [Vibrio cholerae NCTC 8457]
 gi|126519853|gb|EAZ77076.1| flagellin FlaB [Vibrio cholerae B33]
 gi|146316720|gb|ABQ21259.1| flagellin FlaB [Vibrio cholerae O395]
 gi|148875883|gb|EDL74018.1| flagellin FlaB [Vibrio cholerae 623-39]
 gi|149740759|gb|EDM54858.1| flagellin FlaB [Vibrio cholerae MZO-2]
 gi|150422709|gb|EDN14663.1| flagellin FlaB [Vibrio cholerae AM-19226]
 gi|227010155|gb|ACP06367.1| flagellin FlaB [Vibrio cholerae M66-2]
 gi|227014038|gb|ACP10248.1| flagellin FlaB [Vibrio cholerae O395]
 gi|229332620|gb|EEN98106.1| flagellin B [Vibrio cholerae 12129(1)]
 gi|229341020|gb|EEO06025.1| flagellin protein flaA [Vibrio cholerae TM 11079-80]
 gi|229343815|gb|EEO08790.1| flagellin B [Vibrio cholerae RC9]
 gi|229348974|gb|EEO13931.1| flagellin B [Vibrio cholerae TMA 21]
 gi|229351955|gb|EEO16896.1| flagellin B [Vibrio cholerae B33]
 gi|229355278|gb|EEO20199.1| flagellin B [Vibrio cholerae BX 330286]
 gi|229369973|gb|ACQ60396.1| flagellin B [Vibrio cholerae MJ-1236]
 gi|254844933|gb|EET23347.1| flagellin FlaB [Vibrio cholerae MO10]
 gi|262024073|gb|EEY42768.1| flagellin B [Vibrio cholerae RC27]
 gi|262030728|gb|EEY49362.1| flagellin B [Vibrio cholerae INDRE 91/1]
 gi|262031881|gb|EEY50462.1| flagellin B [Vibrio cholerae CT 5369-93]
 gi|297533735|gb|EFH72577.1| flagellin FlaB [Vibrio cholerae RC385]
 gi|297542169|gb|EFH78219.1| flagellin FlaB [Vibrio cholerae MAK 757]
          Length = 376

 Score =  135 bits (340), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 95/367 (25%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNGAADGMQKSMERLSSGYKINSARDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G   +++       +    
Sbjct: 61  LDMAVKNANDGISIAQTAEGAMNETTNILQRMRDLALQSSNGSNSSSERRAIQEEVSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +   K              S   M         KS  A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGSFGSKSFQIGADSGEAVMLSMGSMRSDTQAMGGKSYRAQE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                       TD      +K  +      N     D        + +  DV A+V   
Sbjct: 181 GKAADWRVGA-ATDLTLSYTNKQGEAREVTINAKQGDDLEELATYINGQTEDVKASVGED 239

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +   +      ++                      + +    +++ +S +   L  
Sbjct: 240 GKLQLFASSQKVNGDVTIGGGLGGEIGFDAGRNVTVADVNVSTVAGSQEAVSILDGALKA 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +         L N N  ++   S+    +       ++      + S  
Sbjct: 300 VDSQRASLGAFQNRFGHAISNLDNVNENVNASRSRIRDTDYARETTAMTKAQILQQASTS 359

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 360 VLAQAKQ 366


>gi|190574254|ref|YP_001972099.1| flagellin [Stenotrophomonas maltophilia K279a]
 gi|190012176|emb|CAQ45799.1| putative flagellin [Stenotrophomonas maltophilia K279a]
          Length = 388

 Score =  135 bits (340), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 28/378 (7%), Positives = 83/378 (21%), Gaps = 29/378 (7%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+++                   + + +G   +      A +     +  +   
Sbjct: 1   MAQVINTNTMSLNAQRNLSTSGSSLATTIQRLSSGSRINSAKDDAAGLAISERFGTQIRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
               + + +        ++  L+ +   +Q +    V         +        +    
Sbjct: 61  TDVAIRNANDGISLAQVAEGSLTEIGNNLQRVRELSVQASNATNSASDRKALQAEVTQLV 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 A  +D         + S +                    +      ++ +    
Sbjct: 121 SEIDRVAKQSDFNGTKLLDGSFSSQLFQVGANAGQAIAIDKTIDAKANALGGAQFVTGTI 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWAN----------------------------- 212
                +       D              +                               
Sbjct: 181 AAPTLTGTPATTADIATFTLTSAQGTVTFDALKVENTDAAGAGKALATHINAKIGETGIL 240

Query: 213 NWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKK 272
             ++A+       +KD+   D +           +            +  D +     ++
Sbjct: 241 AEADATGALTLTSVKDSVKADGTLVQLTSTGGVTVAGNTTVPARQYADKIDVSTVKGAQQ 300

Query: 273 MLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLS 332
            +  V + L  I   RA LG  +         LQ  +  +    S+    +     A+L+
Sbjct: 301 AMEVVDKALGAINSTRADLGAVQNRFTSVVANLQTSSENLSASRSRIKDTDFAKETAELT 360

Query: 333 TLINKIEMSYMITTKLQK 350
                 +    +  +  +
Sbjct: 361 RTQILQQAGTAMLAQANQ 378


>gi|220913739|ref|YP_002489048.1| flagellin domain protein [Arthrobacter chlorophenolicus A6]
 gi|219860617|gb|ACL40959.1| flagellin domain protein [Arthrobacter chlorophenolicus A6]
          Length = 391

 Score =  135 bits (340), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 34/381 (8%), Positives = 88/381 (23%), Gaps = 32/381 (8%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+               D  K  E++ +G   +      A +      + +   + 
Sbjct: 3   MQINTNLAANNAYRSLSNTQNDLSKSLEKLSSGLRINRAGDDAAGLAISESLKSQIGGLN 62

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               +       + T++  LS    I+Q +    V       + +             E 
Sbjct: 63  VASRNAQDGIGLVQTAEGGLSQAHSILQRLRDLGVQAANDTNNTDSRAAIKTEATSLVEE 122

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A  TD         +++   +      D+ ++   D          +   L     
Sbjct: 123 LGRIAGSTDFNGTKLLNGDNASLKIQVGANGDAASQIGVDLSGANVKAIANTLNLGALAS 182

Query: 184 EVS------------SMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEG 231
             S            +       D +             +          ++     +  
Sbjct: 183 GGSKFDIADATALAGAATFSSTKDGVVTTVTTADLGAAGSFTSVEGYADALRKDADFSSK 242

Query: 232 IDVSANVNMRGIRDIMFVAVIGTEFLSKNLT--------------------DGARNVLTK 271
             VS   +  G    + V       L                         D +     +
Sbjct: 243 FTVSVEKDANGAGTGIVVQAKDGGDLLDADNATAGTGLAAGAATASVATGLDFSNASKAQ 302

Query: 272 KMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQL 331
             ++ +   +  +   RA LG ++  +      +      +    S+    +      + 
Sbjct: 303 ASITLIDTQIKNVSTARADLGATQNRLESAVQTINVAKENLTASNSRIRDTDMAEEMVKF 362

Query: 332 STLINKIEMSYMITTKLQKLS 352
           +      +    +  +  + S
Sbjct: 363 TRNNILSQAGTAMLAQANQSS 383


>gi|308050017|ref|YP_003913583.1| flagellar hook-associated protein 3 [Ferrimonas balearica DSM 9799]
 gi|307632207|gb|ADN76509.1| flagellar hook-associated protein 3 [Ferrimonas balearica DSM 9799]
          Length = 304

 Score =  135 bits (340), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 40/354 (11%), Positives = 101/354 (28%), Gaps = 50/354 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +S   +        +    +  K+ ++M +G+  +            L  ++E+  + 
Sbjct: 1   MRVSMQQMHRLNLNSMQMNQANYGKVLQQMSSGKKLNVPSDDPLGAVQSLSLQREQASLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + + S +   LS S++ L +M  ++  +    +    G   +      A  LR   +S
Sbjct: 61  QYMTNISSLRMSLSRSESTLDNMNNVLYRVRDLSLQGGNGALTHEDRKGIAAELRVLQDS 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V   N  DE        N  + P        +   +         + E +         
Sbjct: 121 LVEHVNAKDEKGKYIYSGNEVDTPPVAQDASGNWVYQGDLSQRDVPVGEGNWIPGNDTAG 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
            +     + + + + +  D   D      + +  +  +   R  D     +   +     
Sbjct: 181 AIFFAGGEDIFNGLSEWIDVLEDPTLVPGDPAFDAAMDKAMRTIDNTMASIGQTMT---- 236

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                                                          LG  ++ ++    
Sbjct: 237 ----------------------------------------------ELGGRQQGMDLLET 250

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             Q+        I +   ++   A   L+T +  ++ +     K+ +LS+ N+L
Sbjct: 251 AHQDIGMFNQELIGEIENLDYGEASLSLATYLMALQATQQSYVKINQLSLFNHL 304


>gi|254226370|ref|ZP_04919959.1| flagellin FlaB [Vibrio cholerae V51]
 gi|125621120|gb|EAZ49465.1| flagellin FlaB [Vibrio cholerae V51]
          Length = 376

 Score =  135 bits (340), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 39/367 (10%), Positives = 95/367 (25%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNGAADGMQKSMERLSSGYKINSARDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G   +++       +    
Sbjct: 61  LDMAVKNANDGISIAQTAEGAMNETTNILQRMRDLALQSSNGSNSSSERRAIQEEVSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +   K              S   M         KS  A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGSFGSKSFQIGADSGEAVMLSMGSMRSDTQAMGGKSYRAQE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                          +    +K  +      N     D        + +  DV A+V   
Sbjct: 181 GKAADWRVGAATDLTL-SYTNKQGEAREVTINAKQGDDLEELATYINGQTEDVKASVGED 239

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +   +      ++                      + +    +++ +S +   L  
Sbjct: 240 GKLQLFASSQKVNGDVTIGGGLGGEIGFDAGRNVTVADVNVSTVAGSQEAVSILDGALKA 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +   +     L N N  ++   S+    +       ++      + S  
Sbjct: 300 VDSQRASLGAFQNRFSHAISNLDNVNENVNASRSRIRDTDYARETTAMTKAQILQQASTS 359

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 360 VLAQAKQ 366


>gi|260772283|ref|ZP_05881199.1| flagellin protein FlaD [Vibrio metschnikovii CIP 69.14]
 gi|260611422|gb|EEX36625.1| flagellin protein FlaD [Vibrio metschnikovii CIP 69.14]
          Length = 377

 Score =  135 bits (340), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 41/367 (11%), Positives = 92/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                     E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNSATSAQQTSMERLSSGFKINSAKDDAAGLQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISMAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T              K              +   M          S +A  
Sbjct: 121 DELNRIAETTSFAGNRLLNGTFQTKSFQIGSQSGEAVMLTMKDMRSDNAMMGGTSYVAAT 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             +     +    D    L D   D++          D        + +   V A+VN +
Sbjct: 181 EADKDWTVSDGSNDLTLTLTDINGDEQIVNITAKVGDDIEEVATYINGQTDLVQASVNEK 240

Query: 242 GIRDIMFVAVIGT------------------EFLSKNLTDGARNVLTKKMLSTVQQGLSG 283
           G   +       T                  + ++ +  D       +K +S V   L  
Sbjct: 241 GQLQVFTGNNDVTGAVAFSGALATELDMQAGQAITIDTIDVTTVGGAQKSVSVVDAALKY 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +         L N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFGHAINNLDNINENVNASKSRIKDTDFAKETTALTKSQILSQASSS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|269960652|ref|ZP_06175024.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269834729|gb|EEZ88816.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 374

 Score =  135 bits (339), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 27/364 (7%), Positives = 88/364 (24%), Gaps = 16/364 (4%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              ++T+              + +++    + +G   +      A +        +   +
Sbjct: 1   MVSLNTNVTAMMTQRHLSHAAEQNIESQRNLTSGYRINSASDDAAGLQISNTLNVQTRGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
              L +         T++  L     I+Q +    +    G  D++        +    +
Sbjct: 61  DVALRNAHDAYSVAQTAEGALHESSDILQRLRSLGLQAANGSNDSSDRQSIQYEVVALQD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                A  T          +   +  +     +S++    +             +     
Sbjct: 121 ELDRVAITTTFADKNLFDGSYGSQSFHIGANANSISLTLRNMRSHIPEMGGQHYVGDAVD 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
            +       Q   F  Q     +  E+      +  +    Y       +  S   N   
Sbjct: 181 KDWRVTKDNQTLKFEYQDSKGQTQTEFIGLKLGDRIEQVATYINAQQSIVSASVTENNEL 240

Query: 243 IRDIMFVAVIGTEFLSKNLTDG----------------ARNVLTKKMLSTVQQGLSGIIE 286
                 +       L  +L D                 +     +  +  +   +  +  
Sbjct: 241 QFFASTLNAPEGVTLEGSLADELDVSAGGLVIMDDIDMSTVGGAQLSIGVIDAAIKYVDS 300

Query: 287 QRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITT 346
            R+ +G  +  ++     L   N  +     +    +      ++       + +  +  
Sbjct: 301 HRSEIGGFQNRVSGTMDNLNTVNRSVTESKGRIRDTDFARESTEMVRSQVLQDATTALLA 360

Query: 347 KLQK 350
           + ++
Sbjct: 361 QAKQ 364


>gi|87242474|gb|ABD33776.1| flagellin [Bacillus thuringiensis serovar higo]
          Length = 364

 Score =  135 bits (339), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 33/356 (9%), Positives = 101/356 (28%), Gaps = 11/356 (3%)

Query: 6   ISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAER 65
           I+T+    R     ++         + + +G+  +      A +         ++ +   
Sbjct: 1   INTNINSLRTQEYMRQNQSKMSNSMDRLSSGKRINNASDDAAGLAIATRMRARESGLNVA 60

Query: 66  LHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFV 125
            ++       + T+ + ++S+  I+  M         G   ++          +  +   
Sbjct: 61  ANNTQDGMPLIRTADSAMNSVSNILLRMRDIANQSANGTNTDSNKSALQKEFDELQKQIT 120

Query: 126 TFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKK-----------SFDQMLQGFLEENS 174
             A+ T          +S  K      +                    D++  G +    
Sbjct: 121 YIADNTQFNDKNLLKEDSEVKIQTLDSSSSEQQIGINLKAVTLEKLGIDKISIGAVAGAG 180

Query: 175 KSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDV 234
                    +      + + D  K  +D        A N    S    + +  +      
Sbjct: 181 AGAGTKIEQKDIDAVTKGIADLTKDSKDADVTAIKDALNNIKGSMDATQVKGIEDALKGF 240

Query: 235 SANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGIS 294
                      +  +       +    TD A      + +  + + L+ + + RA LG +
Sbjct: 241 KTGAADDTAAGVDDIKDALKAAVLPKATDAAEKDNALEAVKAIDKALTTVADNRATLGAT 300

Query: 295 EKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              ++     L++++  + +  S+    +     ++++      E    + ++  +
Sbjct: 301 LNRLDFNVNNLKSQSASMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQ 356


>gi|328545489|ref|YP_004305598.1| flagellar hook-associated protein L [polymorphum gilvum
           SL003B-26A1]
 gi|326415230|gb|ADZ72293.1| Flagellar hook-associated protein L [Polymorphum gilvum
           SL003B-26A1]
          Length = 349

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 85/357 (23%), Positives = 166/357 (46%), Gaps = 8/357 (2%)

Query: 1   MKTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKN 60
           MKTT IST ++ +    L  + + +  +L  EM TG+ +D GL LG+R    +    E  
Sbjct: 1   MKTTYISTFTLSDTSRGLLMKQSANLARLQVEMSTGRKADIGLDLGSRTGEAIALRSEHT 60

Query: 61  HIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDS 120
            +   + +N+L   RL  +QA L  +    Q  +  LV + +    +    +  G  +  
Sbjct: 61  RLNAIIDTNALAASRLDVTQAALGDVLGTAQSFLATLVGVRD---SDGSASVAKGEGQGG 117

Query: 121 YESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
            +  ++  N    G YLF+G+N+   P+  YF   + + K+            ++   + 
Sbjct: 118 LDLLISRLNTQVNGNYLFAGLNTDVAPMANYFETPAASNKAAVDAAFV-----ARFGFSQ 172

Query: 181 QHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNM 240
               VS+++A  M DF+        DD  W  +WS+AS+  +  RI  +E + +S + N 
Sbjct: 173 DDPAVSTISAADMDDFLTNFYMPLFDDPAWGADWSSASNDAVSSRISASETLGISVSANE 232

Query: 241 RGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINE 300
              R +  V  +  +  +  L + A   +  K +  + + + G+ +  + +GI+++ ++ 
Sbjct: 233 TAFRTLAAVFTMLADLGTGQLGEAAYGAVVDKAIGLLGEAIGGVTDLMSRMGIAQERVSN 292

Query: 301 ERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
               L  +  I++  I+    V       +L+T I ++E +Y ++ ++Q+LSILNYL
Sbjct: 293 ASDRLAIQAGILNQRINVLENVNPEETAVRLNTAITQLETTYAVSARIQRLSILNYL 349


>gi|254239460|ref|ZP_04932782.1| flagellin, FliC [Pseudomonas aeruginosa 2192]
 gi|3386644|gb|AAC28557.1| flagellin [Pseudomonas aeruginosa]
 gi|126192838|gb|EAZ56901.1| flagellin, FliC [Pseudomonas aeruginosa 2192]
          Length = 387

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 37/374 (9%), Positives = 93/374 (24%), Gaps = 28/374 (7%)

Query: 6   ISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAER 65
           ++T+             +       + + TG   +      A +        + N +   
Sbjct: 5   VNTNIASLNTQRNLNNSSASLNTSLQRLSTGSRINSAKDDAAGLQIANRLTSQVNGLNVA 64

Query: 66  LHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFV 125
             + +       T++  L     I+Q M    +    G   +++     G ++   +   
Sbjct: 65  TKNANDGISLAQTAEGALQQSTNILQRMRDLSLQSANGSNSDSERTALNGEVKQLQKELD 124

Query: 126 TFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEV 185
             +N T  G       +            + +     D+M    L         G  +  
Sbjct: 125 RISNTTTFGGRKLLDGSFGVASFQVGSAANEIISVGIDEMSAESLNGTYFKADGGGAVTA 184

Query: 186 SSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRD 245
           ++ +               +       N +            +   + + A  +   I  
Sbjct: 185 ATASGTVDIAIGITGGSAVNVKVDMKGNETAEQAAAKIAAAVNDANVGIGAFTDGAQISY 244

Query: 246 IMFVAVIGTEFLSKNLT----------------------------DGARNVLTKKMLSTV 277
           +   +  GT      +                             D +     +  +  +
Sbjct: 245 VSKASADGTTSAVSGVAITDTGSTGAGTAAGTTTFTEANDTVAKIDISTAKGAQSAVLVI 304

Query: 278 QQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINK 337
            + +  I  QRA LG  +   +     L+N    +     +    +     A L+     
Sbjct: 305 DEAIKQIDAQRADLGAVQNRFDNTINNLKNIGENVSAARGRIEDTDFAAETANLTKNQVL 364

Query: 338 IEMSYMITTKLQKL 351
            +    I  +  +L
Sbjct: 365 QQAGTAILAQANQL 378


>gi|189339433|gb|ABD33704.3| flagellin [Bacillus thuringiensis serovar morrisoni]
          Length = 406

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/363 (10%), Positives = 105/363 (28%), Gaps = 16/363 (4%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +         ++ + 
Sbjct: 34  MRINTNINSMRTQEYMRQNQAKMSNAMDRLSSGKRINNASDDAAGLAIATRMRARESGLG 93

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       + T+ + L+S+  I+  M         G    +             E 
Sbjct: 94  VAANNTQDGMSLIRTADSALNSVSNILLRMRDIANQSANGTNTGDNQKALDKEFSALKEQ 153

Query: 124 FVTFANMT-DEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
               +  T    + L +G N S           +                     +AG  
Sbjct: 154 IDYISKNTEFNDKKLLNGDNKSIAIQTLDNADTAKQININLADSSTKALNIDTLSIAGTT 213

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
            +  ++ A+ +TD    L+   +     A     +    I   +   +    + + N+  
Sbjct: 214 DKTITITAKDLTDNKATLDALKTAKADLAKLDDKSDQATIDKAVDAFKTAFNNVDKNLLS 273

Query: 243 IRDIMFVAVIGTEFLSKNLTDGARNVL---------------TKKMLSTVQQGLSGIIEQ 287
            + I  +    T F   +    A                       + ++   L  I   
Sbjct: 274 DKAIEGITDKMTAFDGTHTAAAAIGTAYTEPTAGDITKSAPNASGAIKSIDAALETIASN 333

Query: 288 RAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTK 347
           RA LG +   ++     L+++++ + +  S+    +     ++++      E    + ++
Sbjct: 334 RATLGATLNRLDFNVNNLKSQSSSMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQ 393

Query: 348 LQK 350
             +
Sbjct: 394 ANQ 396


>gi|238784718|ref|ZP_04628722.1| Flagellin [Yersinia bercovieri ATCC 43970]
 gi|238714397|gb|EEQ06405.1| Flagellin [Yersinia bercovieri ATCC 43970]
          Length = 419

 Score =  135 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/388 (9%), Positives = 87/388 (22%), Gaps = 39/388 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             + I+T+ +         +         E + +G   +      A       +      
Sbjct: 22  TMSVINTNILSLNTQNNMTKSQSALGSAIERLSSGLRINSAKDDAAGQAIANRFTSNIRG 81

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q +    V    G    +        ++   
Sbjct: 82  LTQAARNANDGISVAQTTEGALNEINNNLQRVRELTVQASTGSNSTSDLSSIQDEIQLRM 141

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  T          ++      G    +++     +   +    E         
Sbjct: 142 DEIDRVSAQTQFNGVKVLSSDTKMSIQVGANDNETIDISLKEVTSKTLNLEGFNVTGPKG 201

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
               +   A     F        +      +    A     K  +         +  N  
Sbjct: 202 GATAALAAADFQKAFGATTAMTTATSAETTDGALAARLGVAKASVTVGTAPTKDSAGNWF 261

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNV--------------------------------- 268
              DI          L  N  D A                                    
Sbjct: 262 TKVDIKANDATEANNLKANGFDIASGATKSFYIAVDPQTADTTTTAATAAISIDTASLSL 321

Query: 269 ------LTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGV 322
                  T   L  +   +S I  QR+ LG  +         L N  N +    S+    
Sbjct: 322 KKLTTGATNDPLKALDAAISDIDVQRSSLGAVQNRFQSTVTNLNNTVNNLTAAQSRIQDA 381

Query: 323 EQHTAHAQLSTLINKIEMSYMITTKLQK 350
           +  T  + +S      +    +  +  +
Sbjct: 382 DYATEVSNMSRAQILQQAGTSVLAQANQ 409


>gi|260892171|ref|YP_003238268.1| flagellar hook-associated protein 3 [Ammonifex degensii KC4]
 gi|260864312|gb|ACX51418.1| flagellar hook-associated protein 3 [Ammonifex degensii KC4]
          Length = 296

 Score =  135 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 42/354 (11%), Positives = 100/354 (28%), Gaps = 59/354 (16%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++T+ +                K  EE+ +G+  +        V S L    +     
Sbjct: 1   MRVTTNMLVTNFLRNLNSRLDQIAKRQEELASGRRLNRPSDDPTGVMSALRLRAQLAENQ 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   + +     L+ ++A L      VQ +    V               A  + +  E 
Sbjct: 61  QYHKNMADAVDWLNATEAALRDALATVQRVRELAVAGASDALPQGAREALAQEVEELKEH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               AN T  G+Y+F+G  +   P +    +       ++      ++ N+ S  A    
Sbjct: 121 LGNIANTTYGGRYIFAGTRTDLPPYSNGSLQSYPGGIEYEIAPATTIKVNTLSSEAFSVP 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
                                                               A  N    
Sbjct: 181 N---------------------------------------------------ATANKDIF 189

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
             +  ++    +  ++++++     L      ++   L  + E  A +    K +     
Sbjct: 190 EVLNQLSSDLRDGKTQDISNQRLQEL----DQSIDNLLKVLAEVGAKV----KRLEMGME 241

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L+     +   +S++   +       L T  N    +  +  +L + S++++L
Sbjct: 242 RLETNEADLTRLLSQTEDADMARTIVDLKTQENVYRAALAVGARLLQPSLVDFL 295


>gi|163802593|ref|ZP_02196485.1| flagellin [Vibrio sp. AND4]
 gi|159173676|gb|EDP58495.1| flagellin [Vibrio sp. AND4]
          Length = 374

 Score =  135 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 27/364 (7%), Positives = 89/364 (24%), Gaps = 16/364 (4%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              ++T+              + +++    + +G   +      A +        +   +
Sbjct: 1   MVSLNTNITAMMTQRHLSHAAEKNIESQRNLTSGYRINSASDDAAGLQISNTLNVQTRGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
              L +         T++  L     I+Q +    +    G  D++        +    +
Sbjct: 61  DVALRNAHDAYSVAQTAEGALHESSDILQRLRSLGLQAANGSYDSSDRQSIQHEVVALQD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                A  T  G       +   +  +     +S++    +             +     
Sbjct: 121 EIERVAITTTFGDKNLFNGSYGSQSFHIGANANSISLTLHNMRSHIPEMGGQHYVGDALD 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
            +       Q      Q     +  E       +  +    Y       +  S   +   
Sbjct: 181 KDWRVTKDNQTLQLEYQDNKGQTQTESIRLKLGDRIEQVATYINAQQATVSASVTQDNEL 240

Query: 243 ----------------IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIE 286
                                 + V   E ++ +  D +     +  +  +   +  +  
Sbjct: 241 QFFTSTLNAPEGVKFEGSLADDLDVDTGELVTIDDIDMSTAGGAQLSIGVIDAAIKYVDS 300

Query: 287 QRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITT 346
            R+ +G  +  I+     L   N  +     +    +      ++       + +  +  
Sbjct: 301 HRSEIGGFQNRISSAMDNLNTVNRSVTESKGRIRDTDFARESTEIVRSQVLQDATTALLA 360

Query: 347 KLQK 350
           + ++
Sbjct: 361 QAKE 364


>gi|261420577|ref|YP_003254259.1| flagellin [Geobacillus sp. Y412MC61]
 gi|319768247|ref|YP_004133748.1| flagellin domain protein [Geobacillus sp. Y412MC52]
 gi|261377034|gb|ACX79777.1| flagellin domain protein [Geobacillus sp. Y412MC61]
 gi|317113113|gb|ADU95605.1| flagellin domain protein [Geobacillus sp. Y412MC52]
          Length = 327

 Score =  135 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 25/347 (7%), Positives = 76/347 (21%), Gaps = 30/347 (8%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +               ++ K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINHNIAALNTYRQLTTNTTNASKSIEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  L+ +  I+Q M                              
Sbjct: 61  QASRNAQDGISLIQTAEGALNEVHSILQRMRELATQAANSTNTQADREQLQKEFNQLTSE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N T+         N S           +  +    ++     +    +       
Sbjct: 121 INRIGNTTEFNTQKLLNGNVSGASPIKLQIGANTNQSFEIKIFDMRAQALGLAGTTAGSK 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
                 A          E K         + +                            
Sbjct: 181 ASGLGAATTSNGTSVSNELKVGISNATFTSGTT--------------------------- 213

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                +  +      +   +          +S +   ++ +  +RA LG  +  +     
Sbjct: 214 ---NQLTDVSNASTPEYALNIMSFSGATAAISKIDIAINTVSTERARLGSYQNRLEHTIN 270

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            L      +    S+   V+      + +      + +  +  +  +
Sbjct: 271 NLDTSAENLTAAESRIRDVDMAKEMMEFTKQNILTQAAQSMLAQANQ 317


>gi|302669436|ref|YP_003829396.1| flagellin FliC3 [Butyrivibrio proteoclasticus B316]
 gi|302393909|gb|ADL32814.1| flagellin FliC3 [Butyrivibrio proteoclasticus B316]
          Length = 395

 Score =  135 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/385 (10%), Positives = 95/385 (24%), Gaps = 38/385 (9%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +      N   +  +    +  E + +G          + +        +   + 
Sbjct: 1   MKINYNVSAMIANNALQRNDTLLSESLERLSSGLKIANAKDNPSGLAMSRRMNSQIEGLG 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               +++     +  +   LS +Q+I+Q M    V    G   N+             E 
Sbjct: 61  VAGDTSNDGISIVQVADGSLSEIQEILQRMNQLAVQASNGTLTNSDREAIQEEASLLKEE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A  T              K         + ++      +  + +     +     +
Sbjct: 121 IERMAQTTQFNGQSILDGTFDLKGYATIGDTFAGSQTDASVKVVNYSDVVEAGVYKITGI 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSAN------ 237
           +VS ++    T   KQ     +D +          D      + +     V+ +      
Sbjct: 181 DVSYLHLTGTTGVDKQGIFFENDSDKAIKIERVNDDGTTTSYMNNGMIASVNEDVLTLRD 240

Query: 238 --------------------------------VNMRGIRDIMFVAVIGTEFLSKNLTDGA 265
                                               G    + +  +    L     D A
Sbjct: 241 STGKKIDIQIDRSLSDTLFVDLTASGAMTMQVGANEGQTLDIRIPKVNLTTLGIYNLDMA 300

Query: 266 RNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQH 325
                 + +  V+  L+ I   R+ LG  +  +      L      +    S+ + V+  
Sbjct: 301 NPEGALEAIEEVKGALANISSIRSRLGSYQNRLEHTSSSLDITVENMTAAYSRIMDVDMA 360

Query: 326 TAHAQLSTLINKIEMSYMITTKLQK 350
                 ST     +    +  +  +
Sbjct: 361 EEMTVYSTQQVLSQAGISMMAQANE 385


>gi|189339486|gb|ABD33736.2| flagellin [Bacillus thuringiensis serovar pondicheriensis]
          Length = 426

 Score =  135 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 30/384 (7%), Positives = 98/384 (25%), Gaps = 36/384 (9%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              I+T+    R     ++         + + +G+  +      A +         +N +
Sbjct: 33  IMRINTNINSMRTQEYMRQNQTKMSNAMDRLSSGKRINNASDDAAGLAIATRMRARENGL 92

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
               ++       + T+ + ++S+  I+  M         G   ++             E
Sbjct: 93  GVAANNTQDGMSLIRTADSAMNSVSNILLRMRDLANQSANGTNTDDNQKALDKEFSALKE 152

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLE----------- 171
                +  T+          +    +      D+  + + +                   
Sbjct: 153 QIDYISKNTEFNDKKLLNGENKTIAIQTLDNADTTKQININLADSSTSALQIDKLTISGK 212

Query: 172 ------------ENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASD 219
                        + +   A   ++  +   + + D   +      D           S+
Sbjct: 213 TTDTTKTQTITVTDDEIKAAKTDIDEFNDAKKALADLKAESAPSKGDGSSDDEIKEAVSN 272

Query: 220 HNIKYRIKDTEGIDVSANVNM-------------RGIRDIMFVAVIGTEFLSKNLTDGAR 266
               +        D                       + +        +  +  +T  A 
Sbjct: 273 FKKSFEKIQKFMNDSDIKTVQTEIEKFDAAAPALDKAKGMGIAFTSAMDPKAGTITKAAT 332

Query: 267 NVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHT 326
                  + ++   L  I   RA LG +   ++     L+++++ +    S+    +   
Sbjct: 333 RQNASDAIKSIDAALETIASNRATLGATLNRLDFNVNNLKSQSSSMAAAASQIEDADMAK 392

Query: 327 AHAQLSTLINKIEMSYMITTKLQK 350
             ++++      E    + ++  +
Sbjct: 393 EMSEMTKFKILNEAGISMLSQANQ 416


>gi|206970879|ref|ZP_03231831.1| A-type flagellin [Bacillus cereus AH1134]
 gi|206734515|gb|EDZ51685.1| A-type flagellin [Bacillus cereus AH1134]
          Length = 364

 Score =  135 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 34/354 (9%), Positives = 99/354 (27%), Gaps = 7/354 (1%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +         ++ + 
Sbjct: 1   MRINTNINSMRTQEYMRQNQAKMSNAMDRLSSGKRINNASDDAAGLAIATRMRARESGLG 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       + T+ + ++S+  I+  M         G   N              E 
Sbjct: 61  VAANNTQDGISLIRTADSAMNSVSNILLRMRDLANQSANGTNTNENQAALNKEFDALKEQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               +  T+         ++    +      D+  + + +       E    +L  G   
Sbjct: 121 IDYISTNTEFNDKKLLDGSNKTIAVQTLDNADTSKQININLSNVSTKELGLDTLSIGTDK 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDT-------EGIDVSA 236
              ++       F        +D   +  + + A     K +   +       E      
Sbjct: 181 VEKTVYDATTKAFADLGAKTGADKAAFDADVTAAMKEFDKVKPFMSADDVKKIETKLEDY 240

Query: 237 NVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEK 296
           N            A+         L            ++++   L  I   RA LG +  
Sbjct: 241 NKANDAGAQAAAQALGKEFATLTKLETTDLKANASGAIASIDTALKNIASNRATLGATLN 300

Query: 297 NINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            ++     L+++++ + +  S+    +     ++++      E    + ++  +
Sbjct: 301 RLDFNVNNLKSQSSSMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQ 354


>gi|19910959|dbj|BAB87728.1| flagellin protein FliB(C) [Clostridium chauvoei]
          Length = 413

 Score =  135 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 32/403 (7%), Positives = 90/403 (22%), Gaps = 56/403 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +      +         + K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MIINHNMNALNAHRNMMGNIATAGKSMEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  LS    I+Q M    V                  +    E 
Sbjct: 61  QASRNAQDGISLIQTAEGALSETHSILQRMRELSVQSANDTNVAVDRTAIQDEINSLTEE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               +  T+             +   G  +  ++     +          + SL +    
Sbjct: 121 INRISGDTEFNTQKLLDGGFKGEFQIGANSNQTVKLDIGNMSAASLGLTTTNSLESKALA 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSN----------------ASDHNIKYRIK 227
             S++           L D   +     N+ +                 A    +  +  
Sbjct: 181 LNSNLADGSYKISGTNLVDTNGNTVGTFNSGAKKIVVNGQDTVFTKAALADGAVLTVKGG 240

Query: 228 DTEGIDVSANVN-------------------------------------MRGIRDIMFVA 250
             +  +                                                  +   
Sbjct: 241 IADIKNTMTGAAKKLSSGSYEISGTNVIKDGKLVGTFATGAKKLTIDGVGDVTEAELGFI 300

Query: 251 VIGTEFLSKNLTDGARNVLTKKMLSTV---QQGLSGIIEQRAVLGISEKNINEERVFLQN 307
               +   K   +G+     +    ++      +  +  QR+ LG  +  +      L  
Sbjct: 301 TDQMKDGVKFTINGSDVSTRELASGSIKTINSAIEQVSTQRSKLGAVQNRLEHTINNLNT 360

Query: 308 KNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            +  +    S+   V+        S      + +  +  +  +
Sbjct: 361 SSENLTAAESRVRDVDMAKEMMAFSKNNILSQAAQAMLGQANQ 403


>gi|222099584|ref|YP_002534152.1| Flagellar hook-associated protein 3 [Thermotoga neapolitana DSM
           4359]
 gi|221571974|gb|ACM22786.1| Flagellar hook-associated protein 3 [Thermotoga neapolitana DSM
           4359]
          Length = 304

 Score =  135 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/353 (10%), Positives = 97/353 (27%), Gaps = 51/353 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++   I +R+    +   K   KLH+++ +G    Y            +    +  + 
Sbjct: 1   MRVTNKMISDRVLFNIQTSLKRIAKLHDQLSSGYRVRYPSDDAVVAKRASDIMTRRRELK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +   V   ++   + L ++  I Q +   LV    G     +    A  +    ++
Sbjct: 61  QFQRNIDHVQTYVNAYDSALQTVSAISQRLRELLVRAANGTLSKAEREAIAEEIDRIRDN 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V  AN     +Y+FSG +   +P+        +         +                
Sbjct: 121 LVEIANTRIGNEYIFSGYDVFSEPVKYENNAWKIVTSPSANRSRSVSVLGRSIEYGVTAG 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           E+  +                                                     G 
Sbjct: 181 EIFKL---------------------------------------------------GDGR 189

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                +  +     S        + ++   L  +      I +    +G   + I     
Sbjct: 190 NVFQVLDEVSGLLRSNLDDSAISSHISNISLKDLSFFEENITKVTGKVGGVSRFIEMVEK 249

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNY 356
            +++ +     Y+SK    +       L+   + +E +    +++ + +++++
Sbjct: 250 RIEDLDYFFTEYLSKERDADITELVTDLAMQQSVLEAALKSASRVLQATLVDF 302


>gi|194365671|ref|YP_002028281.1| flagellin [Stenotrophomonas maltophilia R551-3]
 gi|194348475|gb|ACF51598.1| flagellin domain protein [Stenotrophomonas maltophilia R551-3]
          Length = 395

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 28/385 (7%), Positives = 82/385 (21%), Gaps = 36/385 (9%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+++                   + + +G   +      A +     +  +   
Sbjct: 1   MAQVINTNTMSLNAQRNLSTSGSSLATTIQRLSSGSRINSAKDDAAGLAISERFGTQIRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
               + + +        ++  L+ +   +Q +    V         +        +    
Sbjct: 61  TDVAIRNANDGISLAQVAEGSLTEIGNNLQRVRELSVQASNATNSASDRKALQAEVTQLV 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 A  +D         + S +                    +      +K      
Sbjct: 121 SEIDRVAKQSDFNGTKLLDGSFSSQLFQVGANAGQAIAIDKTIDAKANALGGAKFDTNAL 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANV--- 238
            L   + N    T  +       +  +      + A+    +  +       +       
Sbjct: 181 ALADPAANGDFKTTGMSINGVAIAGIDVKQGADATATGKASREALVTAINAKIGETGVYA 240

Query: 239 ---------------------------------NMRGIRDIMFVAVIGTEFLSKNLTDGA 265
                                                       +         +  D +
Sbjct: 241 EVNGTAGVTLTSVKDSVNADGSFKAITATPGTWTGGAAAPTFTASTAAPAAKYASDLDVS 300

Query: 266 RNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQH 325
                ++ +  V + L  I   RA LG  +         LQ  +  +    S+    +  
Sbjct: 301 TVKGAQQAMEIVDKALGAINSTRADLGAIQNRFTSVVANLQTSSENLSASRSRIKDTDFA 360

Query: 326 TAHAQLSTLINKIEMSYMITTKLQK 350
              A+L+      +    +  +  +
Sbjct: 361 KETAELTRTQILQQAGTAMLAQANQ 385


>gi|330445356|ref|ZP_08309008.1| flagellar hook-associated protein 3 [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489547|dbj|GAA03505.1| flagellar hook-associated protein 3 [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 411

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/411 (10%), Positives = 125/411 (30%), Gaps = 55/411 (13%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               IST+S ++ +         +  + + ++ TG+  +          +I  + Q+   
Sbjct: 1   MINRISTASQYQSLTSNLMRKQGEVSESNNKLSTGKRVETAGDDPVSSVTIQNYRQQLTQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           I +   S ++   RL   ++ ++ ++  +      ++ ++ G   +N        L    
Sbjct: 61  IDQYKSSITMANNRLGVMESSIAGVEDNLDATKQKVLRMINGAMASNDRTAFKDELISLR 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +  +  AN  DE        +  +           +  +   Q     ++++ +   +  
Sbjct: 121 DGLLELANSRDESGSYVFAGDQMDTKPFIKDANGKMVYQGDSQSRYAQIDKSVEVKTSLP 180

Query: 182 HLEVSSMNAQQMTDFIKQLED-----------KFSDDEYWANNWSNASDHNIKYRIKDTE 230
             ++ +       DF     D             + D   A           +     TE
Sbjct: 181 GDQLFTSVPNPYGDFRPDFSDLSDGSKLHVLSATTSDFTKAKPIDIQFTEGTETLPDGTE 240

Query: 231 GIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGA------------------------- 265
              +  ++N+ G   +        + +     DG+                         
Sbjct: 241 KKVMQYSLNIDGKEVVADENYDPKQGIQYTAADGSELSITLDDVEVGDQLTLNPAQSINI 300

Query: 266 -------------------RNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQ 306
                                   + ++  +      + ++R+ +G   + +  ++    
Sbjct: 301 FDSLQDAIDNAEKPTSSAAAEATLQGVIDDIDSSFVHVSQRRSEVGTIMQQVERQQDQHL 360

Query: 307 NKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +    ++T  S    ++   A  +++  +  ++ S    +K ++LS+ NYL
Sbjct: 361 DFELTLNTAQSGLEDLDYSKAIMEMNQQMMALQASQSAFSKTKQLSLFNYL 411


>gi|261209878|ref|ZP_05924179.1| flagellin B [Vibrio sp. RC341]
 gi|260841064|gb|EEX67589.1| flagellin B [Vibrio sp. RC341]
          Length = 376

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/367 (10%), Positives = 94/367 (25%), Gaps = 19/367 (5%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+                  K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNGAADGMQKSMERLSSGYKINSARDDAAGLQISNRLTSQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G   +++       +    
Sbjct: 61  LDMAVKNANDGISIAQTAEGAMNETTNILQRMRDLSLQSSNGSNSSSERRAIQEEVSALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G       +   K              S   M         +S  A +
Sbjct: 121 DELNRIAETTSFGGNKLLNGSFGNKSFQIGADSGEAVMLSMGSMRSDTQAMGGRSYRAQE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                          +    DK  +      N     D        + +  DV A+V   
Sbjct: 181 GKAADWRVGAATDLTL-NYTDKQGEAREVTINAKQGDDLEELATYINGQTDDVKASVGEN 239

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +   +      ++                      D +    +++ +S +   L  
Sbjct: 240 GKMQLFASSQKVNGDVTIGGGLGGEIGFDAGRDVTVANIDVSTVAGSQEAVSVLDGALKA 299

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +  QRA LG  +         L N N  ++   S+    +       ++      + S  
Sbjct: 300 VDSQRASLGAFQNRFGHAISNLDNVNENVNASRSRIRDTDYARETTAMTKAQILQQASTS 359

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 360 VLAQAKQ 366


>gi|194365670|ref|YP_002028280.1| flagellin [Stenotrophomonas maltophilia R551-3]
 gi|194348474|gb|ACF51597.1| flagellin domain protein [Stenotrophomonas maltophilia R551-3]
          Length = 392

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 30/382 (7%), Positives = 81/382 (21%), Gaps = 33/382 (8%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+++                   + + +G   +      A +     +  +   
Sbjct: 1   MAQVINTNTMSLNAQRNLSTSGSSLATTIQRLSSGSRINSAKDDAAGLAISERFGTQIRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
               + + +        ++  L+ +   +Q +    V         +        +    
Sbjct: 61  TDVAIRNANDGISLAQVAEGSLTEIGNNLQRVRELSVQASNATNSASDRKALQAEVTQLV 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 A  +D         + S +                    +      S       
Sbjct: 121 SEIDRVAKQSDFNGTKLLDGSFSSQLFQVGANAGQSIAIDKTIDAKAGSLGTSTFAAGAT 180

Query: 182 HLEVSSM---------------------------------NAQQMTDFIKQLEDKFSDDE 208
            +  +S                                   A         +  + + D 
Sbjct: 181 DVLAASTDGSRITGKVMGVDIGTVELKAGATTADASKAVATAINAKIGEAGIYAEANADG 240

Query: 209 YWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNV 268
               +        +   I        +A                     +    D +  +
Sbjct: 241 SMKLSSVKEGKAVVAADIALERSDLTAATGVWSAKAAAGAYTAGTDTAANVQKLDVSTVL 300

Query: 269 LTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAH 328
             ++ L  V + L  I   RA LG  +         LQ  +  +    S+    +     
Sbjct: 301 GAQQALEVVDKALGAINSTRADLGAIQNRFTSVVANLQTSSENLSASRSRIKDTDFAKET 360

Query: 329 AQLSTLINKIEMSYMITTKLQK 350
           A+L+      +    +  +  +
Sbjct: 361 AELTRTQILQQAGTAMLAQANQ 382


>gi|302671557|ref|YP_003831517.1| flagellin FliC4 [Butyrivibrio proteoclasticus B316]
 gi|302396030|gb|ADL34935.1| flagellin FliC4 [Butyrivibrio proteoclasticus B316]
          Length = 406

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 33/392 (8%), Positives = 84/392 (21%), Gaps = 49/392 (12%)

Query: 10  SIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSN 69
                 N +     KD  K  E++ +G   +      A ++   +  ++   + +   + 
Sbjct: 7   MEAMNANRMLNVNVKDQAKASEKLSSGYRINRAADDAAGLSISEKMRRQVRGLTQAAENA 66

Query: 70  SLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFAN 129
                 +  ++  L+ +  ++Q M    V                  +            
Sbjct: 67  QDGISLVQIAEGALNEVHDMLQRMNELCVKSANDTLTYEDKTYIQSEIEALQSEIDRTGG 126

Query: 130 MTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMN 189
           +T   +         E       T                    S S+       + +  
Sbjct: 127 VTTFNEIKILNGIRQEMIRAASPTLAYNGISGGTLTQATSNALASYSIRPLSDGTILTTG 186

Query: 190 AQQMTDFIKQLE----------------------------------------------DK 203
                 +                                                     
Sbjct: 187 NGSEKTYYSVNGPNPPAHQVIYDDDGNIIDEIIPGSSRYPYSISKESVYRDIASRLSKAN 246

Query: 204 FSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLT- 262
            +DD   +  +  A     K+ ++    + +   V     + +                 
Sbjct: 247 TTDDYTVSITYQIAGPDEGKFNMEFFGKLQLKLQVGSEAGQTMDIKISPVNASSLGLWNV 306

Query: 263 --DGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSI 320
                 N      + TV+  +     +R+ LG  +  +      L N         S+  
Sbjct: 307 NVATRDNSGPLSGIETVKNAIEITSRERSNLGAYQNRLEHTIRNLDNVVENTTGAESRIR 366

Query: 321 GVEQHTAHAQLSTLINKIEMSYMITTKLQKLS 352
             +        S     I+    I ++  + +
Sbjct: 367 DTDMAHQMVNYSNRNILIQAGQTILSQANQTN 398


>gi|156973599|ref|YP_001444506.1| flagellin [Vibrio harveyi ATCC BAA-1116]
 gi|156525193|gb|ABU70279.1| hypothetical protein VIBHAR_01302 [Vibrio harveyi ATCC BAA-1116]
          Length = 374

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 28/364 (7%), Positives = 88/364 (24%), Gaps = 16/364 (4%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              ++T+              + +++    + +G   +      A +        +   +
Sbjct: 1   MVSLNTNVTAMMTQRHLGHAAEQNIESQRNLTSGYRINSASDDAAGLQISNTLNVQTRGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
              L +         T++  L     I+Q +    +    G  D++        +    +
Sbjct: 61  DVALRNAHDAYSVAQTAEGALHESSDILQRLRSLGLQAANGSNDSSDRQSIQYEVVALQD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                A  T          +   +  +     +S++    +             +     
Sbjct: 121 ELDRVAITTTFADKNLFDGSYGSQSFHIGANANSISLTLRNMRSHIPEMGGQHYVGDAVD 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR- 241
            +       Q      Q     S  EY      +  +    Y       +  S   N   
Sbjct: 181 KDWRVTKDNQTLKLEYQDSKGKSQTEYIRLKLGDRIEQVATYINAQQSIVSASVTENSEL 240

Query: 242 ---------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIE 286
                                 + V     ++ +  D +     +  +  +   +  +  
Sbjct: 241 QFFASTLNAPEGVELKGSLADELDVTAGGLVTMDDIDMSTAGGAQLSIGVIDAAIKYVDS 300

Query: 287 QRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITT 346
            R+ +G  +  I+     L   N  +     +    +      ++       + +  +  
Sbjct: 301 HRSEIGGFQNRISGTMDNLNTVNRSVTESKGRIRDTDFAREATEMVRSQVLQDATTALLA 360

Query: 347 KLQK 350
           + ++
Sbjct: 361 QAKQ 364


>gi|254230130|ref|ZP_04923525.1| polar flagellin FlaE [Vibrio sp. Ex25]
 gi|262394929|ref|YP_003286783.1| flagellin protein flaE [Vibrio sp. Ex25]
 gi|151937323|gb|EDN56186.1| polar flagellin FlaE [Vibrio sp. Ex25]
 gi|262338523|gb|ACY52318.1| flagellin protein flaE [Vibrio sp. Ex25]
          Length = 374

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 27/364 (7%), Positives = 88/364 (24%), Gaps = 16/364 (4%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              ++T+           +    +V+    + +G   +      A +        +   +
Sbjct: 1   MVSLNTNVAAMVAQRHLSQAAAQNVESQRNLTSGFRINSASDDAAGLQISNTLHVQTRGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
              L +         T++  L     I+Q +    +    G  D +        +    +
Sbjct: 61  DVALRNAHDAYSVAQTAEGALHESSDILQRLRSLGLQAANGSNDTSDRQSIQYEVVALQD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                A  T          +   +  +     +S++    +             +     
Sbjct: 121 ELDRVAITTTFADKNLFDGSYGSQSFHIGANANSISLTLRNMRSHIPEMGGLHYVGDAVD 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR- 241
            +       Q      Q     +  E       +  +    Y       +  S   N   
Sbjct: 181 KDWRVTKDNQTLKVEYQDSKGQTQTESIGLKLGDRVEQVATYINAQQSVVSASVTENNEL 240

Query: 242 ---------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIE 286
                                 + +   + ++ +  D +     +  +  +   +  +  
Sbjct: 241 QFFASTIKAPEGVVLDGSLADELDISTGQLVTMDDIDMSTAGKAQLSIGVIDAAIKYVDS 300

Query: 287 QRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITT 346
            R+ +G  +  +N     L   N  +    S+    +      ++       + +  +  
Sbjct: 301 HRSEIGSFQNRVNGSVDNLNTVNRSVTESKSRIRDTDFARESTEMVRSQVLQDATTALLA 360

Query: 347 KLQK 350
           + ++
Sbjct: 361 QAKQ 364


>gi|24374751|ref|NP_718794.1| flagellar hook-associated protein FlgL [Shewanella oneidensis MR-1]
 gi|24349415|gb|AAN56238.1|AE015761_8 flagellar hook-associated protein FlgL [Shewanella oneidensis MR-1]
          Length = 403

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/405 (9%), Positives = 117/405 (28%), Gaps = 53/405 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +ST+ +F +      +    + K+ E++ +G+  +           I    Q    + 
Sbjct: 1   MRLSTAQLFNQSITSVLQKQTATSKVLEQLSSGKKVNTSGDDPVAALGIDNLNQRNALVD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +      RL+ +++ L S + +   +   L+  + G   +++  + A  ++DS + 
Sbjct: 61  QFMKNIDYANNRLAVTESKLGSAEDLTGSIREQLMRAVNGTLSDSERQMIADEMKDSLKE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ-- 181
            ++ AN  DE         S++K    +                      S   +     
Sbjct: 121 LLSLANSKDESGNYLFSGFSTDKQPFAFDNSTPPKIVYSGDSGVRDSLVQSGVAIGTNIP 180

Query: 182 -------------------------------------------------HLEVSSMNAQQ 192
                                                                +     Q
Sbjct: 181 GDQAFMKAPNGLGDYSVNYLASQQGDFKVQTAKIADQATYVADTYTFNFSDNGAGGVNLQ 240

Query: 193 MTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVI 252
           + D         ++ +       N  +  I  +    +   +     +     I     +
Sbjct: 241 VLDSANNPVANVTNFDATTPVSFNGIEVKIDGKPSAGDSFSMEPQSEVSIFDTISNAIAL 300

Query: 253 GTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNII 312
             +                ++L+ +  G++ +   R+V G + K +   +     +  + 
Sbjct: 301 IEDPNV--ANSPQGKAQLAQILNNIDSGVNQMSSARSVAGNNLKTVERYKDTHTEEKVVN 358

Query: 313 DTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            + +S    ++  +A  +       +     + +K+  +S+ +++
Sbjct: 359 TSALSLLEDLDYASAITEFEKQQLALNAVSNVFSKVGSVSLFDFI 403


>gi|261253605|ref|ZP_05946178.1| flagellin protein FlaD [Vibrio orientalis CIP 102891]
 gi|260936996|gb|EEX92985.1| flagellin protein FlaD [Vibrio orientalis CIP 102891]
          Length = 377

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/367 (11%), Positives = 93/367 (25%), Gaps = 18/367 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+             N       E + +G   +      A +        +   
Sbjct: 1   MAVNVNTNVSAMTAQRYLNSANSAQQTSMERLSSGFKINSAKDDAAGMQISNRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G    ++       +    
Sbjct: 61  LDVAVRNANDGISMAQTAEGAMNETTNILQRMRDLSLQSANGSNSKSERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G         + K              + + M    +     S +A  
Sbjct: 121 DELNRIAETTSFGGNKLLNGTFATKSFQIGADNGEAVMLTMNNMRSDNVMMGGNSYVAAN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D    L DKF   +    N     D        + +   V A+V   
Sbjct: 181 GQGKDWSVQAGANDLTISLTDKFGGAQNITINAKEGDDIEELATYINGQTDLVKASVGEE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT------------------DGARNVLTKKMLSTVQQGLSG 283
           G   +           +   +                  D       ++ ++ V   L  
Sbjct: 241 GNLQLFTDNNKVDGAATFGGSLAGELSFGAAQAVTVDTIDVTSVAGAQESVAIVDAALKF 300

Query: 284 IIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
           +   RA LG  +   N     L+N N  ++   S+    +       L+      + S  
Sbjct: 301 VDSHRAELGAFQNRFNHAINNLENINENVNASNSRIKDTDFAKETTALTKSQILTQASSS 360

Query: 344 ITTKLQK 350
           +  + ++
Sbjct: 361 VLAQAKQ 367


>gi|167769547|ref|ZP_02441600.1| hypothetical protein ANACOL_00881 [Anaerotruncus colihominis DSM
           17241]
 gi|167668515|gb|EDS12645.1| hypothetical protein ANACOL_00881 [Anaerotruncus colihominis DSM
           17241]
          Length = 386

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 27/374 (7%), Positives = 99/374 (26%), Gaps = 27/374 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             + ++ +           N    K  E++ +G   +      + +    + + +   + 
Sbjct: 3   MVVRSNIMAVNAQRQLGMNNSQVGKALEKLSSGYRINRAGDDASGLAISEKMKAQIKGLD 62

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               ++      + T++  L+ +  ++  M         G  +++        +    E 
Sbjct: 63  TASLNSQDGISLVQTAEGALTEVHNMLNRMTELATRSANGINEDSNRASLQKEVAKLQEE 122

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               +  T+         + +          + +   + +        +     L+ Q  
Sbjct: 123 IDRISKSTNFNNLKLLDGSQTYAAATAAGNANGVQNLTIEGGNLSATGQGVSVALSAQGA 182

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYW---------------------------ANNWSN 216
              ++       F      K                                   +    
Sbjct: 183 VTVTVTGGANVAFKTTQTGKGFYSITADLSKVTDDKVKAAWAGVTLNFSVDEAKNDGTYV 242

Query: 217 ASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLST 276
            +   I+   K+        +      +  + +  + ++ L  +  D +      K + T
Sbjct: 243 TTAAAIQNVGKNGSMQLQIGDTADDFNQLKVGIGDMSSKGLGIDKVDISNQDGAAKAIDT 302

Query: 277 VQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLIN 336
           ++  +  +  QRA LG ++  +      L   +  +    S+    +      + + +  
Sbjct: 303 IKNAIDRVSSQRASLGATQNRLEYTINNLDTASENLQAANSRIRDTDMAKMMMEYTKMNV 362

Query: 337 KIEMSYMITTKLQK 350
             + +  +  +  +
Sbjct: 363 LTQSAQAMLAQANQ 376


>gi|189339436|gb|ABD33705.2| flagellin [Bacillus thuringiensis serovar londrina]
          Length = 364

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 30/349 (8%), Positives = 90/349 (25%), Gaps = 2/349 (0%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +         ++ + 
Sbjct: 6   MRINTNINSMRTQEYMRQNQAKMSNAMDRLSSGKRINNASDDAAGLAIATRMRARESGLG 65

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       + T+ + ++S+  I+  M         G   +              E 
Sbjct: 66  VAANNTQDGISLIRTADSAMNSVSNILLRMRDLANQSANGTNTSENQAALDKEFGALKEQ 125

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               +  T+         ++    +      D   K                 L  G   
Sbjct: 126 INYISTNTEFNDKKLLDGSNETIAIQTLDNADEGKKIDIKLANVSTDSLKIDKLTIGGAA 185

Query: 184 EVSSMNAQQMTDFI--KQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
           + +        + +      DK +                     +D + I         
Sbjct: 186 QKTVDAVADKFNALKTTTTTDKAAIQTEVDAVMKEFDKVKGSMSAEDAKVITDKLKDYND 245

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
                   A    +  +               ++ +   L  I   RA LG +   ++  
Sbjct: 246 AADTDTAKATAAKDLGAAFDKTKVNIANPNAAVAAIDSALENIASNRATLGATLNRLDFN 305

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              L+++++ + +  S+    +     ++++      E    + ++  +
Sbjct: 306 VNNLKSQSSSMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQ 354


>gi|168335507|ref|ZP_02693588.1| flagellin domain protein [Epulopiscium sp. 'N.t. morphotype B']
          Length = 412

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/402 (9%), Positives = 100/402 (24%), Gaps = 55/402 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+ +             D   + E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINTNLMAINSQRNLTINQGDQGSIMEKLSSGLRINRAGDDAAGLAISEKMRNQIKGLQ 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  L    ++++ M    +  +     +         L+     
Sbjct: 61  QSSSNAQDGISLIQTTEGALGETHEMLKRMREMSIQSMNDTYTSEDRKKLDIELKQLITE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A+ T+  +      + + K L+   +  +    +         E   K   A    
Sbjct: 121 IDGIADKTEFNEQKLLTGDPTGKGLDLVASARTSLTNAVGTYYDKVAEYQGKLAAAYSID 180

Query: 184 EVS------------------------------------SMNAQQMTDFIKQLEDKFSDD 207
             S                                    +  A +     K        +
Sbjct: 181 GGSSMADLENRVLDLEQEISALEIKAAGASDETEAQKILASVAGKQVSLEKTKASLAFVE 240

Query: 208 EYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTD---- 263
              A   ++ASD        +   +   AN     +   +       +  + N       
Sbjct: 241 SESAALKASASDILKSAVKLEQSTVVEKANKLQATMNQEVGPNEFTFQVGANNDQSIQLN 300

Query: 264 ---------------GARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNK 308
                                    L+++   +  +  QRA LG  +  +      L N 
Sbjct: 301 IKAMNVTALGLTATKIDTPESANIALNSIDAAVEIVSRQRAELGAVQNRLEHTVKSLDNT 360

Query: 309 NNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              + +  S+    +       L+ +    + S  +  +  +
Sbjct: 361 AENLQSAESQIRDADMAAEMVNLTRVNILAQASQSMLAQANQ 402


>gi|152987902|ref|YP_001349643.1| flagellar hook-associated protein FlgL [Pseudomonas aeruginosa PA7]
 gi|150963060|gb|ABR85085.1| flagellar hook-associated protein 3 [Pseudomonas aeruginosa PA7]
          Length = 433

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/432 (9%), Positives = 94/432 (21%), Gaps = 78/432 (18%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST   F            D  +  E++ TG+              +L  +QE+    
Sbjct: 1   MRISTIQAFNNSVNGISRNYADLNRTFEQISTGKRILTPADDPVGSVRLLRLDQEQGLNE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +     +     LS  +  L S+  ++Q +        +G  D+N     A  L    + 
Sbjct: 61  QYKTGMTEAKNSLSQEETILRSVGNVLQRIREIAGQAGDGALDSNDKKALASELSQREDE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +   N  D         +             + +    +   +  +  +++  ++    
Sbjct: 121 LLNLLNSRDASGKYLFSGSQGSVQPFVRNEDGTYSYMGDESQREVQIASSTRIPVSDSGK 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDD------------------EYWANNWSNASDHNIKYR 225
            +            +       D                          ++  D +    
Sbjct: 181 VLFEDIVNAARLDTRAAAGNTGDGRISVGLVEDELAFGSQFPASNPPAATDGFDIHFVSD 240

Query: 226 IKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKM------------ 273
            +       S                           D                      
Sbjct: 241 REYVVYDPKSLPPGYDWNTYDPNSPPAWQLSKGAIDDDPKTIDKVLYAGVSVTIDGTPKA 300

Query: 274 --------------------LSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIID 313
                               +S +++ L    + +A               L      +D
Sbjct: 301 GDEFNVNYKPGSEKRSLLNVVSDLRKALESSTDNQAGNDAIRDATAVALTNLSAVAASVD 360

Query: 314 TYISKS----------------------------IGVEQHTAHAQLSTLINKIEMSYMIT 345
               +                               ++   A ++LS     ++ +    
Sbjct: 361 GGQGRIGARLNTVESTETFIDDVKLVNASVMSQIQDLDYAEALSRLSLQSTIMDAAQQSY 420

Query: 346 TKLQKLSILNYL 357
            K+Q LS+ NYL
Sbjct: 421 VKIQGLSLFNYL 432


>gi|113969613|ref|YP_733406.1| flagellar hook-associated protein FlgL [Shewanella sp. MR-4]
 gi|113884297|gb|ABI38349.1| flagellar hook-associated protein 3 [Shewanella sp. MR-4]
          Length = 402

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 51/402 (12%), Positives = 124/402 (30%), Gaps = 48/402 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +S++ +F +      +    + K+ +++ +G+  +           I    Q    + 
Sbjct: 1   MRLSSAQLFNQSISSVLQKQTATSKILDQLSSGKKVNTSGDDPVAALGIDNLNQRNALVD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +    T  L  +++ L     ++  M   ++    G   + +    A  LR S + 
Sbjct: 61  QFMKNIDYATNHLQQTESQLGQADTLISSMKDLMLQGSNGSQTSEERQTIADDLRKSLDQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +T AN  DE        N ++     +     +  +    +    +    +        
Sbjct: 121 LLTIANTKDESGNYLFAGNKTDTLPFQFDANGKIVYQGDSGVHSAIIASGIQLNTNVAGD 180

Query: 184 EVSSMNAQQMTDF-------------------------IKQLEDKFSDDEYWANNWSNAS 218
                +   M D+                         +   +  F DD     N     
Sbjct: 181 TAFIKSPNAMGDYSVNYLPSQQGEFSVTSAKLDGVTPSLSDYKINFLDDGAGGINVEVTD 240

Query: 219 DHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEF---------------------- 256
                  I      D SA++N  G++  +       +                       
Sbjct: 241 TATPANVISAAAPFDPSASINFDGVKLSIEGEPKIGDSFTLHQEAEVSIFDTFSKAIDLF 300

Query: 257 -LSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTY 315
              + +   +      ++L+ VQ G+  I +Q+ + G S K + +      ++  I  + 
Sbjct: 301 ENGEQVQTPSGQSELAQLLNNVQSGVKQISQQQGLAGNSLKVLEKYTDKHTDEKLINTSA 360

Query: 316 ISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +SK   V+  TA  +       +     + +K+  +S+ +Y+
Sbjct: 361 LSKLEDVDYATAITEFEKQQLALNAVSSVFSKVGSVSLFDYI 402


>gi|167038174|ref|YP_001665752.1| flagellin domain-containing protein [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320116583|ref|YP_004186742.1| flagellin domain-containing protein [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166857008|gb|ABY95416.1| flagellin domain protein [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|319929674|gb|ADV80359.1| flagellin domain protein [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 404

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 32/402 (7%), Positives = 94/402 (23%), Gaps = 57/402 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +               ++ K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MIINHNLSALNAWRALSINTANTQKSLEKLSSGYRINRAGDDAAGLAISEKMRAQIAGLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  L+  Q I+Q M    V         +        +    + 
Sbjct: 61  QAQRNAQDGISLIQTAEGALNETQAILQRMRELAVQAANDTNTASDRAQIQKEIDQLAQE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDS---------------LAKKSFDQMLQG 168
                  T+         +       G     +               +   ++      
Sbjct: 121 LGRIGRTTEFNTQKLLDGSFKGIFQIGANENQNLSLTINDMRGYALQVVGGVTYSITGTF 180

Query: 169 FLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKD 228
               +   +  G +          + D    +    +D + + N  ++A   N       
Sbjct: 181 TPAASGSLISDGTYTVSYDGTKYLLKDQAGNIVATSTDGKSYTNAANDAISFNDPVISGQ 240

Query: 229 TEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLT-------------------------- 262
                 +A        + +       +F +K L                           
Sbjct: 241 ITINGTNATGVATVTNEGLDAGTYTYDFTNKVLKNASGEIIGKSADDKTFVDLQGKTLFT 300

Query: 263 ----------------DGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQ 306
                           D          ++ +Q  +  +  +R+ LG  +  +      L 
Sbjct: 301 LGAAVTANTTFTIGGIDVTTQSAANAAITKLQSAIDTVSTERSKLGAYQNRLEHTINNLG 360

Query: 307 NKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKL 348
                +    S+   V+      + +      + +  +  ++
Sbjct: 361 TAAENLTAAESRIRDVDMAKEMMEFTKNNILNQAATAMLERM 402


>gi|220932549|ref|YP_002509457.1| flagellar hook-associated protein 3 [Halothermothrix orenii H 168]
 gi|219993859|gb|ACL70462.1| flagellar hook-associated protein 3 [Halothermothrix orenii H 168]
          Length = 301

 Score =  134 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 32/354 (9%), Positives = 94/354 (26%), Gaps = 54/354 (15%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + +   +    +   K   K ++++ TG+      +        +          
Sbjct: 1   MRITNNIMVTNLKNYLQRGMKALDKYNKKLATGKEFTLPEEDPIATQRSMILHSALKANK 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       L  +++ L  +  ++Q               + +    A  + +  + 
Sbjct: 61  QYQRNVDHAQDWLLNTESALHDVNDVLQRAYQLAEHGANDTVSDEEREAIAQEIEELNQH 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V  AN    G+Y+FSG  +  K     +                               
Sbjct: 121 LVQLANTKVAGKYIFSGSATDTKAYVANY---------------------------NSGT 153

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           +  +    Q  +     E        +  +  +    N +             N N   I
Sbjct: 154 DTYTFTHYQGDNVSLTAEISPGVPVDYNISGEDVFGPNGELFNILENLRQNLKNDNRDAI 213

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
              +       +                            I++  +++G     ++  + 
Sbjct: 214 ETRIGELEAEMD---------------------------NIMKHFSIIGAKTNRLDLSKN 246

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            L ++   ++  IS++   +       L    N    +     ++ + S+++++
Sbjct: 247 RLSSEELNLNQLISRNEDADMAETIMNLKMQENVFRATLASGARIIQPSLVDFI 300


>gi|30692080|gb|AAP33175.1| FliC [Pseudomonas aeruginosa]
 gi|126165556|gb|ABN80235.1| FliC [Pseudomonas aeruginosa]
          Length = 387

 Score =  134 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/374 (9%), Positives = 94/374 (25%), Gaps = 28/374 (7%)

Query: 6   ISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAER 65
           ++T+             +       + + TG   +      A +        + N +   
Sbjct: 5   VNTNIASLNTQRNLNNSSASLNTSLQRLSTGSRINSAKDDAAGLQIANRLTSQVNGLNVA 64

Query: 66  LHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFV 125
             + +       T++  L     I+Q M    +    G   +++     G ++   +   
Sbjct: 65  TKNANDGISLAQTAEGALQQSTNILQRMRDLSLQSANGSNSDSERTALNGEVKQLQKELD 124

Query: 126 TFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEV 185
             +N T  G       +            + +     D+M    L     +   G  +  
Sbjct: 125 RISNTTTFGGRKLLDGSFGVASFQVGSAANEIISVGIDEMSAESLNGTYFTANGGGAVTA 184

Query: 186 SSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRD 245
           ++ +               +       N +            +   + + A  +   I  
Sbjct: 185 ATASGTVDIAIGITGGSAVNVKVDMKGNETAEQAAAKIAAAVNDANVGIGAFTDGAQISY 244

Query: 246 IMFVAVIGTEFLSKNLT----------------------------DGARNVLTKKMLSTV 277
           +   +  GT      +                             D +     +  +  +
Sbjct: 245 VSKASADGTTSAVSGVAITDTGSTGAGTAAGTTTFTEANDTVAKIDISTAKGAQSAVLVI 304

Query: 278 QQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINK 337
            + +  I  QRA LG  +   +     L+N    +     +    +     A L+     
Sbjct: 305 DEAIKQIDAQRADLGAVQNRFDNTINNLKNIGENVSAARGRIEDTDFAAETANLTKNQVL 364

Query: 338 IEMSYMITTKLQKL 351
            +    I  +  +L
Sbjct: 365 QQAGTAILAQANQL 378


>gi|313106052|ref|ZP_07792311.1| A-type flagellin [Pseudomonas aeruginosa 39016]
 gi|30692065|gb|AAP33173.1| FliC [Pseudomonas aeruginosa]
 gi|30692074|gb|AAP33174.1| FliC [Pseudomonas aeruginosa]
 gi|310878813|gb|EFQ37407.1| A-type flagellin [Pseudomonas aeruginosa 39016]
          Length = 387

 Score =  134 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/374 (9%), Positives = 94/374 (25%), Gaps = 28/374 (7%)

Query: 6   ISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAER 65
           ++T+             +       + + TG   +      A +        + N +   
Sbjct: 5   VNTNIASLNTQRNLNNSSASLNTSLQRLSTGSRINSAKDDAAGLQIANRLTSQVNGLNVA 64

Query: 66  LHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFV 125
             + +       T++  L     I+Q M    +    G   +++     G ++   +   
Sbjct: 65  TKNANDGISLAQTAEGALQQSTNILQRMRDLSLQSANGSNSDSERTALNGEVKQLQKELD 124

Query: 126 TFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEV 185
             +N T  G       +            + +     D+M    L     +   G  +  
Sbjct: 125 RISNTTTFGGRKLLDGSFGVASFQVGSAANEIISVGIDEMSAESLNGTYFTATGGGAVTA 184

Query: 186 SSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRD 245
           ++ +               +       N +            +   + + A  +   I  
Sbjct: 185 ATASGTVDIAIGITGGSAVNVKVDMKGNETAEQAAAKIAAAVNDANVGIGAFTDGAQISY 244

Query: 246 IMFVAVIGTEFLSKNLT----------------------------DGARNVLTKKMLSTV 277
           +   +  GT      +                             D +     +  +  +
Sbjct: 245 VSKASADGTTSAVSGVAITDTGSTGAGTAAGTTTFTEANDTVAKIDISTAKGAQSAVLVI 304

Query: 278 QQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINK 337
            + +  I  QRA LG  +   +     L+N    +     +    +     A L+     
Sbjct: 305 DEAIKQIDAQRADLGAVQNRFDNTINNLKNIGENVSAARGRIEDTDFAAETANLTKNQVL 364

Query: 338 IEMSYMITTKLQKL 351
            +    I  +  +L
Sbjct: 365 QQAGTAILAQANQL 378


>gi|242392306|dbj|BAH80326.1| flagellin [Bacillus sp. PS3]
          Length = 327

 Score =  134 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 25/347 (7%), Positives = 75/347 (21%), Gaps = 30/347 (8%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +               ++ K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINHNIAALNTYRQLTTNTTNASKSIEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  L+ +  I+Q M                              
Sbjct: 61  QASRNAQDGISLIQTAEGALNEVHSILQRMRELATQAANSTNTQADREQLQKEFNQLTSE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N T+         N S           +  +    ++     +    +       
Sbjct: 121 INRIGNTTEFNTQKLLNGNVSGASPIKLQIGANTNQSFEIKIFDMRAQALGLAGTTAGSK 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
                 A          E K         + +                            
Sbjct: 181 ASGLGAATTSNGTSVSNELKVGISSATFTSGAT--------------------------- 213

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                +  +      +   +          +S +   ++ +  +RA LG  +  +     
Sbjct: 214 ---NQLTDVSNASTPEYALNIMSFSGATAAISKIDIAINTVSTERARLGSYQNRLEHTIN 270

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            L      +    S    V+      + +      +   ++  +  +
Sbjct: 271 NLDTSAENLTAAESGIRDVDMAKEMMEFTKQNILTQAGPIVLAQANQ 317


>gi|90579917|ref|ZP_01235725.1| flagellar hook-associated protein [Vibrio angustum S14]
 gi|90438802|gb|EAS63985.1| flagellar hook-associated protein [Vibrio angustum S14]
          Length = 411

 Score =  134 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 44/411 (10%), Positives = 131/411 (31%), Gaps = 55/411 (13%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+S ++ +         +  + + ++ TG+  +          +I  + Q+   
Sbjct: 1   MINRVSTASQYQSLTSNLMRKQGEVNESNNQLSTGKRVETAGDDPVSSVTIQNYRQQLTQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           I +   S ++   RL   ++ ++ ++  +      ++ ++ G   +N        L    
Sbjct: 61  IDQYKSSITMANNRLGVMESSIAGVEDNLDAAKQKVLRMINGAMASNDRTAFKDELTSLR 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +  +  AN  DE        N  +       T   +  +   Q     ++++ +   +  
Sbjct: 121 DGLLELANSRDESGNYVFAGNQMDTQPFVKGTDGKMNYQGDSQSRYAQIDKSVEVKTSLP 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNAS----------------------- 218
             ++ +       DF     D  S  +    + + +                        
Sbjct: 181 GDQLFTSIPNPYGDFRPDFSDLSSGSKLHVLSATTSDFTKAQPIDIAFSEAVVTQPDGSE 240

Query: 219 ---------------------DHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFL 257
                                D     +    +G  VS  ++   + D + +       +
Sbjct: 241 KTVMQYNLSLDGKEVVADQDYDPEKGVQYTAADGSSVSITLDDVEVGDKLTLNPAQKINI 300

Query: 258 SKNLTDG-----------ARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQ 306
             +L D            A     ++++  +      + ++R+ +G   + +  ++    
Sbjct: 301 FDSLQDAIDNAEKPTSSAAAEATLQRVIDDIDSSFLHVSQRRSEVGTIMQQVERQQEQHL 360

Query: 307 NKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +    +++  S    ++   A  +++  +  ++ S    +K ++LS+ NYL
Sbjct: 361 DFELTLNSAQSGLEDLDYSKAIMEMNQQMMALQASQSAFSKTKQLSLFNYL 411


>gi|189164093|gb|ABU96036.2| flagellin [Bacillus thuringiensis serovar kenyae]
          Length = 367

 Score =  134 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/357 (10%), Positives = 92/357 (25%), Gaps = 10/357 (2%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +         +  + 
Sbjct: 1   MRINTNINSMRTQEYMRQNQAKMSNSMDRLSSGKRINNASDDAAGLAIATRMRSREGGLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               +       + T+ + L+S+  I+  M         G   +              E 
Sbjct: 61  VAARNTEDGMSLIRTADSALNSVSNILLRMRDLANQSASGTNTDKNQAAMQKEFDQLKEQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQG----------FLEEN 173
               A+ T+         ++S   +    + D   + +                      
Sbjct: 121 IQYIADNTEFNDKKLLDGSNSTINIQTLDSHDKNKQITISLDSASLKNLDIKDLAIGSAT 180

Query: 174 SKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGID 233
                           A  +TD     +D       +    S  +   +       +  D
Sbjct: 181 INQTDLDTATNSMKRLATPVTDGKVLAQDIADAKAAFNKVQSAYTPAEVDKIQDAFKAYD 240

Query: 234 VSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGI 293
             A        DI   A           T  A        +  + + +  I   RA LG 
Sbjct: 241 KLAADPASKDTDIADAAKNVNTVFGTLATPTATKFDPSSAVEKIDKAIETIASSRATLGA 300

Query: 294 SEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
           +   ++     L+++ N +    S+    +     ++++      E    + ++  +
Sbjct: 301 TLNRLDFNVTNLKSQENSMAASASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQ 357


>gi|260899316|ref|ZP_05907711.1| polar flagellin E [Vibrio parahaemolyticus AQ4037]
 gi|308110204|gb|EFO47744.1| polar flagellin E [Vibrio parahaemolyticus AQ4037]
          Length = 374

 Score =  134 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 28/364 (7%), Positives = 90/364 (24%), Gaps = 16/364 (4%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              ++T+           +    +V+    + +G   +      A +        +   I
Sbjct: 1   MVSLNTNVAAMMTQRHLSQAADQNVESQRNLSSGYRINSASDDAAGLQISNTLHVQTRGI 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
              L +         T++  L     I+Q +    +    G  + +        +    +
Sbjct: 61  DVALRNAHDAYSVAQTAEGALHESSDILQRLRSLGLQAANGSHEQDDRKSLQQEVIALQD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                A  T          +   +  +     +S++    +             L     
Sbjct: 121 ELDRVAITTTFADKNLFNGSYGSQSFHIGANANSISLALRNMRTHIPEMGGQHYLGDSLD 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR- 241
            +       Q   F  Q  +  +  +       +  +    Y       +D S   + + 
Sbjct: 181 KDWRVTRDNQQFAFEYQDNEGQAQSKVLTLKVGDNLEEVATYINAQQSVVDASVTQDHQL 240

Query: 242 ---------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIE 286
                                 + +   E ++ +  D +     +  +  V   +  +  
Sbjct: 241 QFFISTLNAPEGITWKGNFADEMDIGSGELVTVDDLDMSTVGGAQLAIGVVDAAIKYVDS 300

Query: 287 QRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITT 346
            R+ +G  +  ++     L   N  +     +    +       +       + +  +  
Sbjct: 301 HRSEIGGFQNRVSGTIDNLNTINRSVSESKGRIRDTDFARESTVMVRSQVLQDATTALLA 360

Query: 347 KLQK 350
           + ++
Sbjct: 361 QAKQ 364


>gi|328555241|gb|AEB25733.1| flagellin protein [Bacillus amyloliquefaciens TA208]
 gi|328913602|gb|AEB65198.1| flagellin protein [Bacillus amyloliquefaciens LL3]
          Length = 328

 Score =  134 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 28/346 (8%), Positives = 89/346 (25%), Gaps = 30/346 (8%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +      +      +  + K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINHNIAALNTSRQLNAGSNAASKNMEKLSSGLRINRAGDDAAGLAISEKMRSQIRGLD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               +       + TS+  L+    I+Q M             ++        +      
Sbjct: 61  MASKNAQDGISLIQTSEGALNETHSILQRMSELATQAANDTNTDSDRSELQKEMDQLASE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               +  T+          + +        +      S ++M    L+  +         
Sbjct: 121 VTRISTDTEFNTKKLLDGTAKDLTFQIGANEGQTMSLSINKMDSESLKVGTTYTANTDGS 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           ++ + + ++ T      +      +        A                          
Sbjct: 181 KLVTADGKEATLVTDGSKGPNGYYDTDDKLVYQADSALAA-------------------- 220

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                        ++K +   +        L+T++  +  +  +RA LG  +  +     
Sbjct: 221 ----------DTKVTKGIDISSSAKAASSALTTIKTAIDTVSSERAKLGAVQNRLEHTIN 270

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQ 349
            L   +  + +  S+   V+  +   + +      + S  +  +  
Sbjct: 271 NLGTSSENLTSAESRIRDVDMASEMMEYTKNNILTQASQAMLAQAN 316


>gi|113911614|gb|ABI48290.1| Fla2 flagellin [Lachnospiraceae bacterium 14-2]
          Length = 368

 Score =  134 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 33/353 (9%), Positives = 87/353 (24%), Gaps = 11/353 (3%)

Query: 9   SSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHS 68
           +      N           K  E++ +G   +      A +    +   +   + +   +
Sbjct: 6   NLTAMNANRQLGVTTSTQAKSSEKLSSGYRINRAGDDAAGLKISEKMRSQIRGLNKASSN 65

Query: 69  NSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFA 128
                  + T++  L+    I+Q M    V        N         L    E     +
Sbjct: 66  AQDGVSLIQTAEGALNEAHSILQRMNELAVQGANDTNQNVDRDAINQELSALVEELDRIS 125

Query: 129 NMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSM 188
             T   +      + + K L     ++     +   M    +      + A      ++ 
Sbjct: 126 ETTQFNKQSLLDGSFTGKNLQVGANQNQKITINIAAMNAAAIGIKPTQVGAMSGYLTTNE 185

Query: 189 NAQQMTDFIKQLED-----------KFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSAN 237
             +                             ++ N    + +  +     T   DV   
Sbjct: 186 VVKNQKVGTNNSAALRGSIGALAACTVQVGAIYSANSKGVAYYKTQNGTITTNSGDVRTC 245

Query: 238 VNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKN 297
                +       V      + +  +          ++ +Q  ++ +  QR+ LG  +  
Sbjct: 246 AKNLAMCAAQIFKVASKPATTVSTPNVRDYQQATGTITMIQNAINNVSSQRSALGALQNR 305

Query: 298 INEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
           +      L N         S+    +  +   + S      +    +  +  +
Sbjct: 306 LEHTIANLDNVAENTQAAESRIRDTDMASEMVEYSKNNILAQAGQSMLAQANQ 358


>gi|167039117|ref|YP_001662102.1| flagellin domain-containing protein [Thermoanaerobacter sp. X514]
 gi|256750922|ref|ZP_05491806.1| flagellin domain protein [Thermoanaerobacter ethanolicus CCSD1]
 gi|300913293|ref|ZP_07130610.1| flagellin domain protein [Thermoanaerobacter sp. X561]
 gi|307723693|ref|YP_003903444.1| flagellin domain-containing protein [Thermoanaerobacter sp. X513]
 gi|166853357|gb|ABY91766.1| flagellin domain protein [Thermoanaerobacter sp. X514]
 gi|256750257|gb|EEU63277.1| flagellin domain protein [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889978|gb|EFK85123.1| flagellin domain protein [Thermoanaerobacter sp. X561]
 gi|307580754|gb|ADN54153.1| flagellin domain protein [Thermoanaerobacter sp. X513]
          Length = 404

 Score =  134 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 32/402 (7%), Positives = 94/402 (23%), Gaps = 57/402 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +               ++ K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MIINHNLSALNAWRALSINTANTQKSLEKLSSGYRINRAGDDAAGLAISEKMRAQIAGLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  L+  Q I+Q M    V         +        +    + 
Sbjct: 61  QAQRNAQDGISLIQTAEGALNETQAILQRMRELAVQAANDTNTASDRAQIQKEIDQLAQE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDS---------------LAKKSFDQMLQG 168
                  T+         +       G     +               +   ++      
Sbjct: 121 LGRIGRTTEFNTQKLLDGSFKGIFQIGANENQNLSLTINDMRGYALQVVGGVTYSITGTF 180

Query: 169 FLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKD 228
               +   +  G +          + D    +    +D + + N  ++A   N       
Sbjct: 181 TPAASGSLISNGTYTVSYDGTKYLLKDQAGNIVATSTDGKSYTNAANDAISFNDPVISGQ 240

Query: 229 TEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLT-------------------------- 262
                 +A        + +       +F +K L                           
Sbjct: 241 ITINGTNATGVATVTNEGLDAGTYTYDFTNKVLKNASGEIIGKSADDKTFVDLQGKTLFT 300

Query: 263 ----------------DGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQ 306
                           D          ++ +Q  +  +  +R+ LG  +  +      L 
Sbjct: 301 LGAAVTANTTFTIGGIDVTTQSAANAAITKLQSAIDTVSTERSKLGAYQNRLEHTINNLG 360

Query: 307 NKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKL 348
                +    S+   V+      + +      + +  +  ++
Sbjct: 361 TAAENLTAAESRIRDVDMAKEMMEFTKNNILNQAATAMLERM 402


>gi|59712470|ref|YP_205246.1| flagellin [Vibrio fischeri ES114]
 gi|46394807|gb|AAS91572.1| flagellin subunit D [Vibrio fischeri ES114]
 gi|59480571|gb|AAW86358.1| Flagellin FlaD [Vibrio fischeri ES114]
          Length = 375

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 42/365 (11%), Positives = 100/365 (27%), Gaps = 16/365 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  ++T+               D     E + +G   +      A +        +   
Sbjct: 1   MSINVNTNVSAMTAQRYLSNATNDLNSSMERLSSGLKINSAKDDAAGLQISNRLTSQTRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G   +         +    
Sbjct: 61  LDVAVRNANDGISMAQTAEGAMNETTNILQRMRDLSLQSANGSNTHADRTAIQEEVVALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K              + + M          +  A +
Sbjct: 121 DELNRIAETTSFGGSRLLNGQFGTKSFQIGSDSGEAVMLTLNNMRSDTTAMGGSTYSATE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +     + T+      D   +++    N     D        + +   V+A+V   
Sbjct: 181 GKDSNWKVGAENTELTMNFVDSKGEEQNITINAKAGDDIEEVATYINGQSDAVNASVTED 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT----------------DGARNVLTKKMLSTVQQGLSGII 285
           G   I   A       S +L+                D      ++K ++ +   +  + 
Sbjct: 241 GKLQIFAAADATDIEFSGSLSNELGMGNKVSDTVKSIDVTTVGGSQKAVAILDSAMQYVD 300

Query: 286 EQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMIT 345
             RA LG  +   N     L+N N  ++   S+   V+       ++      + S  I 
Sbjct: 301 SNRADLGAFQNRFNHAINNLENINENVNASNSQIKDVDFAKETTAMTKSQILQQASSSIL 360

Query: 346 TKLQK 350
            + ++
Sbjct: 361 AQAKQ 365


>gi|300722633|ref|YP_003711923.1| Flagellin [Xenorhabdus nematophila ATCC 19061]
 gi|139522466|gb|ABO77652.1| FliC [Xenorhabdus nematophila]
 gi|297629140|emb|CBJ89736.1| Flagellin [Xenorhabdus nematophila ATCC 19061]
          Length = 313

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 28/349 (8%), Positives = 78/349 (22%), Gaps = 46/349 (13%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
             + I+T+           +         E + +G   +      A       +      
Sbjct: 1   MASVINTNDSALLAQNNLTKSKGILGSAIERLSSGLRINSAKDDAAGQAIANRFTANVKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q +    V    G    +        +    
Sbjct: 61  LTQAARNANDGISIAQTTEGALNEINNNLQRIRELTVQSENGSNSKSDLDSIQKEVTQRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           E     +  T          + +E  +      +        ++    L     S++  +
Sbjct: 121 EEIDRISTQTQFNGIKVLNGDVTEMKIQVGANDNETIGIKLGKINSEKLNLKEFSVVEKE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            +        Q            +                                    
Sbjct: 181 AVAAKPAVPAQPAVPADPKNGVAAKPA--------------------------------- 207

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
                              +        T   L T+ + L+ + + R+ LG  +  +   
Sbjct: 208 -------------VPAQPEVKAQEAVKKTDNSLDTLDKALAQVDDMRSSLGAVQNRLEST 254

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              L N  N +    S+    +     + +S      +    +  +  +
Sbjct: 255 VNNLNNTVNNLSAARSRIEDADYAVEVSNMSRGQILQQAGTSVLAQANQ 303


>gi|117919779|ref|YP_868971.1| flagellar hook-associated protein FlgL [Shewanella sp. ANA-3]
 gi|117612111|gb|ABK47565.1| flagellar hook-associated protein 3 [Shewanella sp. ANA-3]
          Length = 403

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 50/405 (12%), Positives = 134/405 (33%), Gaps = 53/405 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +S++ IF +      +    + K+ E++ +G+  +           I    Q    + 
Sbjct: 1   MRLSSAQIFNQSITSVLQKQTATSKILEQLSSGKKVNTAGDDPVAALGIDNLNQRNALVD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +    T RL+ +++ L S + +   +   ++  + G   +++  + A  ++ S E 
Sbjct: 61  QFMKNIDYATNRLAVTESKLGSAENLASSIREQVMRAVNGTLADSERQMIADEMKGSLEE 120

Query: 124 FVTFANMTDEGQYL-FSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
            ++ AN  DE     FSG ++ ++P     +       S D  ++  L ++  +L     
Sbjct: 121 LLSIANSKDESGNYMFSGYSTDKEPFAFDNSTPPKIVYSGDSGIRNSLVQSGVALGTNVP 180

Query: 183 LEVS--------------------------------------------------SMNAQQ 192
            + +                                                       Q
Sbjct: 181 GDTAFMKAPNGLGDYSVNYLASQQGEFSVKTAKIADPATYLADTYTFNFSDNGSGGTNLQ 240

Query: 193 MTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVI 252
           + D         ++ +       N  + NI  +    +   +     +     I     +
Sbjct: 241 VLDSANNPVANIANFDAATPVSFNGIEVNISGKPSAGDSFTMEPQSEVSIFDTISRAIAL 300

Query: 253 GTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNII 312
             +  S N   G       ++L+ +  G++ I   R+V G + K +   +     +  + 
Sbjct: 301 IEDPNSANTPQGRSQ--LAQILNDIDSGVNQISSARSVAGNNLKAVESYKDTHIEEQVLN 358

Query: 313 DTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            + +S    ++  +A  + +     +     + +K+  +S+ +Y+
Sbjct: 359 TSALSLLEDLDYASAITEFAKQQLALNAVSSVFSKVGSVSLFDYI 403


>gi|254522599|ref|ZP_05134654.1| flagellar hook-associated protein 3 [Stenotrophomonas sp. SKA14]
 gi|219720190|gb|EED38715.1| flagellar hook-associated protein 3 [Stenotrophomonas sp. SKA14]
          Length = 400

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/397 (10%), Positives = 105/397 (26%), Gaps = 43/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            ++ ISTS +F +   L          L +++ TG              + +  ++    
Sbjct: 1   MSSRISTSMMFNQSVSLMMAKQAKLSHLEQQIATGSKIVSAKDDPVAAGAAVGLDRSLAA 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +     +   V  RL   +  L+ +  ++  +    +                  L    
Sbjct: 61  LDRMKLNAGNVQNRLGVQENTLAQVNDLMARVNDLTIQASNPALSAPDKKTLITELNQIR 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEEN-------- 173
           +  ++ AN  D       G  +   P         + +    Q       +         
Sbjct: 121 DGLLSLANADDGTGRYVFGGTNDGDPPFAKINGKVVYRGDQTQRQIEVGPDTYVRDALPG 180

Query: 174 -------SKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDH------ 220
                              +      +   I +      + + ++  ++ A  +      
Sbjct: 181 SEIFMRIPTGDGFVDGGAAAGNTGNGVLTNITRDGSDSWNGQAFSIRFTAADQYQVLDGA 240

Query: 221 ----------------------NIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLS 258
                                  I       +  +V+   +      +  +         
Sbjct: 241 GNVTGTGTYKAGDNVEVNGVRLQITGAPAAGDSFNVTPASSRDIFDTMDKLIAALDADTG 300

Query: 259 KNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISK 318
                 A+    +  L  V +    +I+ RA  G   K ++      +     + T +S+
Sbjct: 301 TTAKMSAQQNELQSALRDVARASERMIDSRAAGGAQLKALDNAADMREANGVTLKTTLSQ 360

Query: 319 SIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILN 355
              ++   A +Q       ++ +  I +++Q +S+ N
Sbjct: 361 MRDLDYADALSQYQLQSTALQAAQTIFSQMQSMSLFN 397


>gi|153834461|ref|ZP_01987128.1| polar flagellin E [Vibrio harveyi HY01]
 gi|148869157|gb|EDL68189.1| polar flagellin E [Vibrio harveyi HY01]
          Length = 374

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 25/364 (6%), Positives = 86/364 (23%), Gaps = 16/364 (4%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              ++T+              + +++    + +G   +      A +        +   +
Sbjct: 1   MVSLNTNVTAMMTQRHLSHAAEQNIESQRNLTSGYRINSASDDAAGLQISNTLNVQTRGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
              L +         T++  L     I+Q +    +    G  D++        +    +
Sbjct: 61  DVALRNAHDAYSVAQTAEGALHESSDILQRLRSLGLQAANGSNDSSDRQSIQYEVVALQD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                A  T          +   +  +     +S++    +             +     
Sbjct: 121 ELDRVAITTTFADKNLFDGSYGSQSFHIGANANSISLTLRNMRSHIPDMGGQHYVGDAVD 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
            +       Q      Q     S  E       +  +    Y       +  S   N   
Sbjct: 181 KDWRVTKDNQTLKLEYQNSKGQSQTESIRLKLGDRIEQVATYINAQQSIVSASVTENNEL 240

Query: 243 IRDIMFVAV----------------IGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIE 286
                 +                       ++ +  D +     +  +  +   +  +  
Sbjct: 241 QFFASTLNAPEGVELKGSLAHELDVTAGGLVTMDDIDMSTAGGAQLSIGVIDAAIKYVDS 300

Query: 287 QRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITT 346
            R+ +G  +  ++     L   N  +     +    +      ++       + +  +  
Sbjct: 301 HRSEIGGFQNRVSGTMDNLNTVNRSVTESKGRIRDTDFARESTEMVRSQVLQDATTALLA 360

Query: 347 KLQK 350
           + ++
Sbjct: 361 QAKQ 364


>gi|56965461|ref|YP_177193.1| flagellin protein [Bacillus clausii KSM-K16]
 gi|56911705|dbj|BAD66232.1| flagellin protein [Bacillus clausii KSM-K16]
          Length = 302

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 32/348 (9%), Positives = 86/348 (24%), Gaps = 57/348 (16%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +      +         + K  E++ +G   +      A ++   +   +   + 
Sbjct: 1   MIINNNLSAMNAHRQLGINQGAASKAQEKLSSGLRINRAGDDAAGLSISEKMRAQIRGLD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLE-GKTDNNKFPINAGMLRDSYE 122
           +   +       + T++  L     I+Q M   +V     G   +         +    E
Sbjct: 61  QASRNAQDGISLIQTAEGALDETHSILQRMRELVVQAGNTGTNQDEDLQAIQDEINSLKE 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                                                                  +    
Sbjct: 121 EI---------------------------------------------------GGMTDGS 129

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
             +S   A    D +K   D        +  +   ++      I+  +      +    G
Sbjct: 130 KGISDRTAFNGKDLLKGATDDAGASAPASFTFQIGANQGQTITIEIGDM-----SATALG 184

Query: 243 IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEER 302
                 + +   +       D          L+ V+  +  + +QR+ LG ++  +    
Sbjct: 185 TEGDDGLKISDIDVTKFADPDATDEEGFDTQLAAVENAIKQVSKQRSSLGAAQNRLEHTI 244

Query: 303 VFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
             L N +  +    S+   V+      + +      + S  +  +  +
Sbjct: 245 SNLDNSSENLQAAESRIRDVDMAKEIMEYTKSNILSQASQSMLAQANQ 292


>gi|194014726|ref|ZP_03053343.1| flagellin [Bacillus pumilus ATCC 7061]
 gi|194013752|gb|EDW23317.1| flagellin [Bacillus pumilus ATCC 7061]
          Length = 304

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/348 (10%), Positives = 82/348 (23%), Gaps = 55/348 (15%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +             N  S K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINHNIAALNTLNRLSANNASSQKNMEKLSSGLKINRAGDDAAGLAISEKMRGQIRGLE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLE-GKTDNNKFPINAGMLRDSYE 122
               +       +  ++  L+    I+Q +   +V     G  D+         ++   E
Sbjct: 61  MATKNAQDGISLIQIAEGALTETHSILQRVRELVVQAGNTGTQDDTDLGAIQEEIKALVE 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                A+                               S      G    +      G  
Sbjct: 121 EIGNGADK---------------------------NGISDRTEFNGKKLLDGSFSSTGTD 153

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
                + A         +E   +D             +     I  T+    +A+V   G
Sbjct: 154 SLTFQIGANGAQQLSVNIEAMSADKLGATLPDGTLVANQAVKDIDVTKFAANAADVADVG 213

Query: 243 IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEER 302
               + +                           V   +  +  QR+ LG  +  +    
Sbjct: 214 FDAQLGI---------------------------VDGAIKQVSTQRSKLGAVQNRLEHTI 246

Query: 303 VFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
             L      +    S+   V+     ++ +      + S  +  +  +
Sbjct: 247 NNLGASGENLTAAESRIRDVDMAKEMSEFTKNNILSQASQAMLAQANQ 294


>gi|197335551|ref|YP_002156688.1| A-type flagellin [Vibrio fischeri MJ11]
 gi|197317041|gb|ACH66488.1| A-type flagellin [Vibrio fischeri MJ11]
          Length = 375

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 42/365 (11%), Positives = 99/365 (27%), Gaps = 16/365 (4%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  ++T+               D     E + +G   +      A +        +   
Sbjct: 1   MSINVNTNVSAMTAQRYLSNATNDLNSSMERLSSGLKINSAKDDAAGLQISNRLTSQTRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  ++    I+Q M    +    G   +         +    
Sbjct: 61  LDVAVRNANDGISMAQTAEGAMNETTNILQRMRDLSLQSANGSNTHADRTAIQEEVVALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           K              + + M          +  A +
Sbjct: 121 DELNRIAETTSFGGSRLLNGQFGTKSFQIGSDSGEAVMLTLNNMRSDTTAMGGSTYSATE 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + +     + T+      D    ++    N     D        + +   V+A+V   
Sbjct: 181 GKDSNWKVGAENTELTMNFVDSKGKEQNITINAKAGDDIEEVATYINGQSDAVNASVTED 240

Query: 242 GIRDIMFVAVIGTEFLSKNLT----------------DGARNVLTKKMLSTVQQGLSGII 285
           G   I   A       S +L+                D      ++K ++ +   +  + 
Sbjct: 241 GKLQIFAAADATDIEFSGSLSNELGMGNKVSDTVKSIDVTSVGGSQKAVAILDSAMQYVD 300

Query: 286 EQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMIT 345
             RA LG  +   N     L+N N  ++   S+   V+       ++      + S  I 
Sbjct: 301 SNRADLGAFQNRFNHAINNLENINENVNASNSQIKDVDFAKETTAMTKSQILQQASSSIL 360

Query: 346 TKLQK 350
            + ++
Sbjct: 361 AQAKQ 365


>gi|149188076|ref|ZP_01866371.1| flagellin [Vibrio shilonii AK1]
 gi|148838064|gb|EDL55006.1| flagellin [Vibrio shilonii AK1]
          Length = 382

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 41/372 (11%), Positives = 94/372 (25%), Gaps = 23/372 (6%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++T+              +++ K  E + +G   +      A +        +   
Sbjct: 1   MAINVNTNVSAMTAQRYLNNAAENTQKSMERLSSGYKINSAKDDAAGLQIANRLNVQSRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +       T++  +     I+Q M    +    G     +       +    
Sbjct: 61  LDMAVKNANDGISIAQTAEGAMDETTNILQRMRDLSLQSANGSNSKAERVAIQEEVTALN 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     A  T  G           +              S + M     +    S  A  
Sbjct: 121 DELNRIAETTSFGGNRLLNGTYGTQSFQIGSNSGEAVMLSMNDMRSDNAQMGGSSYKAAN 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
             + S       T  I   +   +     A       D        + +   V A+V+  
Sbjct: 181 AKDESWTVGAGATLTIDLNDKAGNAMTQIAITGKEGDDIEQLATYINGQTDQVQASVDED 240

Query: 242 GIRDIMFVAVIGTEFL-----------------------SKNLTDGARNVLTKKMLSTVQ 278
           G   I   +    +                         S N  +       ++ ++ + 
Sbjct: 241 GALQIFASSNGEADSASLTFGGSLAGGSELDLSGAASAVSVNDINVTSVGGAQESVAILD 300

Query: 279 QGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKI 338
             L  +   RA LG  +   N     L N N  ++   S+    +       ++      
Sbjct: 301 AALKYVDSNRAELGAFQNRFNHAINNLDNINENVNASKSRIEDTDYAKETTAMTKNQILQ 360

Query: 339 EMSYMITTKLQK 350
           + S  I  + ++
Sbjct: 361 QASTSILAQAKQ 372


>gi|116489820|gb|ABJ98817.1| phase I flagellin middle domain variant C12 [Salmonella enterica
           subsp. enterica serovar Typhimurium]
          Length = 386

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 38/376 (10%), Positives = 90/376 (23%), Gaps = 27/376 (7%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+         +         E + +G   +      A       +      
Sbjct: 1   MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANRFTANIKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  L+ +   +Q +    V         +        +    
Sbjct: 61  LTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 +  T          +++     G    +++         Q    +        +
Sbjct: 121 NEIDRVSGQTQFNGVKVLAQDNTLTIQVGANDGETIDIDLKQINSQTLGLDTLNVQQKYK 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYW---------------------------ANNW 214
             + ++         I      F                                     
Sbjct: 181 VSDTAATVTGYADTTIALDNSTFKASATGLGGTDQKIDGDDDYYSATQNKDGSISINTTK 240

Query: 215 SNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKML 274
             A D   K  +    G D    V   G +        G  F ++     A    T+  L
Sbjct: 241 YTADDGTSKTALNKLGGADGKTEVVSIGGKTYAASKAEGHNFKAQPDLAEAAATTTENPL 300

Query: 275 STVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTL 334
             +   L+ +   R+ LG  +   N     L N  N + +  S+    +  T  + +S  
Sbjct: 301 QKIDAALAQVDTLRSDLGAVQNRFNSAITNLGNTVNNLTSARSRIEDSDYATEVSNMSRA 360

Query: 335 INKIEMSYMITTKLQK 350
               +    +  +  +
Sbjct: 361 QILQQAGTSVLAQANQ 376


>gi|120598239|ref|YP_962813.1| flagellar hook-associated protein FlgL [Shewanella sp. W3-18-1]
 gi|120558332|gb|ABM24259.1| flagellar hook-associated protein 3 [Shewanella sp. W3-18-1]
          Length = 403

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 46/405 (11%), Positives = 129/405 (31%), Gaps = 53/405 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +S++ IF +      +    + K+ E++ +G+  +           I    Q    + 
Sbjct: 1   MRLSSAQIFNQSITSVLQKQTATSKILEQLSSGKKVNTAGDDPVAALGIDNLNQRNALVD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +    T RL+ +++ L S + +   +   ++  + G   +++  + A  ++ S E 
Sbjct: 61  QFMKNIDYATNRLAVTESKLGSAENLASSIREQVMRAVNGTLADSERQMIADEMKGSLEE 120

Query: 124 FVTFANMTDEGQYL-FSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
            ++ AN  DE     FSG ++ ++P     +       S D  ++  L +   +L     
Sbjct: 121 LLSIANSKDESGNYMFSGYSTDKEPFAFDNSTPPQIVYSGDSGVRNSLVQTGVALGTNVP 180

Query: 183 LEVS--------------------------------------------------SMNAQQ 192
            + +                                                       Q
Sbjct: 181 GDTAFMKAPNGLGDYSVNYLASQQGEFSVKAAKIADTSTYLADTYTFNFTDNGVGGTNLQ 240

Query: 193 MTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVI 252
           + D         ++ +       N  +  +  +    +   +     +     I     +
Sbjct: 241 VLDSANNPVANVTNFDATTPVSFNGIEVKVSGKPSAGDSFTMEPQAEVSIFDTISSAIAL 300

Query: 253 GTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNII 312
             +  S             ++L+ +  G++ I   R+V G + K +   +     +  + 
Sbjct: 301 IEDPNS--ANTPQGRAQLAQILNDIDSGVNQISSARSVAGNNLKAVESYKDTHIEEQVLN 358

Query: 313 DTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            + +S    ++  +A  +       +     + +K+  +S+ +Y+
Sbjct: 359 TSALSLLEDLDYASAITEFEKQQLALNAVSSVFSKVGSVSLFDYI 403


>gi|190574256|ref|YP_001972101.1| flagellar hook-associated protein FlgL [Stenotrophomonas
           maltophilia K279a]
 gi|190012178|emb|CAQ45801.1| putative flagellar hook-associated protein [Stenotrophomonas
           maltophilia K279a]
          Length = 400

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 42/397 (10%), Positives = 107/397 (26%), Gaps = 43/397 (10%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            ++ ISTS +F +   L          L +++ TG              + +  ++    
Sbjct: 1   MSSRISTSMMFNQSVSLMMAKQAKLSHLEQQIATGSKIVSAKDDPVAAGAAVGLDRSLAA 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +     +   V  RL   +  L+ +  ++  +    +                  L    
Sbjct: 61  LDRMKLNAGNVQNRLGVQENTLAQVNDLMARVNDLTIQASNPALGAADKKTLITELNQIR 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEEN-------- 173
           E  ++ AN  D       G  +   P         + +    Q       +         
Sbjct: 121 EGLLSLANADDGTGRYVFGGTNDGDPPFAKINGKVVYRGDQTQRQIEVGPDTYVRDALPG 180

Query: 174 -------SKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDH------ 220
                           +  +S     +   I +      + + ++  ++ A  +      
Sbjct: 181 SEIFMRIPTGDGFVDGVAAASNTGNGVLTNITRDGSDSWNGQSFSIRFTAADQYQVLDGA 240

Query: 221 ----------------------NIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLS 258
                                  I       +  +V    +      +  +         
Sbjct: 241 GNVTGTGTFKAGDNVEVNGVRLQITGAPAAGDSFNVKPATSRDIFDTMDKLIAALDADTG 300

Query: 259 KNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISK 318
                 A+    +  L  V +    +I+ RA  G   K ++      +  +  + T +S+
Sbjct: 301 TTAKMSAQQNELQSALRDVARASERMIDSRAAGGAQLKALDNAADMREANSVTLKTTLSQ 360

Query: 319 SIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILN 355
              ++   A +Q       ++ +  I +++Q +S+ N
Sbjct: 361 MRDLDYADALSQYQLQSTALQAAQTIFSQMQSMSLFN 397


>gi|56383041|emb|CAE53942.1| flagellin [Escherichia coli]
          Length = 349

 Score =  133 bits (333), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 35/349 (10%), Positives = 87/349 (24%), Gaps = 11/349 (3%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+         +         E + +G   +      A       +      
Sbjct: 1   MAQVINTNSLSLITQNNINKNQSALSTSIERLSSGLRINSAKDDAAGQAIANRFTSNIKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  LS +   +Q +    V    G   ++        ++   
Sbjct: 61  LTQAARNANDGISLAQTAEGALSEINNNLQRIRELTVQASTGTNSDSDLSSIQDEIKSRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  T          N   K   G    ++++             +         
Sbjct: 121 DEIDRVSGQTQFNGVNVLSKNDLMKIQIGANDNETISIGLQQIDSTTLNLKGFTVSGMAD 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   A         ++D         +    AS+               +   +  
Sbjct: 181 FSAAKLTAADGTAIAAADVKDAEGKQVNLLSYTDTASNSTK-----------YAVVDSAT 229

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
           G      VA+  T               T   L  +   ++ + + R+ LG  +  ++  
Sbjct: 230 GKYMKATVAITNTAAEVTVGPAEVAGAATADPLKALDAAIAKVDKFRSSLGAVQNRLDSA 289

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              L N    +    S+    +  T  + +S      +    +  K  +
Sbjct: 290 VTNLNNTTTNLSEAQSRIQDADYATEVSNMSKAQIIQQAGNSVLAKANQ 338


>gi|28897565|ref|NP_797170.1| flagellin [Vibrio parahaemolyticus RIMD 2210633]
 gi|260364622|ref|ZP_05777224.1| polar flagellin E [Vibrio parahaemolyticus K5030]
 gi|260878273|ref|ZP_05890628.1| polar flagellin E [Vibrio parahaemolyticus AN-5034]
 gi|260898103|ref|ZP_05906599.1| polar flagellin E [Vibrio parahaemolyticus Peru-466]
 gi|29840875|sp|Q9ZBA2|FLAE_VIBPA RecName: Full=Polar flagellin E
 gi|28805777|dbj|BAC59054.1| polar flagellin FlaE [Vibrio parahaemolyticus RIMD 2210633]
 gi|308086106|gb|EFO35801.1| polar flagellin E [Vibrio parahaemolyticus Peru-466]
 gi|308090116|gb|EFO39811.1| polar flagellin E [Vibrio parahaemolyticus AN-5034]
 gi|308115112|gb|EFO52652.1| polar flagellin E [Vibrio parahaemolyticus K5030]
          Length = 374

 Score =  133 bits (333), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 28/364 (7%), Positives = 90/364 (24%), Gaps = 16/364 (4%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              ++T+           +    +V+    + +G   +      A +        +   I
Sbjct: 1   MVSLNTNVAAMMTQRHLSQAADQNVESQRNLSSGYRINSASDDAAGLQISNTLHVQTRGI 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
              L +         T++  L     I+Q +    +    G  + +        +    +
Sbjct: 61  DVALRNAHDAYSVAQTAEGALHESSDILQRLRSLGLQAANGSHEQDDRKSLQQEVIALQD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                A  T          +   +  +     +S++    +             L     
Sbjct: 121 ELDRVAITTTFADKNLFNGSYGSQSFHIGANANSISLALRNMRTHIPEMGGQHYLGDSLD 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR- 241
            +       Q   F  Q  +  +  +       +  +    Y       +D S   + + 
Sbjct: 181 KDWRVTRDNQQFAFEYQDNEGQAQSKVLTLKVGDNLEEVATYINAQQSVVDASVTQDHQL 240

Query: 242 ---------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIE 286
                                 + +   E ++ +  D +     +  +  V   +  +  
Sbjct: 241 QFFTSTLNAPEGITWKGNFADEMDIGSGELVTVDDLDMSTVGGAQLAIGVVDAAIKYVDS 300

Query: 287 QRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITT 346
            R+ +G  +  ++     L   N  +     +    +       +       + +  +  
Sbjct: 301 HRSEIGGFQNRVSGTIDNLNTINRSVSESKGRIRDTDFARESTVMVRSQVLQDATTALLA 360

Query: 347 KLQK 350
           + ++
Sbjct: 361 QAKQ 364


>gi|229069311|ref|ZP_04202601.1| Flagellin [Bacillus cereus F65185]
 gi|228713798|gb|EEL65683.1| Flagellin [Bacillus cereus F65185]
          Length = 370

 Score =  133 bits (333), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 30/360 (8%), Positives = 97/360 (26%), Gaps = 13/360 (3%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +         ++ + 
Sbjct: 1   MRINTNINSLRTQEYMRQNQSKMSNSMDRLSSGKRINNASDDAAGLAIATRMRARESGLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       + T+ + ++S+  I+  M         G   ++          +  + 
Sbjct: 61  VAANNTQDGMSLIRTADSAMNSVSNILLRMRDIANQSANGTNTDSNKSALQKEFDELQKQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A+ T          +S  K      +          + +        K  +     
Sbjct: 121 ITYIADNTQFNDKNLLKEDSEVKIQTLDSSSSEQQIGINLKAVTLEKLGIDKISIGAVAG 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSAN------ 237
                     T   +   D  ++        S  +D              + +       
Sbjct: 181 GTGGTGGTGGTKIEQTDIDAVTNGIGALTKDSKDTDITAIKDAFAKIKGGMDSTEAKAID 240

Query: 238 -------VNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAV 290
                          +  +            TD A      + +  + + L+ + + RA 
Sbjct: 241 DALGKFKEGTATAATVKEITDALKGATLPKATDAAEKDNALEAVKAIDKALTTVADNRAT 300

Query: 291 LGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
           LG +   ++     L+++++ + +  S+    +     ++++      E    + ++  +
Sbjct: 301 LGATLNRLDFNVNNLKSQSSSMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQ 360


>gi|152985351|ref|YP_001349632.1| A-type flagellin [Pseudomonas aeruginosa PA7]
 gi|3386642|gb|AAC28556.1| flagellin [Pseudomonas aeruginosa]
 gi|150960509|gb|ABR82534.1| A-type flagellin [Pseudomonas aeruginosa PA7]
          Length = 387

 Score =  133 bits (333), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 35/374 (9%), Positives = 90/374 (24%), Gaps = 28/374 (7%)

Query: 6   ISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAER 65
           ++T+             +       + + TG   +      A +        + N +   
Sbjct: 5   VNTNIASLNTQRNLNNSSASLNTSLQRLSTGSRINSAKDDAAGLQIANRLTSQVNGLNVA 64

Query: 66  LHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFV 125
             + +       T++  L     I+Q M    +    G   +++     G ++   +   
Sbjct: 65  TKNANDGISLAQTAEGALQQSTNILQRMRDLSLQSANGSNSDSERTALNGEVKQLQKELD 124

Query: 126 TFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEV 185
             +N T  G       +            + +     D+M    L         G  +  
Sbjct: 125 RISNTTTFGGRKLLDGSFGVASFQVGSAANEIISVGIDEMSAESLNGTYFKADGGGAVTA 184

Query: 186 SSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR---- 241
           ++ +               +       N +            +   + + A  +      
Sbjct: 185 ATASGTVDIALGITGGSTVNVKVDMKGNETAEQAAAKIAAAVNDANVGIGAFSDGDTISY 244

Query: 242 ------------------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTV 277
                                   G       +       +    D +     +  +  +
Sbjct: 245 VSKASADGTTSAVSGVVITDTGSTGAGAAASTSTFTEANDTVAKIDISTAKGAQSAVLVI 304

Query: 278 QQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINK 337
            + +  I  QRA LG  +   +     L+N    +     +    +     A L+     
Sbjct: 305 DEAIKQIDAQRADLGAVQNRFDNTINNLKNIGENVSAARGRIEDTDFAAETANLTKNQVL 364

Query: 338 IEMSYMITTKLQKL 351
            +    I  +  +L
Sbjct: 365 QQAGTAILAQANQL 378


>gi|189164096|gb|ABU96037.2| flagellin [Bacillus thuringiensis serovar kenyae]
          Length = 367

 Score =  133 bits (333), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 37/357 (10%), Positives = 91/357 (25%), Gaps = 10/357 (2%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +         +  + 
Sbjct: 1   MRINTNINSMRTQEYMRQNQAKMSNSMDRLSSGKRINNASDDAAGLAIATRMRSREGGLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               +       + T+ + L+S+  I+  M         G   +              E 
Sbjct: 61  VAARNTEDGMSLIRTADSALNSVSNILLRMRDLANQSASGTNTDKNQAAMQKEFDQLKEQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQG----------FLEEN 173
               A+ T+         ++S   +    + D   + +                      
Sbjct: 121 IQYIADNTEFNDKKLLDGSNSTINIQALDSHDKNKQITISLDSASLKNLDIKDLAIGSAT 180

Query: 174 SKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGID 233
                           A   TD     +D       +    S  +   +       +  D
Sbjct: 181 INQTDLDTATNSMKRLATPATDGKVLAQDIADAKAAFNKVQSAYTPAEVDKIQDAFKAYD 240

Query: 234 VSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGI 293
             A        DI   A           T  A        +  + + +  I   RA LG 
Sbjct: 241 KLAADPASKDTDIADAAKNVNTVFGTLATPTATKFDPSSAVEKIDKAIETIASSRATLGA 300

Query: 294 SEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
           +   ++     L+++ N +    S+    +     ++++      E    + ++  +
Sbjct: 301 TLNRLDFNVTNLKSQENSMAASASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQ 357


>gi|91792671|ref|YP_562322.1| flagellar hook-associated protein FlgL [Shewanella denitrificans
           OS217]
 gi|91714673|gb|ABE54599.1| flagellin-like protein [Shewanella denitrificans OS217]
          Length = 400

 Score =  132 bits (332), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 39/400 (9%), Positives = 109/400 (27%), Gaps = 46/400 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST  +F++           + K  +++ +G+  +          +I    Q+   ++
Sbjct: 1   MRISTGQMFQQNTKSILNNQSAANKTLQQLASGKRVNTAGDDPVASIAIDNLSQKNVQVS 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +       LS +++ L S   ++  M G  +  + G        I A  ++ + + 
Sbjct: 61  QYIKNIDYAKNHLSIAESKLGSADSLMTTMRGQFLQGINGSLTAADRQIIADEMKSNLKE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +  AN  DE                 + T  ++            +    +  +     
Sbjct: 121 LLAIANSQDESGNYLFSGFKINSKPFAFDTSGAMVYSGDSGQRTSNVSTQVQIGINAPGD 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDT-------------- 229
                    M D+          D    +    ++  ++                     
Sbjct: 181 SAFMKAPNAMGDYGVNYLASQQGDFTVDSAKIVSAGSHVPDTYTFNFIPNAPGVDLQVLN 240

Query: 230 ---------EGIDVSANVNMRGIRDIMFVAVIGTEFLSKN-------------------- 260
                       D +  VN  GI   +    +  +  +                      
Sbjct: 241 SSAAIVATVVNFDANTPVNFNGIEVKLSGIPVSGDSFTMQPLNEVSIFDSLNQAITLLED 300

Query: 261 ---LTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYIS 317
                         ++L+ +  G + +   R+  G   K++         +  +  + +S
Sbjct: 301 PSAANSPQGKSKLAQLLNDIDSGQNQVSIARSNTGTGLKSLESISASHDEEQIVNQSALS 360

Query: 318 KSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
               ++   A  +       +     + +K+   S+ +++
Sbjct: 361 LLEDLDYSAAITEYEKQKLALNAVSSVFSKVGSTSLFDFI 400


>gi|189164081|gb|ABU96033.2| flagellin [Bacillus thuringiensis serovar sotto]
 gi|189164085|gb|ABU96034.2| flagellin [Bacillus thuringiensis serovar sotto]
 gi|189164089|gb|ABU96035.2| flagellin [Bacillus thuringiensis serovar sotto]
 gi|189339452|gb|ABD33723.2| flagellin [Bacillus thuringiensis serovar sotto]
          Length = 367

 Score =  132 bits (332), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 33/357 (9%), Positives = 93/357 (26%), Gaps = 10/357 (2%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +         +  + 
Sbjct: 1   MRINTNINSMRTQEYMRQNQTKMSNAMDRLSSGKRINNASDDAAGLAIATRMRSREGGLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               +       + T+ + L+S+  I+  M             +              E 
Sbjct: 61  VAARNTEDGMSLIRTADSALNSVSNILLRMRDLANQSASETNTSKNQAAMQKEFDQLKEQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A+ T+         ++S   +    + D   + +           +   L  G + 
Sbjct: 121 IQYIADNTEFNDKKLLDGSNSTINIQTLDSHDKNKQITISLDSASLKNLDITDLAIGSNT 180

Query: 184 EVSSMNA----------QQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGID 233
              +                 D   Q +D       +    S  +   ++      +  D
Sbjct: 181 VNKNDLDTLNNSMKRLETAAADAAVQAQDVTDAKNAFNKVKSGYTPAEVEKMEDAFKAYD 240

Query: 234 VSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGI 293
                  +    +   A              A        +  + + +  I   RA LG 
Sbjct: 241 KVVADPAKTDALLKAAAEKINTEFKTLTAPTATAFDPSSSVEKIDKAIETIASSRATLGA 300

Query: 294 SEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
           +   ++     L+++ N +    S+    +     ++++      E    + ++  +
Sbjct: 301 TLNRLDFNVTNLKSQENSMAASASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQ 357


>gi|269103182|ref|ZP_06155879.1| flagellar hook-associated protein FlgL [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268163080|gb|EEZ41576.1| flagellar hook-associated protein FlgL [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 412

 Score =  132 bits (332), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 42/412 (10%), Positives = 109/412 (26%), Gaps = 57/412 (13%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
            + IST S +  +              + ++ TG+  D          SI  ++Q+   I
Sbjct: 1   MSRISTLSQYNNLTSNLMRKQTQLSHTNNQLATGKRVDTSGDDPVSSISIQNYKQQLTQI 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
            +   + +L   RL   + +++ ++  +      ++ +L G    N        L+  Y+
Sbjct: 61  GQYKDAITLANNRLGVLETNIAGVEDNLDVTKQKVLGMLNGAMAANDRKAFKDELQSLYD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
             ++ AN  DE        N  +             +              +        
Sbjct: 121 GLLSLANSKDEAGNYIFAGNQMDTKPFIEKDGYMTYQGDSQSRQTQIDSNMNVKTSLPGD 180

Query: 183 L--------------EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKD 228
                            + +        +      FS  +    ++S+            
Sbjct: 181 QVFMDIPNPYGDFRPNFAGLTEGSKAHVLSADISDFSKAKAIQVSFSDGGTTAGPNGETV 240

Query: 229 TEGIDVSANVNMRGIRDI------------------------------------------ 246
                  +      ++D                                           
Sbjct: 241 KVTNYSLSIDGTEVVKDQPYDPEKGIEYTGSTAGDPTLNLKFAEMQDGDTITLQPAQSFN 300

Query: 247 -MFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFL 305
                     +     +        ++++  +  G   + +QR+ +G   K +  ++   
Sbjct: 301 IFDSIQAAITYADAPTSSPEAQANLQRVIDDLDAGFVHMNQQRSEVGSIMKQVERQQEQH 360

Query: 306 QNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            +    ++T       ++  +A   L+     ++ S    ++ + LS+ NYL
Sbjct: 361 LDFELTLNTAHGGLEDLDYSSAVLDLNQQAMALQASQAAFSQTKNLSLFNYL 412


>gi|299536004|ref|ZP_07049323.1| flagellin domain protein [Lysinibacillus fusiformis ZC1]
 gi|298728609|gb|EFI69165.1| flagellin domain protein [Lysinibacillus fusiformis ZC1]
          Length = 418

 Score =  132 bits (331), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 29/408 (7%), Positives = 90/408 (22%), Gaps = 61/408 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I  +      +      N  + K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MRIQHNISALNAHRNLGFNNTQASKNLEKLSSGFKINRAGDDAAGLAISEKMRGQIRGLD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               ++      + T++  L+    I+Q M    V        N         +    E 
Sbjct: 61  MATKNSQDAISLIQTAEGALNETHSILQRMRELSVQSSSDTNVNLDRDAIQQEITQLTEE 120

Query: 124 FVTFANMTD-------------------EGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQ 164
               +  T+                                          +   K    
Sbjct: 121 LDRISETTEFNTQKLLDGSFSGTFQIGANEGQELKMDIDKMGAAALGLVNTTTLGKDAVN 180

Query: 165 MLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKY 224
                   +    +     ++      ++ +    +    +   Y   N +  +   +  
Sbjct: 181 TTTNSNLADGTYKINTAGTKLLDSKGNEVGNVAAGVITANNGATYKFTNATGLTGGTLTI 240

Query: 225 RIKDTEGIDVSANVNMR------------------------------------------G 242
           +           +V+ +                                           
Sbjct: 241 KDGKGTAQTTLNSVSSKLSAGKYEIVDGKVVKDNKIVGEVTTTAGTYKIKVGNEDVEFKN 300

Query: 243 IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEER 302
               +  A+        N    +        ++ +   L+ + EQR+ LG  +  +    
Sbjct: 301 TDLNLAAALADGTSFEINGVSVSTREQASGTITKIDDALTKVSEQRSALGAVQNRLEHTI 360

Query: 303 VFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
             L   +  +    S+    +      + +     ++ +  +  +  +
Sbjct: 361 NNLGAASENLTAAESRIRDTDMAKEMMEFTKNNILMQAAQSMLAQANQ 408


>gi|254522991|ref|ZP_05135046.1| flagellar protein [Stenotrophomonas sp. SKA14]
 gi|219720582|gb|EED39107.1| flagellar protein [Stenotrophomonas sp. SKA14]
          Length = 392

 Score =  132 bits (331), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 28/382 (7%), Positives = 78/382 (20%), Gaps = 33/382 (8%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+++                   + + +G   +      A +     +  +   
Sbjct: 1   MAQVINTNTMSLNAQRNLSTSGSSLATTIQRLSSGSRINSAKDDAAGLAISERFGTQIRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
               + + +        ++  L+ +   +Q +    V         +        +    
Sbjct: 61  TDVAIRNANDGISLAQVAEGSLTEIGNNLQRVRELSVQASNATNSASDRKALQAEVTQLV 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 A  +D         + S +                    +      +       
Sbjct: 121 SEIDRVAKQSDFNGTKLLDGSFSSQLFQVGANAGQSIAIDKTIDAKAGSLGTATFATGDT 180

Query: 182 HLEVSSM---------------------------------NAQQMTDFIKQLEDKFSDDE 208
               +S                                   A         +  + + D 
Sbjct: 181 AALTASTDGARFSGKVMGVDIGTVEVKAGATTADASKAVATAINAKIGEAGIYAEANSDG 240

Query: 209 YWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNV 268
               +            I        +                      +    D +  +
Sbjct: 241 TLKLSSVKEGKAVATADIALMRSDYDATAKTWGTAAAAGAYTAGTDTSANVQKLDVSTVL 300

Query: 269 LTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAH 328
             ++ L  V + L  I   RA LG  +         LQ  +  +    S+    +     
Sbjct: 301 GAQQALEVVDKALGAINSTRADLGAIQNRFTSVVANLQTSSENLSASRSRIKDTDFAKET 360

Query: 329 AQLSTLINKIEMSYMITTKLQK 350
           A+L+      +    +  +  +
Sbjct: 361 AELTRTQILQQAGTAMLAQANQ 382


>gi|153840356|ref|ZP_01993023.1| polar flagellin E [Vibrio parahaemolyticus AQ3810]
 gi|149745981|gb|EDM57111.1| polar flagellin E [Vibrio parahaemolyticus AQ3810]
          Length = 374

 Score =  132 bits (331), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 27/364 (7%), Positives = 90/364 (24%), Gaps = 16/364 (4%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              ++T+           +    +V+    + +G   +      A +        +   I
Sbjct: 1   MVSLNTNVAAMMTQRHLSQAADQNVESQRNLSSGYRINSASDDAAGLQISNTLHVQTRGI 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
              L +         T++  L     I+Q +    +    G  + +        +    +
Sbjct: 61  DVALRNAHDAYSVAQTAEGALHESSDILQRLRSLGLQAANGSHEQDDRTSLQQEVIALQD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                A  T          +   +  +     +S++    +             L     
Sbjct: 121 ELDRVAITTTFADKNLFNGSYGSQSFHIGANANSISLTLRNMRTHIPEMGGQHYLGDSLD 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR- 241
            +       Q   F  +  +  +  +       +  +    Y       +D S   + + 
Sbjct: 181 KDWRVTRDNQQFAFEYRDNEGQAQSKALTLKVGDNLEEVATYINAQQSVVDASVTQDHQL 240

Query: 242 ---------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIE 286
                                 + +   E ++ +  D +     +  +  V   +  +  
Sbjct: 241 QFFTSTLNAPEGVTWKGNFADEMDIGSGELVTVDDLDMSTVGGAQLAIGVVDAAIKYVDS 300

Query: 287 QRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITT 346
            R+ +G  +  ++     L   N  +     +    +       +       + +  +  
Sbjct: 301 HRSEIGGFQNRVSGTIDNLNTINRSVSESKGRIRDTDFARESTVMVRSQVLQDATTALLA 360

Query: 347 KLQK 350
           + ++
Sbjct: 361 QAKQ 364


>gi|308175268|ref|YP_003921973.1| flagellin protein [Bacillus amyloliquefaciens DSM 7]
 gi|307608132|emb|CBI44503.1| flagellin protein [Bacillus amyloliquefaciens DSM 7]
          Length = 328

 Score =  132 bits (331), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 28/346 (8%), Positives = 89/346 (25%), Gaps = 30/346 (8%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +      +      +  + K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINHNIAALNTSRQLNAGSNAASKNMEKLSSGLRINRAGDDAAGLAISEKMRSQIRGLD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               +       + TS+  L+    I+Q M             ++        +      
Sbjct: 61  MASKNAQDGISLIQTSEGALNETHSILQRMSELATQAANDTNTDSDRSELQKEMDQLASE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               +  T+          + +        +      S ++M    L+  +         
Sbjct: 121 VTRISTDTEFNTKKLLDGTAKDLTFQIGANEGQTMSLSINKMDSESLQVGTTYTANTDGS 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           ++ + + ++ T      +      +        A                          
Sbjct: 181 KLVTADGKEATLVTDGSKGPNGYYDTDDKLVYQADSALAA-------------------- 220

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                        ++K +   +        L+T++  +  +  +RA LG  +  +     
Sbjct: 221 ----------DTKVTKGIDISSSAKAASSALTTIKTAIDTVSSERAKLGAVQNRLEHTIN 270

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQ 349
            L   +  + +  S+   V+  +   + +      + S  +  +  
Sbjct: 271 NLGTSSENLTSAESRIRDVDMASEMMEYTKNNILTQASQAMLAQAN 316


>gi|2829686|sp|P80583|FLA_CLOTY RecName: Full=Flagellin
 gi|5019447|emb|CAB44444.1| flagellin [Clostridium tyrobutyricum]
          Length = 377

 Score =  132 bits (331), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 36/376 (9%), Positives = 95/376 (25%), Gaps = 27/376 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ + +           + ++ K  E++ +G   +      A +    +   + N + 
Sbjct: 1   MIINHNLMANNALRNMNVNSNNASKAMEKLSSGLRINRAGDDAAGLAISEKMRGQINGLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  L+    I+Q M    V                  +    + 
Sbjct: 61  QASSNAQDSISLIQTAEGALNETHSILQRMRTLAVQSSNDTNTTTDRSAIQDEVNQLTDE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               AN T+         +                  S +  L       S + +A    
Sbjct: 121 IDRIANTTEFNTQKLLDGSKVGLVDAKDADASVQLNTSANISLASNFSTTSATGIADSFT 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKY------------------- 224
              +             +   +          ++S                         
Sbjct: 181 VTITRTHGTAGATFASTDYDVALVGGTELIEHSSSSLTYDTKAINLVGMIKCFSIRTNDT 240

Query: 225 --------RIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLST 276
                    +K       +   NM    + M    IG    S    D +        ++ 
Sbjct: 241 IRKVSHVRTVKALSMQIGAIVTNMLIGINSMKATDIGVRNTSGKALDISTASKATGAITQ 300

Query: 277 VQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLIN 336
           +   +  +  QR+ LG  +  +      L   +  + +  S+   V+  +  ++ S    
Sbjct: 301 INNAIETVSTQRSKLGAYQNRLEHTINNLGTSSENLTSAESRIRDVDMASEMSEYSKNNI 360

Query: 337 KIEMSYMITTKLQKLS 352
             + +  +  +  + +
Sbjct: 361 LSQTAQAMLAQANQQT 376


>gi|4204100|gb|AAD10273.1| polar flagellin [Vibrio parahaemolyticus]
          Length = 374

 Score =  132 bits (331), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 30/364 (8%), Positives = 93/364 (25%), Gaps = 16/364 (4%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              ++T+           +    +V+    + +G   +      A +        +   I
Sbjct: 1   MVSLNTNVAAMMTQRHLSQAADQNVESQRNLSSGYRINSASDDAAGLQISNTLHVQTRGI 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
              L +         T++  L     I+Q +    +    G  + +        +    +
Sbjct: 61  DVALRNAHDAYSVAQTAEGALHESSDILQRLRSLGLQAANGSHEQDDRTSLQQEVIALQD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                A  T          +   +  +     +S++    +             L     
Sbjct: 121 ELDRVAITTTFADKNLFNGSYGSQSFHIGANANSISLTLRNMRTHIPEMGGQHYLGDSLD 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR- 241
            +       Q   F  Q  +  +  E       ++ +    Y       +D S   + + 
Sbjct: 181 KDWRVTRDNQQFAFEYQDNEGQTQSEALTLKVGDSLEEVATYINAQQSVVDASVTQDHQL 240

Query: 242 ---------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIE 286
                                 + +   E ++ +  D +     +  +S V   +  +  
Sbjct: 241 QFFTSTLNAPEGVTWKGNFADEMDIGSGELVTVDDLDMSTVRGAQLAISVVDAAIKYVDS 300

Query: 287 QRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITT 346
            R+ +G  +  ++     L   N  +     +    +      ++       + +  +  
Sbjct: 301 HRSEIGGFQNRVSGTIDNLNTINRSVLESKGRIRDTDFARESTEMVRSQVLQDATTALLA 360

Query: 347 KLQK 350
           + ++
Sbjct: 361 QAKQ 364


>gi|121535543|ref|ZP_01667351.1| flagellin domain protein [Thermosinus carboxydivorans Nor1]
 gi|121305871|gb|EAX46805.1| flagellin domain protein [Thermosinus carboxydivorans Nor1]
          Length = 415

 Score =  132 bits (331), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 35/392 (8%), Positives = 90/392 (22%), Gaps = 58/392 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +             N ++ K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MIINHNMSALNTYRQLSINNANTSKSLEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  L+    I+Q M    V         +        +    + 
Sbjct: 61  QAARNAQDGISLIQTAEGALNETHSILQRMRELAVQAASDTNTASDRSELQKEVDQLAQE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEEN---------- 173
                N T            +     G     +L     D                    
Sbjct: 121 IGRIGNTTQFNTQKLLDGKFNGTFHIGANENQTLTLSINDMRSYNLGVTGDVTIKETGTL 180

Query: 174 --SKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEG 231
                      +  ++    Q+ D    +    +D + + N             +   + 
Sbjct: 181 AAGDFADGTYTVAKANDGTYQLLDVTGNIVATSTDAKTYKNVLDTTKTITFTNTVTSGKV 240

Query: 232 IDVSANVNMRGIR----------------------------------------------D 245
           I    N +                                                   D
Sbjct: 241 IVSGTNADAEATVATANSGLEAGTYTYDATNKVLKDAGGNVVAVSSDGTKFTVGGTNVLD 300

Query: 246 IMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFL 305
           +   A+   + +  +  D        K ++T+++ L  + ++RA +G  +  +      L
Sbjct: 301 LGSNALADGDTVVIHGVDITSRDAANKAITTIEKALEIVSDERAKMGAYQNRLEHTINNL 360

Query: 306 QNKNNIIDTYISKSIGVEQHTAHAQLSTLINK 337
              +  +    S+   V+              
Sbjct: 361 STSSENLTAAESRIRDVDMAKEMMNFQKNSIL 392


>gi|14278871|dbj|BAB58972.1| flagellin [Bacillus subtilis]
          Length = 333

 Score =  132 bits (331), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 30/346 (8%), Positives = 95/346 (27%), Gaps = 25/346 (7%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +      +      +  + K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINHNIAALNTSRQLNAGSNSAAKNMEKLSSGLRINRAGDDAAGLAISEKMRSQIRGLD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               +       + TS+  L+    I+Q M             ++        +      
Sbjct: 61  MASKNAQDGISLIQTSEGALNETHSILQRMSELATQAANDTNTDSDRSELQKEMDQLASE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               +  T+          +          +      S ++M    L+  +   ++    
Sbjct: 121 VTRISTDTEFNTKKLLDGTAQNLTFQIGANEGQTMSLSINKMDSESLKVGTTYTVSNDQN 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
            ++S + +    +  ++ D                             +  +A       
Sbjct: 181 TLTSTDGKSTATWADEVTD-------------------------PDGKVTKAAGYYDTDG 215

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
           + I    +     ++K +   +        L+T++  +  +  +RA LG  +  +     
Sbjct: 216 KVIASEKLAADSKVTKGIDISSSAKAASSALTTIKTAIDTVSSERAKLGAVQNRLEHTIN 275

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQ 349
            L   +  + +  S+   V+  +   + +      + S  +  +  
Sbjct: 276 NLGTSSENLTSAESRIRDVDMASEMMEYTKNNILTQASQAMLAQAN 321


>gi|89075503|ref|ZP_01161914.1| flagellar hook-associated protein [Photobacterium sp. SKA34]
 gi|89048775|gb|EAR54346.1| flagellar hook-associated protein [Photobacterium sp. SKA34]
          Length = 411

 Score =  132 bits (331), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 41/411 (9%), Positives = 123/411 (29%), Gaps = 55/411 (13%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               +ST+S ++ +         +  + + ++ TG+  +          +I  + Q+   
Sbjct: 1   MINRVSTASQYQSLTSNLMRKQGEVNESNNQLSTGKRVETAGDDPVSSVTIQNYRQQLTQ 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           I +   S ++   RL   ++ ++ ++  +      ++ ++ G   +N        L    
Sbjct: 61  IDQYKSSITMANNRLGVMESSIAGVEDNLDATKQKVLRMINGAMASNDRTAFKDELTSLR 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +  +  AN  DE        N  +       T D +  +   Q     ++++ +   +  
Sbjct: 121 DGLLELANSRDESGNYVFAGNQMDTQPFVKGTDDKMNYQGDSQSRYAQIDKSVEVKTSLP 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKY----------------- 224
             ++ +       DF     D  S  +    + + +     +                  
Sbjct: 181 GDQLFTSIPNPYGDFRPDFSDLSSGSKLHVLSATTSDFTKAQPIDIAFSEALVTQPDGSE 240

Query: 225 ------------------RIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGAR 266
                             +  D E        N   +   +    +G +           
Sbjct: 241 KTVMQYKLSLDGKEVVADQDYDPEKGIQYTAANGSSVSITLDDVEVGDKLTLNPAQKINI 300

Query: 267 NVLTKKMLST--------------------VQQGLSGIIEQRAVLGISEKNINEERVFLQ 306
               +  +                      +      + ++R+ +G   + +  ++    
Sbjct: 301 FDSLQDAIDNAEKPTSSAAAEATLQRVIDDIDGSFLHVSQRRSEVGTIMQQVERQQEQHL 360

Query: 307 NKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +    +++  S    ++   A  +++  +  ++ S    +K ++LS+ NYL
Sbjct: 361 DFELTLNSAQSGLEDLDYSKAIMEMNQQMMALQASQSAFSKTKQLSLFNYL 411


>gi|91201246|emb|CAJ74306.1| similar to flagellar hook-associated protein FlgL [Candidatus
           Kuenenia stuttgartiensis]
          Length = 305

 Score =  132 bits (331), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 31/356 (8%), Positives = 101/356 (28%), Gaps = 53/356 (14%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  ++ +S+        +   K   ++ E++ +G+  +           +L ++  +N 
Sbjct: 1   MSFRVTQASLSNTTLSNIQLNYKKMQEIQEKLSSGKQINRASDDPVSTRKLLGFKSGENE 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + L +      +++     L ++Q I+  +    V   +G   +++  I A  + +  
Sbjct: 61  LQQYLDAIKHARDKINFIFDALENIQDIMVKIQTKTVQAADGTLGDSERGIIASEIDELM 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           E+ + F+N+TD           +                                     
Sbjct: 121 ETIIQFSNITDSNGRYLFSGTKTLTAPFR------------------------------- 149

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                        D   ++     D       +   S+  I+      +    +      
Sbjct: 150 ----------ATRDSGGEITGVKYDGNNETIQYQIGSNTFIQVNQPGGKLFMEN------ 193

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
                  +         +                  +   + ++ +    G     +   
Sbjct: 194 ------GIFANLINLRDELKKSDFDTDAFLSQKKNFETANNNVLTEITKFGAKVDRLAIT 247

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
              ++N    +   IS +   +  +   +L    N ++ +     ++ + S+L+++
Sbjct: 248 ENRVENSKIALKELISYTEDADLASLITELKNQENVLQAALQTGARIIQPSLLDFI 303


>gi|217959243|ref|YP_002337791.1| flagellin [Bacillus cereus AH187]
 gi|217063875|gb|ACJ78125.1| flagellin [Bacillus cereus AH187]
          Length = 373

 Score =  132 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 31/363 (8%), Positives = 89/363 (24%), Gaps = 16/363 (4%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +         ++ + 
Sbjct: 1   MRINTNINSMRTQEYMRQNQAKMSNAMDRLSSGKRINNASDDAAGLAIATRMRARESGLG 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       + T+ + L+S+  I+  M         G   N           +  E 
Sbjct: 61  VASNNTQDGMSLIRTADSALNSVSNILLRMRDLANQSANGTNTNENKAAMQKEFGELKEQ 120

Query: 124 FVTFANMTDEGQYL----------------FSGINSSEKPLNGYFTKDSLAKKSFDQMLQ 167
               A  T                          + S++           A    D  + 
Sbjct: 121 IKYIAENTQFNDQHLLNADKGITKEIAIQTLDSDSDSKQIKIKLQGSSLEALDIKDLQIG 180

Query: 168 GFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIK 227
                     L    ++          D   Q      D        S++     +    
Sbjct: 181 NTELAQKDLDLLNATMDRLDATVPGTRDVDVQAAKDAFDKVKGFYTNSDSVKAIERAFED 240

Query: 228 DTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQ 287
                                  +   +           +  +   ++ +   L  + + 
Sbjct: 241 YATASTAGTAKADAATAIKAAFDLAANKVGKPATGGAQGSANSLGAITKIDAALKTVADN 300

Query: 288 RAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTK 347
           RA LG +   ++     L+++ + +    S+    +     ++++      E    + ++
Sbjct: 301 RATLGATLNRLDFNVNNLKSQASSMAAAASQVEDADMAKEMSEMTKFKILNEAGISMLSQ 360

Query: 348 LQK 350
             +
Sbjct: 361 ANQ 363


>gi|89895768|ref|YP_519255.1| hypothetical protein DSY3022 [Desulfitobacterium hafniense Y51]
 gi|89335216|dbj|BAE84811.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 389

 Score =  132 bits (330), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 29/366 (7%), Positives = 79/366 (21%), Gaps = 38/366 (10%)

Query: 10  SIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSN 69
                        N  + K  E++ +G   +      A +    +   +   + +   + 
Sbjct: 1   MSAINTYRQLTVNNAGTSKSLEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLDQAGRNA 60

Query: 70  SLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFAN 129
                 + T++  L+    I+Q M    V        +         ++   +     AN
Sbjct: 61  QDSISLIQTAEGALNETHSILQRMRELAVQAANDTNSSTDRGEIQKEIKQLTDEIDRIAN 120

Query: 130 MTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMN 189
            T+         +                    +  L   +  N          +     
Sbjct: 121 TTEFNTQKLLNGDKKGLVDKEESQVTLQLNTKANITLGASVSTNIGQSGVIILTKGDVSV 180

Query: 190 AQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNM--------- 240
                         +   E    + S  +        K    I++S +++          
Sbjct: 181 EGNNPLSGNTSFSVYIAGEVGTISVSGNTITIAANGSKLGGTIELSGSLDDLKAGESIAI 240

Query: 241 -----------------------------RGIRDIMFVAVIGTEFLSKNLTDGARNVLTK 271
                                         G+  +    +        +  +        
Sbjct: 241 SIKSAVAESTAIGNSFSMQIGANSGQNIMVGMNSMKASELKLRTGADGDALEVGNYYQAT 300

Query: 272 KMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQL 331
             +S +   +  +  +R+ LG  +  +      L   +  +    S+   V+        
Sbjct: 301 AAVSIINNAIETVSAERSKLGAIQNRLEHTINNLGTSSENLTAAESRIRDVDMAKEMMNF 360

Query: 332 STLINK 337
                 
Sbjct: 361 QKNNIL 366


>gi|148979886|ref|ZP_01815764.1| flagellin [Vibrionales bacterium SWAT-3]
 gi|145961578|gb|EDK26879.1| flagellin [Vibrionales bacterium SWAT-3]
          Length = 374

 Score =  132 bits (330), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 27/364 (7%), Positives = 87/364 (23%), Gaps = 16/364 (4%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              ++T+              + +++    + +G   +      A +        +   +
Sbjct: 1   MVSLNTNVTAMMTQRHLSHAAEQNIESQRNLTSGYRINSASDDAAGLQISNTLNVQTRGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
              L +         T++  L     I+Q +    +    G  D++        +    +
Sbjct: 61  DVALRNAQDAYSVAQTAEGALHESSDILQRLRSLGLQAANGSNDSSDRQSIQYEVVALQD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                A  T          +   +  +     +S++    +             +     
Sbjct: 121 ELDRVAITTTFADKNLFDGSYGSQSFHIGANANSISLTLRNMRSHIPEMGGQHYVGDAVD 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
            +       Q   F  Q     +  E       +  +    Y       +  S   N   
Sbjct: 181 KDWRVTKDSQTLKFEYQDSKGQTQTESIRLKLGDRIEQVATYINAQQSIVSASVTENNEL 240

Query: 243 IRDIMFVAVIGTEFLSKNLTDG----------------ARNVLTKKMLSTVQQGLSGIIE 286
                 +       L  +L D                 +     +  +  +   +  +  
Sbjct: 241 QFFASTLNAPEGVTLEGSLADELDVSAGALVTMDNIDMSTVGGAQLSIGVIDAAIKYVDS 300

Query: 287 QRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITT 346
            R+ +G  +  ++     L   N  +     +    +      ++       + +  +  
Sbjct: 301 HRSEIGGFQNRVSGTMENLNTVNRSVTESKGRIRDTDFARESTEMVRSQVLQDATTALLA 360

Query: 347 KLQK 350
           + ++
Sbjct: 361 QAKQ 364


>gi|298571377|gb|ADI87719.1| putative flagellin [uncultured Nitrospirae bacterium MY3-5B]
          Length = 336

 Score =  132 bits (330), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 31/349 (8%), Positives = 89/349 (25%), Gaps = 23/349 (6%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+            +     +  + + +G   +      A +  +     +   
Sbjct: 1   MAFVINTNISSINAQRNLMRVQSPLQEAMQRLSSGLRINSAKDDAAGLAIVTRMTTQTRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +     + T +  L  +   +Q M    V  L G+   +        +    
Sbjct: 61  LTVAIRNANDGISMVQTGEGALEEVTNNLQRMRELSVQALSGQYGASDIGFMQQEVNALI 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           E     A  T              +         ++A  + D  +   +   +  +L G+
Sbjct: 121 EEVGRIAEQTSFNNKKLLAGGFGSR--------LAVAYMASDTTIDIHIASMNSDVLGGK 172

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
               +  +   M                   +W + +     + +     I  +   +  
Sbjct: 173 TFTATGKDGAFMMLKDIHTATTVGIQGVGDGSWQSGAGAPYAWSVTAKAQIGYTGQAS-- 230

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
                          ++ + T           ++ +   LS +   R+ +G      +  
Sbjct: 231 -------------LLVNDSTTLTGLASRASNAIAIIDGALSAVTNARSYMGAKANQFDAV 277

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              L N         S+    +     A L+  +   +    + ++   
Sbjct: 278 VRNLSNIVETTMASRSRIYDADFAAETASLTKYMIMQQSGISVLSQANS 326


>gi|326389607|ref|ZP_08211173.1| flagellin domain protein [Thermoanaerobacter ethanolicus JW 200]
 gi|325994322|gb|EGD52748.1| flagellin domain protein [Thermoanaerobacter ethanolicus JW 200]
          Length = 404

 Score =  132 bits (330), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 30/402 (7%), Positives = 92/402 (22%), Gaps = 57/402 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +               ++ K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MIINHNLSALNAWRALSINTANTQKSLEKLSSGYRINRAGDDAAGLAISEKMRAQIAGLN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  L+  Q I+Q M    V         +        +    + 
Sbjct: 61  QAQRNAQDGISLIQTAEGALNETQAILQRMRELAVQSANDTNTASDRAQIQKEIDQLAQE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDS---------------LAKKSFDQMLQG 168
                  T+         +       G     +               +   +++     
Sbjct: 121 LGRIGRTTEFNTQKLLDGSFKGIFQIGANENQNLSLTINDMRGYALQIVGGVTYNITGTF 180

Query: 169 FLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKD 228
               +   +  G +          + D         +D + + N   +    +       
Sbjct: 181 SAAASGSLISNGTYTVSYDGTKYLLKDQAGNTVATSTDGKSYTNTAGDTISFSDPVISGQ 240

Query: 229 TEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLT-------------------------- 262
                 +A        + +       +F +K L                           
Sbjct: 241 ITINGTNATGVATVTNNGLDAGTYTYDFTNKVLKNASGEVIGKSTDGKTFVDLQGNTLFT 300

Query: 263 ----------------DGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQ 306
                           D          ++ +Q  +  +  +R+ LG  +  +      L 
Sbjct: 301 LGAAVTADTTFTIGGIDVTTQSAANAAITKIQSAIDKVSTERSKLGAYQNRLEHTINNLG 360

Query: 307 NKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKL 348
                +    S+   V+      + +      + +  +  ++
Sbjct: 361 TAAENLTAAESRIRDVDMAKEMMEFTKNNILNQAATAMLERM 402


>gi|85859204|ref|YP_461406.1| flagellin and related hook-associated proteins [Syntrophus
           aciditrophicus SB]
 gi|85722295|gb|ABC77238.1| flagellin and related hook-associated proteins [Syntrophus
           aciditrophicus SB]
          Length = 403

 Score =  132 bits (330), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 42/400 (10%), Positives = 113/400 (28%), Gaps = 44/400 (11%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               ++ +  +  +      +      + E+M + +S +        +T I ++ + K+ 
Sbjct: 3   MVVRVTENMKYNSIIGNIFTVQNGYNCIMEKMSSQKSINRTSDNPMGMTRIFDFRKTKSF 62

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           I +   +       LS+S++ LS+   ++       V             ++A  ++   
Sbjct: 63  IEQYNRNIDSADAWLSSSESKLSAAGDLISKAREIAVREASSTATETSRKLSAENIQSLI 122

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPL--------------------------------- 148
           +  ++ AN T  G+YLFSG  +   P                                  
Sbjct: 123 DEMLSLANSTLNGRYLFSGSATDTPPFSASELPARIEAAGGAEGNEFQGTVESQGHFTGT 182

Query: 149 ----------NGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIK 198
                      G    +     S D        ++  S    +  +   M          
Sbjct: 183 SNKTFAVRIDEGGPLAEVEYSISLDGGKSWCAGKDDLSAGTVELGDGVQMAFDDDGGAKP 242

Query: 199 QLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIG-TEFL 257
                    + +A  +   ++  +   ++    +  +                I      
Sbjct: 243 LSNGDLFYVKSYAAGYYCGNNEKLSVDVQRDSPVTYNLTGQEVFTGVGSDGVDIFKCLAD 302

Query: 258 SKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYIS 317
            K     +     +  +  +++  + I    +  G  +  +      L +    +   +S
Sbjct: 303 LKKAMQNSDQQSIQAQIGNLEKAQNQITLNVSKCGTRQNRLEIAESNLADLELKVTELMS 362

Query: 318 KSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
                +      Q +     ++  Y I +++   S+L++L
Sbjct: 363 NIEDADLTQLVTQFTMKEVSLKACYAIASEIGNTSVLDFL 402


>gi|269965414|ref|ZP_06179533.1| polar flagellin FlaE [Vibrio alginolyticus 40B]
 gi|269829893|gb|EEZ84123.1| polar flagellin FlaE [Vibrio alginolyticus 40B]
          Length = 374

 Score =  132 bits (330), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 28/364 (7%), Positives = 88/364 (24%), Gaps = 16/364 (4%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              ++++           +    +V+    + +G   +      A +        +   +
Sbjct: 1   MISLNSNVSAMVAQRHLSQAAAQNVESQRNLTSGFRINSASDDAAGLQISNTLHVQTRGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
              L +         T++  L     I+Q +    +    G  D++        +    +
Sbjct: 61  DVALRNAHDAFSVAQTAEGALHESSDILQRLRSLGLQAANGSYDSSDRQSIQYEVVALQD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                A  T          +   +  +     +S++    +             +     
Sbjct: 121 ELDRVAITTTFADKNLFDGSYGSQSFHIGANANSISLTLRNMRSHIPEMGGQHYVGDAVD 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
            +       Q      Q     +  E       +  +    Y       ++ S   N   
Sbjct: 181 KDWRVTKDNQTLKVEYQDSKGQTHTESIGLKLGDRIEQVATYINAQQSIVNASVTENNEL 240

Query: 243 IRDIMFVAVIGTEFLSKNLTDG----------------ARNVLTKKMLSTVQQGLSGIIE 286
                 +       L  +L D                 +     +  +  +   +  +  
Sbjct: 241 QFFASTMNAPEGVLLDGSLADELDVSAGQLVTMDDIDMSTAGKAQLSVGVIDAAIKYVDS 300

Query: 287 QRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITT 346
            R+ +G  +  +N     L   N  +    S+    +      ++       + +  +  
Sbjct: 301 HRSEIGSFQNRVNGSMDNLNTVNRSVTESKSRIRDTDFARESTEMVRSQVLQDATTALLA 360

Query: 347 KLQK 350
           + ++
Sbjct: 361 QAKQ 364


>gi|125659361|dbj|BAF46880.1| flagellin [Escherichia coli]
          Length = 349

 Score =  132 bits (330), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/349 (10%), Positives = 88/349 (25%), Gaps = 11/349 (3%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+         +         E + +G   +      A       +      
Sbjct: 1   MAQVINTNSLSLITQNNINKNQSALSTSIERLSSGLRINSAKDDAAGQAIANRFTSNIKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  LS +   +Q +    V    G   ++        ++   
Sbjct: 61  LTQAARNANDGISLAQTAEGALSEINNNLQRIRELTVQASTGTNSDSDLSSIQDEIKSRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  T          N S K   G     +++             +         
Sbjct: 121 DEIDRVSGQTQFNGVNVLSKNDSMKIQIGANDNQTISIGLQQIDSTTLNLKGFTVSGMAD 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   A         ++D         +    AS+               +   +  
Sbjct: 181 FSAAKLTAADGTAIAAADVKDAGGKQVNLLSYTDTASNSTK-----------YAVVDSAT 229

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
           G      VA+ GT               T   L  +   ++ + + R+ LG  +  ++  
Sbjct: 230 GKYMEATVAITGTAAAVTVGAAEVAGAATADPLKALDAAIAKVDKFRSSLGAVQNRLDFA 289

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              L N    +    S+    +  T  + +S      +    +  K  +
Sbjct: 290 VTNLNNTTTNLSEAQSRIQDADYATEVSNMSKAQIIQQAGNSVLAKANQ 338


>gi|257871325|ref|ZP_05650978.1| flagellin protein [Enterococcus gallinarum EG2]
 gi|257805489|gb|EEV34311.1| flagellin protein [Enterococcus gallinarum EG2]
          Length = 360

 Score =  132 bits (330), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 30/350 (8%), Positives = 87/350 (24%), Gaps = 2/350 (0%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+             N        ++ +G   +      A +    + + +   ++
Sbjct: 1   MRINTNVSALNTYSRLTAANASKSNSLSKLSSGLRINKAGDDAAGLAISEKMKGQIGGLS 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  L+    I+  M    V    G   ++             + 
Sbjct: 61  QAKSNAQDGISLIQTAEGALNETHSILGRMRDLAVQSSNGTLSDDDRSAINKEYTALSDE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
                N T+           ++     +    +  +     +            L     
Sbjct: 121 IDRIRNNTEFNTKSLLTGEGNDAKSFTFQIGANANQTMSVSITNMSSTVLDVKGLDLTQA 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
             +S  A      +       +  +Y A+   +A+       ++   G            
Sbjct: 181 FSTSEIAAAKDKAVAAAFIADTTTKYAADGKVDAAAGKTAADLQTAIGTAADDAAEATAQ 240

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKML--STVQQGLSGIIEQRAVLGISEKNINEE 301
           +         T          A      +    + + + +  +  QRA LG ++  +   
Sbjct: 241 KTYDDALATFTASDEGKAAAAAAETAIVENNPITKIDKAIKAVSAQRADLGAAQNRLEHT 300

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKL 351
              L      +    S+   V+        +      + +  +  +   +
Sbjct: 301 INNLGTTQENLSEANSRIRDVDMAQEMMSFTKSNILSQAATSMLAQANSM 350


>gi|148269977|ref|YP_001244437.1| flagellar hook-associated protein 3 [Thermotoga petrophila RKU-1]
 gi|147735521|gb|ABQ46861.1| flagellar hook-associated protein 3 [Thermotoga petrophila RKU-1]
          Length = 304

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 42/353 (11%), Positives = 97/353 (27%), Gaps = 51/353 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++   I +R+    +   K   KLH+++ +G    Y            +    K  + 
Sbjct: 1   MRVTNKMISDRVLFNIQTSLKRIAKLHDQLSSGYKVRYPSDDAVVAKRASDILTRKRELE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   S   V   ++   + L ++  I Q +   LV    G     +    A  +    E+
Sbjct: 61  QFQRSVDHVQTYVNAYDSALQTVSSITQRLRELLVRAANGTLSKAEREAIAEEIDKIKEN 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V  AN     +Y+FSG +   +P+        ++        +  L             
Sbjct: 121 LVEVANTRIGNEYIFSGYDVFSQPVENENGTWKISTLPASDKSRSILVLGHSIDYGVTAS 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           EV  +                                                     G 
Sbjct: 181 EVFEL---------------------------------------------------DSGK 189

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                +  +     S          ++   L  +      I      +G   + I+    
Sbjct: 190 NVFQMLEEVSATLRSNLNETQISERVSNVFLKELSYFEERITRTIGEVGGVSRFIDMVNS 249

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNY 356
            +Q+ +     Y+SK    +       L+     +E +    +++ + +++++
Sbjct: 250 RVQDLDFFFTEYLSKERDADITELVTDLAMQQLVLEAALKSASRVLQATLVDF 302


>gi|91225883|ref|ZP_01260852.1| polar flagellin FlaE [Vibrio alginolyticus 12G01]
 gi|91189533|gb|EAS75809.1| polar flagellin FlaE [Vibrio alginolyticus 12G01]
          Length = 374

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 27/364 (7%), Positives = 90/364 (24%), Gaps = 16/364 (4%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              ++++           +    +V+    + +G   +      A +        +   +
Sbjct: 1   MISLNSNVSAMVAQRHLSQAAAQNVESQRNLTSGFRINSASDDAAGLQISNTLHVQTRGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
              L +         T++  L     I+Q +    +    G  D++        +    +
Sbjct: 61  DVALRNAHDAFSVAQTAEGALHESSDILQRLRSLGLQAANGSYDSSDRQSIQYEVVALQD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                A  T          +   +  +     +S++    +             +     
Sbjct: 121 ELDRVAITTTFADKNLFDGSYGSQSFHIGANANSISLTLRNMRSHIPEMGGQHYVGDAVD 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR- 241
            +       Q      Q     +  E       +  +    Y       ++ S   N   
Sbjct: 181 KDWRVTKDNQTLKVEYQDSKGQTQTESIGLKLGDRIEQVATYINAQQSIVNASVTENNEL 240

Query: 242 ---------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIE 286
                                 + V   + ++ +  D +     +  +  +   +  +  
Sbjct: 241 QFFASTMKAPEGVVLDGSLADELDVSAGQLVTMDDIDMSTAGKAQLSIGVIDAAIKYVDS 300

Query: 287 QRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITT 346
            R+ +G  +  +N     L   N  +    S+    +      ++       + +  +  
Sbjct: 301 HRSEIGSFQNRVNGSMDNLNTVNRSVTESKSRIRDTDFARESTEMVRSQVLQDATTALLA 360

Query: 347 KLQK 350
           + ++
Sbjct: 361 QAKQ 364


>gi|254522597|ref|ZP_05134652.1| flagellar protein [Stenotrophomonas sp. SKA14]
 gi|219720188|gb|EED38713.1| flagellar protein [Stenotrophomonas sp. SKA14]
          Length = 406

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 30/395 (7%), Positives = 86/395 (21%), Gaps = 46/395 (11%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+++                   + + +G   +      A +     +  +   
Sbjct: 1   MAQVINTNTMSLNAQRNLSTSGSSLATTIQRLSSGLRINSAKDDAAGLAISERFTTQIRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +        ++  LS +   +Q +    V        ++        +    
Sbjct: 61  LDVAIRNANDGISLAQVAEGSLSEVGNNLQRIRELAVQSSNATNSSSDRKALQAEVTQLV 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 A   D         + + +              +     +      +       
Sbjct: 121 SEVDRVAKQADFNGTKLLDGSFTSQLFQVGANAGQAIAINSVVNAKADSLGAATFANGYT 180

Query: 182 HL------------------------------------------EVSSMNAQQMTDFIKQ 199
                                                        ++S  A  +   + +
Sbjct: 181 GTSLAAADKATADTTYSGLQISVTPPGGTATTVTINDFTVKAGESITSATAAAINGKLGE 240

Query: 200 LEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI----RDIMFVAVIGTE 255
                S +    +  S          +        +    + G+           + G  
Sbjct: 241 TGVMASVNAGVVSLASVKDGQTFTLGVSAATPPTGATAATIAGLGLTETSTNGGLLTGAA 300

Query: 256 FLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTY 315
                  +       +K LS V + L  +   RA LG  +         LQ  +  +   
Sbjct: 301 SNFVKDLNVTTAEGAQKALSIVDKALESVNSVRADLGAIQNRFTSVVANLQTSSENLSAS 360

Query: 316 ISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            S+    +     A+L+      +    +  +  +
Sbjct: 361 RSRIRDTDFAKETAELTRTQILQQAGTAMLAQANQ 395


>gi|301053298|ref|YP_003791509.1| flagellin [Bacillus anthracis CI]
 gi|300375467|gb|ADK04371.1| flagellin [Bacillus cereus biovar anthracis str. CI]
          Length = 354

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 32/347 (9%), Positives = 92/347 (26%), Gaps = 3/347 (0%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +         ++ + 
Sbjct: 1   MRINTNINSMRTQEYMRQNQAKMSNAMDRLSSGKRINNASDDAAGLAIATRMRARESGLG 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       + T+ + ++S+  I+  M         G   +              E 
Sbjct: 61  VAANNTQDGISLIRTADSAMNSVSNILLRMRDLANQSANGTNTSENQAALDKEFGALKEQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               +  T+         ++    +      D   K          +   S S+      
Sbjct: 121 INYISTNTEFNDKKLLDGSNETIAIQTLDNADEGKKIDIKLA---NVSTQSLSIDKLTIG 177

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
             S      + D    L+   + D+       +A               D  A  +    
Sbjct: 178 GASQKTIDDVADKFTALKTTTTTDKADIQKEVDAVMKEFDKVKGSMSAADAKAVTDKLTA 237

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                      +                  ++ +   L  I   RA LG +   ++    
Sbjct: 238 YKNAADTDAAKDLGGAFDKTKVTVANPNAAVAAIDSALENIASNRATLGATLNRLDFNVN 297

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            L+++++ + +  S+    +     ++++      E    + ++  +
Sbjct: 298 NLKSQSSSMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQ 344


>gi|299531279|ref|ZP_07044689.1| flagellar hook-associated protein 3 [Comamonas testosteroni S44]
 gi|298720686|gb|EFI61633.1| flagellar hook-associated protein 3 [Comamonas testosteroni S44]
          Length = 404

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 49/403 (12%), Positives = 102/403 (25%), Gaps = 46/403 (11%)

Query: 1   MKTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKN 60
           M    I T+++++             V L E+   G+                       
Sbjct: 1   MSINRIGTANMYDSTINNLGSRQSSLVDLMEKTTAGKRVLRASDDPVAAAQAERARTRIT 60

Query: 61  HIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDS 120
                          ++  ++ L      +QD    L+    G  D          +   
Sbjct: 61  RSENDQRVLGAQRDVIAQGESELGKAHGALQDFRDLLMQAGNGSYDQVARDALVKQMESL 120

Query: 121 YESFVTFANMTDEGQ-YLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLA 179
            +  + +AN  D     +F G+ S + PL       S                 S    A
Sbjct: 121 RDQVLGYANAKDSNGLPIFRGLGSPDTPLQSTPPGSSSQLNPGQNTGSDNGLPISLDGHA 180

Query: 180 GQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVN 239
                 +      +          ++D     +      D       KD    +VS  +N
Sbjct: 181 AWLNVPTGNGVFVVNGAASNSGKAWADVGSVTDPSKVTGDSYTLVFTKDPTTGEVSYEIN 240

Query: 240 MRGIR---------------------------------------------DIMFVAVIGT 254
                                                                 +     
Sbjct: 241 SSSATVTNPVVPSTPYKEGQAITVGGQQISIKGTPADGDSFTMSPSTRTDIFSVLDQAIA 300

Query: 255 EFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDT 314
                     A      + LS +  G++ +   R+  G   K  +     ++++    + 
Sbjct: 301 TVKGGTGGSTALQQGLGRALSELDSGMNRVQAMRSYAGDQLKRADGLESDMKDQALTQEG 360

Query: 315 YISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             S++  ++  TA +Q+ T    ++ +     ++QKLS+ NY+
Sbjct: 361 ARSRAEDIDMITALSQVETQKVGLQAALQSYAQMQKLSLFNYI 403


>gi|217972605|ref|YP_002357356.1| flagellar hook-associated protein FlgL [Shewanella baltica OS223]
 gi|217497740|gb|ACK45933.1| flagellar hook-associated protein 3 [Shewanella baltica OS223]
          Length = 403

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 44/405 (10%), Positives = 127/405 (31%), Gaps = 53/405 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +S++ +F +      +    + K+ +++ +G+  +           I    Q+   + 
Sbjct: 1   MRLSSAQLFNQSITSVLQKQTATSKILDQLSSGKKVNTAGDDPVASQGIDNLNQKNALVD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +    T RL+ +++ L S + +   +   ++  + G     +  + A  ++ S E 
Sbjct: 61  QFMKNIDYATNRLAVTESKLGSAEDLTGSIREQVMRAINGTLSGTERQMIADEMKGSMEE 120

Query: 124 FVTFANMTDEGQYL-FSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
            ++ AN  DE     FSG ++ ++P     +       S D  ++  L +   ++     
Sbjct: 121 LLSIANSKDESGNYMFSGFSTDKEPFAFDNSTPPKIVYSGDSGVRNSLVQTGVAMGTNIP 180

Query: 183 LE--------------------------------------------------VSSMNAQQ 192
            +                                                   +     Q
Sbjct: 181 GDSAFMKAPNGLGDYSVNYLASQQGEFSVKTAKIADAATYVADTYTFKFIDNGAGGTNLQ 240

Query: 193 MTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVI 252
           + D         ++ +       N  D  I  +    +   +     +     I     +
Sbjct: 241 VLDSANNPVANVANFDATNPVNFNGIDVKIDGKPNAGDSFTMEPQAEVSIFDTISSAIAL 300

Query: 253 GTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNII 312
             +  S             ++L+ +  G++ I   R+V G + K +         +  + 
Sbjct: 301 IEDPNS--ANTPQGRAQLAQILNNIDSGVNQISSARSVAGNNLKVVESYTETHTEEKVVN 358

Query: 313 DTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            + +S    ++  +A  +       +     + +K+  +S+ +++
Sbjct: 359 TSALSLLEDLDYASAITEFEKQQLALNAVSNVFSKVGSVSLFDFI 403


>gi|328473443|gb|EGF44291.1| flagellin [Vibrio parahaemolyticus 10329]
          Length = 374

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 29/364 (7%), Positives = 91/364 (25%), Gaps = 16/364 (4%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              ++T+           +    +V+    + +G   +      A +        +   I
Sbjct: 1   MVSLNTNVAAMMTQRHLSQAAAQNVESQRNLSSGYRINSASDDAAGLQISNTLHVQTRGI 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
              L +         T++  L     I+Q +    +    G  + +        +    +
Sbjct: 61  DVALRNAHDAYSVAQTAEGALHESSDILQRLRSLGLQAANGSHEQDDRTSLQQEVIALQD 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                A  T          +   +  +     +S++    +             L     
Sbjct: 121 ELDRVAITTTFADKNLFNGSYGSQSFHIGANANSISLTLRNMRTHIPEMGGQHYLGDSLD 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR- 241
            +       Q   F  Q  +  +  +      S+  +    Y       +D S   + + 
Sbjct: 181 KDWRVTRDNQQFAFEYQDNEGQAQSKVLTLKVSDNLEEVATYINAQQSVVDASVTQDHQL 240

Query: 242 ---------------GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIE 286
                                 + +   E ++ +  D +     +  +  V   +  +  
Sbjct: 241 QFFTSTLNAPEGITWKGNFADEMDIGSGELVTVDDLDMSTVGGAQLAIGVVDAAIKYVDS 300

Query: 287 QRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITT 346
            R+ +G  +  ++     L   N  +     +    +       +       + +  +  
Sbjct: 301 HRSEIGGFQNRVSGTIDNLNTINRSVSESKGRIRDTDFARESTVMVRSQVLQDATTALLA 360

Query: 347 KLQK 350
           + ++
Sbjct: 361 QAKQ 364


>gi|82702460|ref|YP_412026.1| flagellar hook-associated protein FlgL [Nitrosospira multiformis
           ATCC 25196]
 gi|82410525|gb|ABB74634.1| Flagellin-like protein [Nitrosospira multiformis ATCC 25196]
          Length = 311

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/354 (11%), Positives = 96/354 (27%), Gaps = 44/354 (12%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +S+++ +E             +K  E++ TG+S        A     L+  +  +  +
Sbjct: 1   MRVSSNTSYEAGLAAIHRQQSAQMKTFEQISTGRSVLTPSANPAAYVRALDVAEADSANS 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       LS  +  L  +  ++Q      V    G  +++     A  LR S   
Sbjct: 61  QYALNRQNGMASLSMLEDTLGGITALLQRAQELTVAAGNGTLNDSGRETIATELRTSLGE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +  +N  D           S                     +         ++      
Sbjct: 121 LLGLSNRKDASGQYLFSGYQSSTKPFEDTGSGVQYVGDEGLRMIQASSSRQLAVNESGRE 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
               + A   +                                                 
Sbjct: 181 VFERIPAAGGS--------------------------------------------YHSMF 196

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
           + +  +A +    ++      A           +   L  +++ +A +G   K I+    
Sbjct: 197 KTLSDLADLLETPVTDPAGKTALATGLGSAQVNLSNALDNVLKVQASVGTRMKEIDALNE 256

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             ++ N      +S+   V+   A + L+     +E +     K+Q LS+ +Y+
Sbjct: 257 RGEDLNIQYKQQLSELRDVDYVEAISDLTQQRTYLEATQKAFLKVQSLSLFDYI 310


>gi|285018202|ref|YP_003375913.1| flagellin and related hook-associated proteins (hook-filament
           junction protein) [Xanthomonas albilineans GPE PC73]
 gi|283473420|emb|CBA15925.1| probable flagellin and related hook-associated proteins
           (hook-filament junction protein) [Xanthomonas
           albilineans]
          Length = 401

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 48/400 (12%), Positives = 113/400 (28%), Gaps = 44/400 (11%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +T IS+  I+ +      +       L +++ TGQ             + +  ++    
Sbjct: 1   MSTRISSGMIYNQSLNTMLDKQGRIAHLQQQLSTGQRLVTAADDPVAFGTAVTMDRADAA 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +A+   + ++V  RL+  +  LS    ++  +    V    G  + +     A  L+  +
Sbjct: 61  LAQFGQNANIVQNRLNLQENALSQAGSLMARVNDLTVEANSGALNTSNRQAIASELKTLH 120

Query: 122 ESFVTFANMTDEGQ-YLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
           +S ++ +N TD    YLF G      P      +         + ++   +      L G
Sbjct: 121 DSLLSLSNSTDGSGRYLFGGTADGNPPFTVVGGQAVYNGNQTQRSVEVAPDTKVSDTLPG 180

Query: 181 QHLEVSSMNAQQMTDF-------------------------------------------I 197
             + +         D                                             
Sbjct: 181 SEIFMRVRTGDGSVDAHAGGSNTGTGLLLDFSRDGSSPGWNGSSYSVVFTDPNTYQVKDS 240

Query: 198 KQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFL 257
                                + ++       +   +  + N      I  +  +     
Sbjct: 241 SGTVINTGTYTAGDTLNFAGLNMHLDGAPAAGDSFQIGPSTNKDVFSTINDLVNVLNTDP 300

Query: 258 SKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYIS 317
                  A     +  +  + Q  S I   RA  G     I+         +  + T +S
Sbjct: 301 VTPTGKAALQNALQSSMRDISQATSKISAARASGGAQLAAIDNASDLRSANDVSLKTSLS 360

Query: 318 KSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
               ++   A ++     + ++ +  I T++Q +S+ N +
Sbjct: 361 SVRDLDYADAISKYQLEQSALKAAQTIFTQMQSMSLFNMI 400


>gi|157961178|ref|YP_001501212.1| flagellar hook-associated protein FlgL [Shewanella pealeana ATCC
           700345]
 gi|157846178|gb|ABV86677.1| flagellar hook-associated protein 3 [Shewanella pealeana ATCC
           700345]
          Length = 400

 Score =  131 bits (329), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 42/400 (10%), Positives = 116/400 (29%), Gaps = 46/400 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST+ +F + +    +    + ++ E++ +G+  +           I    Q+     
Sbjct: 1   MRISTAQMFHQTSSNVLKGQSATSQILEQLASGKKVNTAGDDPIAAAGIDNLNQQSALTN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + L +    + RL+ S++ + S + ++Q M   ++  + G  ++      A  +R S E 
Sbjct: 61  QFLKNIDYASNRLAVSESKIGSAETLIQSMHEGMLRSVNGTLNDADRQAIADEMRSSLEE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            ++ AN  DE         +++     +    ++       +    +             
Sbjct: 121 LMSIANSKDESGNSLFAGFATDTTPFAFDNSGNVVYSGDSGVRDSIVASGITVGSNIAGD 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
            +    A  + D+        +      +     +   +          + +  +++   
Sbjct: 181 SIFMNAANAIGDYSVNYSASQTGSFTVESAKVTDASLPVVGDYTFDFVDNGAGGLDLNVT 240

Query: 244 RDIMFVAVIGTEF----------------------------------------------L 257
                V  I                                                   
Sbjct: 241 DSSGGVDTIPNFDPSQPVTVDGIELQFKGTPVAGDTFSMSPETQSNIFDTLNSAISLLED 300

Query: 258 SKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYIS 317
              L          ++L+ V  G   +   R+V G S K++       + +  +  + +S
Sbjct: 301 GAKLNSPQGQSEMAQLLNNVTSGQEQMAMSRSVAGNSLKSLESYTDTHKEEQLVNQSALS 360

Query: 318 KSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
               ++   A  +       +     + +K+   S+ +Y+
Sbjct: 361 LLEDLDYAEAITEFEKQQLALNAVSSVFSKVGSTSLFDYI 400


>gi|281412142|ref|YP_003346221.1| flagellar hook-associated protein 3 [Thermotoga naphthophila
           RKU-10]
 gi|281373245|gb|ADA66807.1| flagellar hook-associated protein 3 [Thermotoga naphthophila
           RKU-10]
          Length = 304

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/353 (12%), Positives = 100/353 (28%), Gaps = 51/353 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++   I +R+    +   K   KLH+++ +G    Y            +    K  + 
Sbjct: 1   MRVTNKMISDRVLFNIQTSLKRIAKLHDQLSSGYKVRYPSDDAVVAKRASDILTRKRELE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   S   V   ++   + L ++  I Q +   LV    G     +    A  +    E+
Sbjct: 61  QFQRSVDHVQTYVNAYDSALQTVSSITQRLRELLVRAANGTLSKAEREAIAEEIDKIKEN 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V  AN     +Y+FSG +   +P+        ++        +  L             
Sbjct: 121 LVEVANTRIGNEYIFSGYDVFSQPVENENGTWKISTLPASDKSRSILVLGHSIDYGVTAS 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           EV  +                                                     G 
Sbjct: 181 EVFEL---------------------------------------------------DSGK 189

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                +  +     S          ++   L  +      II+    +G   + I+    
Sbjct: 190 NVFQMLEEVSATLRSNLNETQISERVSNVFLKELSSFEERIIKTIGKVGGVSRFIDMVNS 249

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNY 356
            +Q+ +     Y+SK    +       L+   + +E +    +++ + +++++
Sbjct: 250 RVQDLDFFFTEYLSKERDADITELVTDLAMQQSVLEAALKSASRVLQATLVDF 302


>gi|170288662|ref|YP_001738900.1| flagellar hook-associated protein 3 [Thermotoga sp. RQ2]
 gi|170176165|gb|ACB09217.1| flagellar hook-associated protein 3 [Thermotoga sp. RQ2]
          Length = 304

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/353 (12%), Positives = 100/353 (28%), Gaps = 51/353 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++   I +R+    +   K   KLH+++ +G    Y            +    K  + 
Sbjct: 1   MRVTNKMISDRVLFNIQTSLKRIAKLHDQLSSGYKVRYPSDDAVVAKRASDILTRKRELE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   S   V   ++   + L ++  I Q +   LV    G     +    A  +    E+
Sbjct: 61  QFQRSVDHVQTYVNAYDSALQTVSSITQRLRELLVRAANGTLSKAEREAIAEEIDKIKEN 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V  AN     +Y+FSG +   +P+        ++        +  L             
Sbjct: 121 LVEVANTRIGNEYIFSGYDVFSQPVENENGTWKISTLPASDKSRSILVLGHSIDYGVTAS 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           EV  +                                                     G 
Sbjct: 181 EVFEL---------------------------------------------------DSGK 189

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                +  +     S          ++   L  +      II+    +G   + I+    
Sbjct: 190 NVFQMLEEVSATLRSNLNETQISERVSNVFLEELSSFEERIIKTIGKVGGVSRFIDMVNS 249

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNY 356
            +Q+ +     Y+SK    +       L+   + +E +    +++ + +++++
Sbjct: 250 RVQDLDFFFTEYLSKERDADITELVTDLAMQQSVLEAALKSASRVLQATLVDF 302


>gi|190574253|ref|YP_001972098.1| flagellin [Stenotrophomonas maltophilia K279a]
 gi|190012175|emb|CAQ45798.1| putative flagellin [Stenotrophomonas maltophilia K279a]
          Length = 406

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 28/396 (7%), Positives = 85/396 (21%), Gaps = 47/396 (11%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+++                   + + +G   +      A +     +  +   
Sbjct: 1   MAQVINTNTMSLNAQRNLSTSGSSLATTIQRLSSGSRINSAKDDAAGLAISERFGTQIRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
               + + +        ++  L+ +   +Q +    V         +        +    
Sbjct: 61  TDVAIRNANDGISLAQVAEGSLTEIGNNLQRVRELSVQASNATNSASDRKALQAEVTQLV 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 A  +D         + S +                    +      +       
Sbjct: 121 SEIDRVAKQSDFNGTKLLDGSFSSQLFQVGANAGQAIAIDKTIDAKANALGGAMFDSVSF 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
            +   +     +      + +        A+    A       + +D     + A +N +
Sbjct: 181 TIAAPADATTGVKMTGMTITNGAGSAISIADIDVAAQGGADGTKTQDAATKAMVAAINAK 240

Query: 242 GIRD-----------------------------------------------IMFVAVIGT 254
                                                               +  +    
Sbjct: 241 IGETGVLAEVDAAGGGKINLSSVKDSVDKNGAFLGIAVETGTWTGIATGPGDITASTTAV 300

Query: 255 EFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDT 314
                +  D +     ++ +  V + L  I   RA LG  +         LQ  +  +  
Sbjct: 301 AKSFADKIDVSTVKGAQQAMEVVDKALGAINSTRADLGAIQNRFTSVVANLQTSSENLSA 360

Query: 315 YISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
             S+    +     A+L+      +    +  +  +
Sbjct: 361 SRSRIKDTDFAKETAELTRTQILQQAGTAMLAQANQ 396


>gi|307718455|ref|YP_003873987.1| hypothetical protein STHERM_c07630 [Spirochaeta thermophila DSM
           6192]
 gi|306532180|gb|ADN01714.1| hypothetical protein STHERM_c07630 [Spirochaeta thermophila DSM
           6192]
          Length = 415

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/414 (7%), Positives = 92/414 (22%), Gaps = 59/414 (14%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              IST+   + M    ++  +   ++   M +                 + ++     +
Sbjct: 1   MNRISTNMPNDDMVYHLQKRERALYRVQNRMSSQTRIQDLRDDPVGAAHAVRYDSFLTRL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
                + + V    +  + HL    +IVQ +    V    G             + +  E
Sbjct: 61  TRYGENIAYVQDYYNVVEGHLKEGVEIVQRIRELTVQAAHGTYTPEDLKAMGKEVDELLE 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
             V  AN          G   +          +             ++ + ++       
Sbjct: 121 QLVQIANARGPEGRFLFGGARTRGEPFRVVRGNVPGADDLLITGVEYIGDITEKQTEIAE 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNAS----DHNIKYRIKDTEGIDVSANV 238
               +        F  Q +  ++  +        A     D       +      +   +
Sbjct: 181 GAFITTGFSGNFVFGAQQQQVYATIDALDYRVGEAGYFSIDGVRIDVTEGDTLYSIVQKI 240

Query: 239 NMRGIRDIMFVAVIGT----------------------------EFLSKNLTDGARNVLT 270
           N         +  +                                   +   G      
Sbjct: 241 NDSAAPVRARIDPVNHSLILETTVPHQLWMEDGEGSVLQDLGIIAPPDVHRPPGNIAASA 300

Query: 271 KKMLSTVQQGLSGIIEQR------------------------AVLGISEKN---INEERV 303
                ++   +  + +                            +G        +     
Sbjct: 301 VHGGGSLFDVVMRVRDAMMVGDQEALGGRGLGMIDEALSALVGKMGEIGARGTRLRFAYA 360

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             Q +   +    +K + ++   A  +L  L    + +     ++   ++L++L
Sbjct: 361 HNQEEIPDVTELYAKRVDLDVSEAIIELKRLEYTHKAALSTAARILPPTLLDFL 414


>gi|330911731|gb|EGH40241.1| flagellar biosynthesis protein FliC [Escherichia coli AA86]
          Length = 349

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/349 (10%), Positives = 89/349 (25%), Gaps = 11/349 (3%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+         +         E + +G   +      A       +      
Sbjct: 1   MAQVINTNSLSLITQNNINKNQSALSTSIERLSSGLRINSAKDDAAGQAIANRFTSNIKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  LS +   +Q +    V    G   ++        ++   
Sbjct: 61  LTQAARNANDGISLAQTAEGALSEINNNLQRIRELTVQASTGTNSDSDLSSIQDEIKSRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  T          N S K   G     +++             +         
Sbjct: 121 DEIDRVSGQTQFNGVNVLSKNDSMKIQIGANDNQTISIGLQQIDSTTLNLKGFTVSGMAD 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   A         ++D         +    AS+             + +   +  
Sbjct: 181 FSAAKLTAADGTAIAAADVKDAGGKQVNLLSYTDTASNST-----------EYAVVDSAT 229

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
           G      V + GT               T   L  +   ++ + + R+ LG  +  ++  
Sbjct: 230 GKYMEATVLITGTAAAVTVGAAEVAGAATADPLKALDAAIAKVDKFRSSLGAVQNRLDSA 289

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              L N    +    S+    +  T  + +S      +    + +K  +
Sbjct: 290 VTNLNNTTTNLSEAQSRIQDADYATEVSNMSKAQIIQQAGNSVLSKANQ 338


>gi|300904811|ref|ZP_07122637.1| bacterial flagellin [Escherichia coli MS 84-1]
 gi|301305264|ref|ZP_07211361.1| bacterial flagellin [Escherichia coli MS 124-1]
 gi|300403238|gb|EFJ86776.1| bacterial flagellin [Escherichia coli MS 84-1]
 gi|300839470|gb|EFK67230.1| bacterial flagellin [Escherichia coli MS 124-1]
 gi|315257246|gb|EFU37214.1| bacterial flagellin [Escherichia coli MS 85-1]
          Length = 349

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/349 (10%), Positives = 88/349 (25%), Gaps = 11/349 (3%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+         +         E + +G   +      A       +      
Sbjct: 1   MAQVINTNSLSLITQNNINKNQSALSTSIERLSSGLRINSAKDDAAGQAIANRFTSNIKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  LS +   +Q +    V    G   ++        ++   
Sbjct: 61  LTQAARNANDGISLAQTAEGALSEINNNLQRIRELTVQASTGTNSDSDLSSIQDEIKSRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  T          N S K   G     +++             +         
Sbjct: 121 DEIDRVSGQTQFNGVNVLSKNDSMKIQIGANDNQTISIGLQQIDSTTLNLKGFTVSGMAD 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   A         ++D         +    AS+               +   +  
Sbjct: 181 FSAAKLTAADDTAIAAADVKDAGGKQVNLLSYTDTASNSTK-----------YAVVDSAT 229

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
           G      V + GT               T   L  +   ++ + + R+ LG  +  ++  
Sbjct: 230 GKYMEATVVITGTAAAVTVGAAEVARAATADPLKALDAAIAKVDKFRSSLGAVQNRLDSA 289

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              L N    +    S+    +  T  + +S      +    + +K  +
Sbjct: 290 VTNLNNTTTNLSEAQSRIQDADYATEVSNMSKAQIIQQAGNSVLSKANQ 338


>gi|56383043|emb|CAE53943.1| flagellin [Escherichia coli]
          Length = 349

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/349 (10%), Positives = 88/349 (25%), Gaps = 11/349 (3%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+         +         E + +G   +      A       +      
Sbjct: 1   MAQVINTNSLSLITQNNINKNQSALSTSIERLSSGLRINSAKDDAAGQAIANRFTSNIKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  LS +   +Q +    V    G   ++        ++   
Sbjct: 61  LTQAARNANDGISLAQTAEGALSEINNNLQRIRELTVQASTGTNSDSDLSSIQDEIKSRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  T          N S K   G     +++             +         
Sbjct: 121 DEIDRVSGQTQFNGVNVLSKNDSMKIQIGANDNQTISIGLQQIDSTTLNLKGFTVSGMAD 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   A         ++D         +    AS+               +   +  
Sbjct: 181 FSAAKLTAADDTAIAAADVKDAGGKQVNLLSYTDTASNSTK-----------YAVVDSAT 229

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
           G      V + GT               T   L  +   ++ + + R+ LG  +  ++  
Sbjct: 230 GKYMEATVVITGTAAAVTVGAAEVAGAATADPLKALDAAIAKVDKFRSSLGAVQNRLDSA 289

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              L N    +    S+    +  T  + +S      +    + +K  +
Sbjct: 290 VTNLNNTTTNLSEAQSRIQDADYATEVSNMSKAQIIQQAGNSVLSKANQ 338


>gi|218695530|ref|YP_002403197.1| Flagellin [Escherichia coli 55989]
 gi|331647516|ref|ZP_08348608.1| bacterial flagellin N-terminus subfamily [Escherichia coli M605]
 gi|331657968|ref|ZP_08358930.1| bacterial flagellin N-terminus subfamily [Escherichia coli TA206]
 gi|331683475|ref|ZP_08384076.1| bacterial flagellin N-terminus subfamily [Escherichia coli H299]
 gi|6009833|dbj|BAA85081.1| flagellin [Escherichia coli]
 gi|30059850|gb|AAP13297.1| FliC [Escherichia coli]
 gi|56383039|emb|CAE53941.1| flagellin [Escherichia coli]
 gi|218352262|emb|CAU98018.1| Flagellin [Escherichia coli 55989]
 gi|331043240|gb|EGI15378.1| bacterial flagellin N-terminus subfamily [Escherichia coli M605]
 gi|331056216|gb|EGI28225.1| bacterial flagellin N-terminus subfamily [Escherichia coli TA206]
 gi|331079690|gb|EGI50887.1| bacterial flagellin N-terminus subfamily [Escherichia coli H299]
          Length = 349

 Score =  131 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/349 (10%), Positives = 88/349 (25%), Gaps = 11/349 (3%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+         +         E + +G   +      A       +      
Sbjct: 1   MAQVINTNSLSLITQNNINKNQSALSTSIERLSSGLRINSAKDDAAGQAIANRFTSNIKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  LS +   +Q +    V    G   ++        ++   
Sbjct: 61  LTQAARNANDGISLAQTAEGALSEINNNLQRIRELTVQASTGTNSDSDLSSIQDEIKSRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  T          N S K   G     +++             +         
Sbjct: 121 DEIDRVSGQTQFNGVNVLSKNDSMKIQIGANDNQTISIGLQQIDSTTLNLKGFTVSGMAD 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   A         ++D         +    AS+               +   +  
Sbjct: 181 FSAAKLTAADGTAIAAADVKDAGGKQVNLLSYTDTASNSTK-----------YAVVDSAT 229

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
           G      V + GT               T   L  +   ++ + + R+ LG  +  ++  
Sbjct: 230 GKYMEATVVITGTAAAVTVGAAEVAGAATADPLKALDAAIAKVDKFRSSLGAVQNRLDSA 289

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              L N    +    S+    +  T  + +S      +    + +K  +
Sbjct: 290 VTNLNNTTTNLSEAQSRIQDADYATEVSNMSKAQIIQQAGNSVLSKANQ 338


>gi|315186993|gb|EFU20750.1| flagellar hook-associated protein 3 [Spirochaeta thermophila DSM
           6578]
          Length = 415

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 34/414 (8%), Positives = 96/414 (23%), Gaps = 59/414 (14%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              IST+   + M    ++  +   ++   M +                 + ++     +
Sbjct: 1   MNRISTNMPNDDMVYHLQKRERALYRVQNRMSSQTRIQDLRDDPVGAAHAVRYDSFLTRL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
                +   V    +  + HL    +I+Q +    V    G             + +  E
Sbjct: 61  KRYGENIEYVQDYYNVVEGHLKEGVEILQRIRELTVQAAHGTYTPEDLKAMGKEVDELLE 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
             V  AN          G   +          +             ++ + ++       
Sbjct: 121 QLVQIANARGPEGRFLFGGARTRGEPFRVVRGNVPGADDLLITGVEYIGDITEKQTEIAE 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNAS----DHNIKYRIKDTEGIDVSANV 238
               +        F  Q +  ++  +        A     D       +      +   +
Sbjct: 181 GAFITTGFSGNFVFGAQQQQVYATVDALDYRVGEAGYFSIDGVRIDVTEGDTLYSIVQKI 240

Query: 239 NMRGIRDIMFVAVIGTEFLSKNL----------------------------TDGARNVLT 270
           N         +  +    + +                                G      
Sbjct: 241 NDSAAPVRARIDPVNHSLILETTVPHQLWMEDGEGTVLQDLGIIAPPDVQRPPGNIAASA 300

Query: 271 KKMLSTVQQGLSGIIEQ-----RAVLGIS-EKNINEERVFL------------------- 305
                ++   +  + +      +  LG      ++E    L                   
Sbjct: 301 VHGGGSLFDVVMRVRDAMMVGDQDALGGRGLGMVDEALSALVGKMGEIGARGTRLTFAYA 360

Query: 306 --QNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             Q +   +    +K + ++   A  +L  L    + +     ++   ++L++L
Sbjct: 361 HNQEEIPDVTELYAKRVDLDVSEAIIELKRLEFTHKAALSTAARILPPTLLDFL 414


>gi|288940416|ref|YP_003442656.1| flagellar hook-associated protein 3 [Allochromatium vinosum DSM
           180]
 gi|288895788|gb|ADC61624.1| flagellar hook-associated protein 3 [Allochromatium vinosum DSM
           180]
          Length = 425

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 51/425 (12%), Positives = 115/425 (27%), Gaps = 71/425 (16%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ISTS IF+      +       K   ++ TGQ            T  ++++       
Sbjct: 1   MRISTSQIFQSGLSAMQGAQSKFNKTGLQLATGQRILTPADDPGGATQSVQFKAAIKATE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +      +L   +A L ++  ++Q     +V       +     I A  +R   E 
Sbjct: 61  QYQRNADYAQPKLEYEEAQLIALGNVLQRARELVVAGNNDTYNPENRKIIASEIRQLRED 120

Query: 124 FVTFANMTDEGQ-YLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
            +  AN  D    YLF+G  S  +P             +        ++  S   +A   
Sbjct: 121 ILGLANSEDANGEYLFAGTRSQHQPFVVGDDGRISYVGADGPGSIREVDITSNRRVATGD 180

Query: 183 LEV---------------SSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIK 227
                             + +      + +  +E K    +   +  S      I++   
Sbjct: 181 TGAHVFMDIPERSGLLTEAVLKPGNSLNGVAGVELKTEVADLQRSLNSAGQTFRIRFEDD 240

Query: 228 DTEGIDVSANVNMRGIRDIMFVA---------------------------VIGTEFLSKN 260
               +    + +   ++D                                        + 
Sbjct: 241 GGTLMYKVLDPDGNAVKDQNGALIGGPYVANQPIEFAGRRVTLTVPTTTPPTVPADGDEI 300

Query: 261 LTDGARNVLTKKMLSTVQQGLSG--------------IIEQRAVLGISEKNINEERVFLQ 306
           L+     V   K L  +                         + L      +NE R  + 
Sbjct: 301 LSRPITQVDIFKTLDDIATAFETPATDETTRESLSQATSMALSNLDSGLDRVNEVRTSVG 360

Query: 307 NKNNIIDTYIS----KSIG----------VEQHTAHAQLSTLINKIEMSYMITTKLQKLS 352
            + + +DT       + +           ++   A ++       ++ +    T++ +LS
Sbjct: 361 LRLDALDTQAGLNDERLVDLNSTLSDIQDLDYAEAISRFMLQRTVLQAAQQTYTQVSRLS 420

Query: 353 ILNYL 357
           + ++L
Sbjct: 421 LFDFL 425


>gi|153001465|ref|YP_001367146.1| flagellar hook-associated protein FlgL [Shewanella baltica OS185]
 gi|151366083|gb|ABS09083.1| flagellar hook-associated protein 3 [Shewanella baltica OS185]
          Length = 403

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 41/405 (10%), Positives = 117/405 (28%), Gaps = 53/405 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +S++ +F +      +    + K+ +++ +G+  +           I    Q+   + 
Sbjct: 1   MRLSSAQLFNQSITSVLQKQTATSKILDQLSSGKKVNTAGDDPVASQGIDNLNQKNALVD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +    T RL+ +++ L S + +   M   ++  + G     +  + A  ++ S E 
Sbjct: 61  QFMKNIDYATNRLAVTESKLGSAEDLTGSMREQVMRAINGTLSGTERQMIADEMKGSLEE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFT------------------------------ 153
            ++ AN  DE         S++K    +                                
Sbjct: 121 LLSIANSKDESGNYMFSGFSTDKEPFAFDNSTPPKIVYSGDSGVRNSLVQTGVAMGTNIP 180

Query: 154 ---------------------KDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQ 192
                                            +       + +         +     Q
Sbjct: 181 GDSAFMKAPNGLGDYSVNYLASQQGEFSVKTAKIADAATYVADTYTFNFTDNGAGGTNLQ 240

Query: 193 MTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVI 252
           + D         ++ +       N  D  I  +    +   +     +     I     +
Sbjct: 241 VLDSANNPVANVANFDATNPVSFNGIDVKIDGKPGAGDSFTMEPQAEVSIFDTISSAIAL 300

Query: 253 GTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNII 312
             +  S             ++L+ V  G++ I   R+V G + K +         +  + 
Sbjct: 301 IEDPNS--ANTPQGRAQLAQILNNVDSGVNQISSARSVAGNNLKVVESYTETHTEEKVVN 358

Query: 313 DTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            + +S    ++  +A  +       +     + +K+  +S+ +++
Sbjct: 359 TSALSLLEDLDYASAITEFEKQQLALNAVSNVFSKVGSVSLFDFI 403


>gi|15642857|ref|NP_227898.1| flagellar hook-associated protein 3 [Thermotoga maritima MSB8]
 gi|4980571|gb|AAD35176.1|AE001695_2 flagellar hook-associated protein 3 [Thermotoga maritima MSB8]
          Length = 304

 Score =  130 bits (327), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 42/353 (11%), Positives = 99/353 (28%), Gaps = 51/353 (14%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++   I +R+    +   K   KLH+++ +G    Y            +    K  + 
Sbjct: 1   MRVTNKMISDRVLFNIQTSLKRIAKLHDQLSSGYKVRYPSDDAVVAKRASDILTRKRELE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   S   V   ++   + L ++  I Q +   LV    G     +    A  +    E+
Sbjct: 61  QFQRSVDHVQTYVNAYDSALQTVSSITQRLRELLVRAANGTLSKAEREAIAEEIDKIKEN 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            V  AN     +Y+FSG +   +P+        ++        +  L             
Sbjct: 121 LVEVANTRIGNEYIFSGYDVFSQPVENENGIWKISTLPASNKSRSILVLGHSIDYGVTAS 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
           EV  +                                                     G 
Sbjct: 181 EVFEL---------------------------------------------------DSGK 189

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERV 303
                +  +     S          ++   L  +      I +    +G   + I+    
Sbjct: 190 NVFQMLEEVSATLRSNLNETQISERVSNVFLKELSSFEERITKTIGKVGGVSRFIDMVNS 249

Query: 304 FLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNY 356
            +Q+ +     Y+SK    +       L+   + +E +    +++ + +++++
Sbjct: 250 RVQDLDFFFTEYLSKERDADITELVTDLAMQQSVLEAALKSASRVLQATLVDF 302


>gi|168335503|ref|ZP_02693584.1| flagellin domain protein [Epulopiscium sp. 'N.t. morphotype B']
          Length = 411

 Score =  130 bits (327), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 34/401 (8%), Positives = 102/401 (25%), Gaps = 54/401 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+ +            ++  +L E++ +G   +      A +    +   +     
Sbjct: 1   MEINTNLMAINSQRSMGVKQEEKSELAEKLSSGLRINRAGDDAAGLAISEKMRNQIKGFQ 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  LS + +++  +    +  +     N          +    S
Sbjct: 61  QASRNAEDGISLIQTTEGALSEIYEMLTRVREMSIQSINDTYTNEDRKKLDIEAQQLILS 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               AN  +  +      + + K L     +      +           +S   ++    
Sbjct: 121 IDDLANKAEFNEQKILTGDPTGKGLASVAAQKQNLAAALKTYYAHIGAHDSLLGMSYSVT 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNW--------------------------SNA 217
               +     +    + + +  + +                                  A
Sbjct: 181 TALPLQTALQSAIDLEYKIEALEIQAQGETSDIKQDVLTKISHFRVSFEQLYSSISQYEA 240

Query: 218 SDHNIKYRIKDTEGIDVSANVNMRGI----------------------------RDIMFV 249
             ++++        + VS   +M                                  + +
Sbjct: 241 QANSLRSAAISFATMAVSVEADMVAFVSKTLQATMNEKVGPNEFTFQVGPNNDQEIHLNI 300

Query: 250 AVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKN 309
             + +  L  + T        K  L++V   +  I  Q+A+LG  +  +      +    
Sbjct: 301 KAMNSTALGLDATKLDTPESAKLALTSVDAAVEIISRQKALLGAVQNRLEHTVKSVNISA 360

Query: 310 NIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
             +    S+    +       L+      + S  I  +  +
Sbjct: 361 ENLQAAESQIRDADMAQEMMNLTKTNIISQASQSILVQANQ 401


>gi|834004|gb|AAB33953.1| flagellin {alternatively spliced} [Salmonella typhimurium, SJW46,
           Peptide Mutant, 397 aa]
          Length = 397

 Score =  130 bits (327), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 39/387 (10%), Positives = 90/387 (23%), Gaps = 39/387 (10%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              I+T+S+         +         E + +G   +      A       +      +
Sbjct: 1   AQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANRFTANIKGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
            +   + +       T++  L+ +   +Q +    V         +        +     
Sbjct: 61  TQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLN 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSK------- 175
                +  T          +++     G    +++         Q    +          
Sbjct: 121 EIDRVSGQTQFNGVKVLAQDNTLTIQVGANDGETIDIDLKQINSQTLGLDTLNVQQKYKV 180

Query: 176 --------------------------------SLLAGQHLEVSSMNAQQMTDFIKQLEDK 203
                                           S        +    A ++ D        
Sbjct: 181 SDNVQVANADLTEAKAALTAAGVTGTASVVKMSYTDNNGKTIDGGLAVKVGDDYYSATQN 240

Query: 204 FSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTD 263
                        A D   K  +    G D    V   G +        G  F ++    
Sbjct: 241 KDGSISINTTKYTADDGTSKTALNKLGGADGKTEVVSIGGKTYAASKAEGHNFKAQPDLA 300

Query: 264 GARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVE 323
            A    T+  L  +   L+ +   R+ LG  +   N     L N  N + +  S+    +
Sbjct: 301 EAAATTTENPLQKIDAALAQVDTLRSDLGAVQNRFNSAITNLGNTVNNLTSARSRIEDSD 360

Query: 324 QHTAHAQLSTLINKIEMSYMITTKLQK 350
             T  + +S      +    +  +  +
Sbjct: 361 YATEVSNMSRAQILQQAGTSVLAQANQ 387


>gi|189339482|gb|ABD33735.2| flagellin [Bacillus thuringiensis serovar yunnanensis]
          Length = 416

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/382 (7%), Positives = 99/382 (25%), Gaps = 36/382 (9%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +         +N + 
Sbjct: 34  MRINTNINSMRTQEYMRQNQAKMSNAMDRLSSGKRINNASDDAAGLAIATRMRARENGLG 93

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       + T+ + ++S+  I+  M         G   ++             E 
Sbjct: 94  VAANNTQDGMSLIRTADSAMNSVSNILLRMRDLANQSANGTNTDDNQKALDKEFSALKEQ 153

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLE------------ 171
               +  T+          +    +      D+  + + +                    
Sbjct: 154 IDYISKNTEFNDKKLLNGENKTIAIQTLDNADTTKQININLADSSTSALQIDKLTISGKT 213

Query: 172 -----------ENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDH 220
                       + +   A   ++  +   + + D   +     +D        +  S+ 
Sbjct: 214 TDTTKTETITVTDDEIKAAKTDIDEFNDAKKALADLKAETSAGKADGSTDDEIKTAVSNF 273

Query: 221 NIKYRIKDTEGIDVSANVNM-------------RGIRDIMFVAVIGTEFLSKNLTDGARN 267
              +        D                       + +        +  +  +T  A  
Sbjct: 274 TKSFEKIQKFMNDSDIKTVQTEIEKFDAAAPALDKAKGMGIAFTSAMDPKAGTITKAATR 333

Query: 268 VLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTA 327
                 + ++   L  I   RA LG +   ++     L+++++ +    S+    +    
Sbjct: 334 QNASDAIKSIDAALETIASNRATLGATLNRLDFNVNNLKSQSSSMAAAASQIEDADMAKE 393

Query: 328 HAQLSTLINKIEMSYMITTKLQ 349
            ++++      E    + ++  
Sbjct: 394 MSEMTKFKILNEAGISMLSQAN 415


>gi|10432585|dbj|BAB13814.1| flagellin [Clostridium chauvoei]
 gi|19910957|dbj|BAB87726.1| flagellin protein FliA(C) [Clostridium chauvoei]
          Length = 413

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 37/403 (9%), Positives = 95/403 (23%), Gaps = 56/403 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +      +         + K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MIINHNMNALNAHRNMMGNIATAGKSMEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  L+    I+Q M    V                  +    E 
Sbjct: 61  QASRNAQDGISLIQTAEGALAETHSILQRMRELSVQSANDTNVAVDRTAIQDEINSLTEE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               +  T+             +   G  +  ++     +          + SL +    
Sbjct: 121 INRISGDTEFNTQKLLDGGFKGEFQIGANSNQTVKLDIGNMSAASLGLTTTNSLESKALT 180

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWS---------------------------- 215
           + S++         K L D   +     +  S                            
Sbjct: 181 KDSNLADGTYKISGKNLVDTNGNSVGTFDAASKKITVNGKDTVFDKAALAENAVLTVKSG 240

Query: 216 ------NASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVL 269
                   +    K    + E    +   + +            T     ++++      
Sbjct: 241 TAEIKNTMTGAATKLSSGNYEIKGTNVIKDGKLAGTFDAAKKKLTIDGVGDVSEAELGFQ 300

Query: 270 TKKMLSTVQQGLS----------------------GIIEQRAVLGISEKNINEERVFLQN 307
           T KML  V   ++                       +  QR+ LG  +  +      L  
Sbjct: 301 TSKMLDKVSFTINGSDVSTRELASGSIKTINSAIEQVSTQRSKLGAVQNRLEHTINNLNT 360

Query: 308 KNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            +  +    S+   V+        S      + +  +  +  +
Sbjct: 361 SSENLTAAESRVRDVDMAKEMMAFSKNNILSQAAQAMLGQANQ 403


>gi|157691932|ref|YP_001486394.1| flagellin [Bacillus pumilus SAFR-032]
 gi|157680690|gb|ABV61834.1| flagellin [Bacillus pumilus SAFR-032]
          Length = 305

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 32/348 (9%), Positives = 80/348 (22%), Gaps = 54/348 (15%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +             N  S K  E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINHNIAALNTLNRLSANNGASQKNMEKLSSGLKINRAGDDAAGLAISEKMRGQIRGLE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLE-GKTDNNKFPINAGMLRDSYE 122
               +       + T++  L+    I+Q +   +V     G  D          + +  +
Sbjct: 61  MATKNAQDGISLIQTAEGALTETHSILQRVRELVVQAGNTGTQDGTDLGAIQEEIANLVQ 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                                           D   K       +   ++      +   
Sbjct: 121 EI-----------------------------GDGSGKNGISDRTEFNGKKLLDGTFSAAG 151

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRG 242
               S+  Q   +  ++L+         A     A              +   A+    G
Sbjct: 152 ATPKSLTFQIGANKAQKLDVNIEAMSSTALGALEADGTLKADHAVADIDVTQFADPTAAG 211

Query: 243 IRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEER 302
                                             V   +  + +QR+ LG  +  +    
Sbjct: 212 ALSFDDQL------------------------DIVDGAIKQVSDQRSKLGAVQNRLEHTI 247

Query: 303 VFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
             L      +    S+   V+     ++ +      + S  +  +  +
Sbjct: 248 NNLGASGENLTAAESRIRDVDMAKEMSEFTKNNILSQASQAMLAQANQ 295


>gi|40994711|emb|CAD60547.1| flagellin [Escherichia coli]
          Length = 349

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 37/349 (10%), Positives = 88/349 (25%), Gaps = 11/349 (3%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+         +         E + +G   +      A       +      
Sbjct: 1   MAQVINTNSLSLITQNNINKNQSALSTSIERLSSGLRINSAKDDAAGQAIANRFTSNIKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  LS +   +Q +    V    G   ++        ++   
Sbjct: 61  LTQAARNANDGISLAQTAEGALSEINNNLQRIRELTVQASTGTNSDSDLSSIQDEIKSRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  T          N S K   G     +++             +         
Sbjct: 121 DEIDRVSGQTQFNGVNVLSKNDSMKIQIGANDNQTISIGLQQIDSTTLNLKGFTVSGMAD 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   A         ++D         +    AS+               +   +  
Sbjct: 181 FSAAKLTAADGTAIAAADVKDAGGKQVNLLSYTDTASNSTK-----------YAVVDSAT 229

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
           G      VA+ GT               T   L  +   ++ + + R+ LG  +  ++  
Sbjct: 230 GKYMEATVAITGTAAAVTVGAAEVAGAATADPLKALDAAIAKVDKFRSSLGAVQNRLDSA 289

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              L N    +    S+    +  T  + +S      +    +  K  +
Sbjct: 290 VTNLNNTTTNLSEAQSRIQDADYATEVSNMSKAQIIQQAGNSVLAKANQ 338


>gi|73539457|ref|YP_299824.1| flagellar hook-associated protein FlgL [Ralstonia eutropha JMP134]
 gi|72122794|gb|AAZ64980.1| Flagellin, N-terminal [Ralstonia eutropha JMP134]
          Length = 404

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 44/404 (10%), Positives = 101/404 (25%), Gaps = 50/404 (12%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             ++TS+++++            + + +++ TG+            T  L   Q      
Sbjct: 1   MRVATSTLYQQGLASMNMQQSSLLHIQQQLGTGRKVLTPSDDPVAATRALGVTQASAIND 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   S +     L   +  LS++  + Q++   LV    G   +      A  L+  YE 
Sbjct: 61  QYTTSRNQANISLGMEENTLSTVTTVTQNIQTLLVQAGNGTLSDVDRASLATALKGQYEQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLN---------------------------------- 149
            +  AN  D       G   S  P                                    
Sbjct: 121 LLGLANADDGNGQYLFGGTLSGSPPFVQGGGSVQYIGNTEQQQYQVDVARQMPAGSNGRE 180

Query: 150 ----------------GYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQM 193
                              T  +   +         L     +L                
Sbjct: 181 VFQSVQGSAGYVLKGNSANTGSATYGQVSTTDPTNPLYGTPLTLTFDDSSGSMQYTITDP 240

Query: 194 TDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIG 253
           +            D                 +  DT  I  ++        ++  V    
Sbjct: 241 SGNPVGGTPLAYTDPGQIAVAGVTFTVKGAPKTGDTISIQPASQAGTDMFANLKSVIDAL 300

Query: 254 TEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIID 313
              +  +      N +    +      L  ++  RA +G   + ++       N+     
Sbjct: 301 DAPVHSDADSANLNNVIATGIRQFSNSLDNVLTVRASVGSRMQELDALDTIGTNRGLNYT 360

Query: 314 TYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             +S    ++  +A  +       ++ +     ++Q +++  YL
Sbjct: 361 ETLSGLQDLDYASAITEYYQRQTALQGAQQSFMQIQGMNLFKYL 404


>gi|189339448|gb|ABD33717.2| flagellin [Bacillus thuringiensis serovar darmstadiensis]
          Length = 364

 Score =  130 bits (326), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 28/349 (8%), Positives = 87/349 (24%), Gaps = 2/349 (0%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +         ++ + 
Sbjct: 6   MRINTNINSMRTQEYMRQNQAKMSNAMDRLSSGKRINNASDDAAGLAIATRMRARESGLG 65

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
              ++       + T+ + ++S+  I+  M         G   +              E 
Sbjct: 66  VAANNTQDGISLIRTADSAMNSVSNILLRMRDLANQSANGTNTSENQAALDKEFGALKEQ 125

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               +  T+         ++    +      D   K             +   L  G   
Sbjct: 126 INYISTNTEFNDKKLLDGSNETIAIQTLDNADEGKKIDIKLANVSTQSLSIDKLTIGGAS 185

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDE--YWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
           + +  +       +         D                      D + +         
Sbjct: 186 QKTIDDVAGKFTALNTTTTTDKADIQKEVDAAMKEFDKVKGSMSAADAKAVTDKLADYNN 245

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
                +  A                       ++ +   L  I   RA LG +   ++  
Sbjct: 246 AADTDVAKAAAAKALGGAFDKTKVTVANPNAAVAAIDSALENIASNRATLGATLNRLDFN 305

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              L+++++ + +  S+    +     ++++      E    + ++  +
Sbjct: 306 VNNLKSQSSSMASAASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQ 354


>gi|284810833|gb|ADB96212.1| FliC [Yersinia enterocolitica]
          Length = 369

 Score =  130 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 35/359 (9%), Positives = 86/359 (23%), Gaps = 11/359 (3%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              I+T+S+         +         E + +G   +      A       +    N +
Sbjct: 1   MAVINTNSLSLLTQNNLNKSQSSLGTAIERLSSGLRINSAKDDAAGQAIANRFTSNINGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
                + +       T++  L  +   +Q +    V         +        +    E
Sbjct: 61  TVAARNANDGISLSQTAEGALGEINNNLQRVRDLTVQAQNSSNSASDIDSIQSEVNQRME 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                   TD          ++      +       ++    + +      + +   G  
Sbjct: 121 EINRVTKQTDFNGIKVLDNRTATDSSYDFQVGSKDNEQISIAIGKSSGWNLATAKADGTS 180

Query: 183 LEVSS-----------MNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEG 231
            +  +                             DD       + A+   +  +      
Sbjct: 181 TDTVNTYAFTKKAALDTAQTDYDTANTAYLKAVKDDAANGTTTATAAKTALDGKSTLLAT 240

Query: 232 IDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVL 291
               A      +             +     D A        L+ + + L  +  QR+VL
Sbjct: 241 AVKDATAVNEAVNGKARTVAAKGFDVLSGTVDSAGVATGTTPLADIDKALKAVDTQRSVL 300

Query: 292 GISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
           G S+         L N  N + +  S+    +  T  + +S      +    +  +  +
Sbjct: 301 GASQNRFESTITNLNNTVNNLTSARSRIQDADYSTEVSNMSRAQILQQAGTSVLAQANQ 359


>gi|114046845|ref|YP_737395.1| flagellar hook-associated protein FlgL [Shewanella sp. MR-7]
 gi|113888287|gb|ABI42338.1| flagellar hook-associated protein 3 [Shewanella sp. MR-7]
          Length = 402

 Score =  130 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 51/402 (12%), Positives = 122/402 (30%), Gaps = 48/402 (11%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +S++ +F +      +    + K+ +++ +G+  +           I    Q    + 
Sbjct: 1   MRLSSAQLFNQSISSVLQKQTATSKILDQLSSGKKVNTSGDDPVAALGIDNLNQRNALVD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +    T  L  +++ L     ++  M   ++    G   + +    A  LR S + 
Sbjct: 61  QFMKNIDYATNHLQQTESQLGQADALISSMKDLMLQGSNGSQTSEERQTIADDLRKSLDQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
            +T AN  DE        N +E     +     +  +    +    +    +        
Sbjct: 121 LLTIANTKDESGNYLFAGNKTETLPFQFDANGKIVYQGDSGVHSAIIASGIQLNTNVAGD 180

Query: 184 EVSSMNAQQMTDFIKQLED-------------------------KFSDDEYWANNWSNAS 218
                +   M D+                                F DD     N     
Sbjct: 181 TAFIKSPNAMGDYSVNYSSSQQGEFSVTSAKLDGVTPSLSDYQINFLDDGAGGINVEVTD 240

Query: 219 DHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVIGTE----------------------- 255
                  I      D SA++N  G++  +       +                       
Sbjct: 241 TATPANVISAAAPFDPSASINFDGVKLSIEGEPKIGDSFTLHQEAEVSIFDTFSKAIALF 300

Query: 256 FLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTY 315
             +  +   +      ++L+ +Q G+  I +Q+ + G S K + +      ++  I  + 
Sbjct: 301 DNADQVQTPSGQSELAQLLNNIQSGVKQISQQQGLAGNSLKVLEKYTDKHTDEKLINTSA 360

Query: 316 ISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           +SK   V+  TA  +       +     + +K+  +S+ +Y+
Sbjct: 361 LSKLEDVDYATAITEFEKQQLALNAVSSVFSKVGSVSLFDYI 402


>gi|323700158|ref|ZP_08112070.1| flagellin domain protein [Desulfovibrio sp. ND132]
 gi|323460090|gb|EGB15955.1| flagellin domain protein [Desulfovibrio desulfuricans ND132]
          Length = 308

 Score =  130 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 29/350 (8%), Positives = 83/350 (23%), Gaps = 52/350 (14%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
            +  I+ + +         E           + +G          A +        E + 
Sbjct: 1   MSLVINHNLMAMNAQRNLSEHYSRLGVSTRRLSSGLRVGTAADDAAGLAIRELMRSEISS 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + + + + S     + T+   L  + + +  +    +    G  ++++  I     +   
Sbjct: 61  LHQGIRNASDAISLIQTADGALQVVDEKLIRLKELAMQASTGTYNSDQRMIIDSEYQAMC 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 AN TD         N S  P                              +   
Sbjct: 121 SEITRIANATDFNGIYLLNGNLSGDP-----------------------------GVDHD 151

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
              + +    ++         +         + ++A        +K+ +           
Sbjct: 152 GTGLQATGPLKIHFGTGNDSAEDYYYVAIQGSTASAFGLGHLAAMKNGDTW--------- 202

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
                                  +   L +  +  + Q +    + RA LG  +  +   
Sbjct: 203 --------------EAMNAGKSISTQALAQAAMEAINQAIISKDKIRANLGSMQNRLENT 248

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKL 351
              L+ +   +    S+   V+      +        + +  +  +   L
Sbjct: 249 ITNLEIQAENLQAAESRISDVDVAQEMTEFVRNQILTQSAVAMLAQANSL 298


>gi|190574255|ref|YP_001972100.1| flagellin [Stenotrophomonas maltophilia K279a]
 gi|190012177|emb|CAQ45800.1| putative motility flagellin protein [Stenotrophomonas maltophilia
           K279a]
          Length = 406

 Score =  130 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 28/395 (7%), Positives = 80/395 (20%), Gaps = 46/395 (11%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+++                   + + +G   +      A +     +  +   
Sbjct: 1   MAQVINTNTMSLNAQRNLSTSGSSLATTIQRLSSGLRINSAKDDAAGLAISERFTTQIRG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           +   + + +        ++  LS +   +Q +    V         +        +    
Sbjct: 61  LDVAIRNANDGISLAQVAEGSLSEVGNNLQRIRELAVQSSNATNSASDRKALQAEVTQLV 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
                 A   D         + + +              +     +      +       
Sbjct: 121 SEVDRVAKQADFNGTKLLDGSFTSQLFQVGANAGQAIAINSVVNAKADSLGAATFANGYT 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
              +++ +          L+   +     A   +             +       N    
Sbjct: 181 GTSLAAADKATADTTYSGLQISVTPPGGTATTVTINDFTVKAGESITSATSAAINNKLGE 240

Query: 242 GI----------------------------------------------RDIMFVAVIGTE 255
                                                                  + G  
Sbjct: 241 TGVMASVNAGVISLASVKDGQTFSLGVSAATPPAGATAATIAGLGLTETSTNGGLLTGAT 300

Query: 256 FLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTY 315
                  +       +K LS V + L  +   RA LG  +         LQ  +  +   
Sbjct: 301 ANFVKDLNVTTAEGAQKALSIVDKALESVNSVRADLGAIQNRFTSVVANLQTSSENLSAS 360

Query: 316 ISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            S+    +     A+L+      +    +  +  +
Sbjct: 361 RSRIRDTDFAKETAELTRTQILQQAGTAMLAQANQ 395


>gi|160876196|ref|YP_001555512.1| flagellar hook-associated protein FlgL [Shewanella baltica OS195]
 gi|160861718|gb|ABX50252.1| flagellar hook-associated protein 3 [Shewanella baltica OS195]
 gi|315268386|gb|ADT95239.1| flagellar hook-associated protein 3 [Shewanella baltica OS678]
          Length = 403

 Score =  130 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 41/405 (10%), Positives = 117/405 (28%), Gaps = 53/405 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             +S++ +F +      +    + K+ +++ +G+  +           I    Q+   + 
Sbjct: 1   MRLSSAQLFNQSITSVLQKQTATSKILDQLSSGKKVNTAGDDPVASQGIDNLNQKNALVD 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           + + +    T RL+ +++ L S + +   +   ++  + G     +  + A  ++ S E 
Sbjct: 61  QFMKNIDYATNRLAVTESKLGSAEDLTGSIREQVMRAINGTLSGTERQMIADEMKGSMEE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFT------------------------------ 153
            ++ AN  DE         S++K    +                                
Sbjct: 121 LLSIANSKDESGNYMFSGFSTDKEPFAFDNSTPPKIVYSGDSGVRNSLVQTGVAMGTNIP 180

Query: 154 ---------------------KDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQ 192
                                            +       + +         +     Q
Sbjct: 181 GDSAFMKAPNGLGDYSVNYLASQQGEFSVKTAKIADTATYVADTYTFNFTDNGAGGTNLQ 240

Query: 193 MTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAVI 252
           + D         ++ +       N  D  I  +    +   +     +     I    V+
Sbjct: 241 VLDSANNPVANVANFDATNPVSFNGIDVKIDGKPSAGDSFTMEPQAEVSIFDTISSAIVL 300

Query: 253 GTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNII 312
                S             ++L+ V  G++ I   R+V G + K +         +  + 
Sbjct: 301 IEAPNS--ANTPQGRAQLAQILNNVDSGVNQISSARSVAGNNLKVVESYTETHTEEKVVN 358

Query: 313 DTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
            + +S    ++  +A  +       +     + +K+  +S+ +++
Sbjct: 359 TSALSLLEDLDYASAITEFEKQQLALNAVSNVFSKVGSVSLFDFI 403


>gi|157161394|ref|YP_001458712.1| putative flagellin [Escherichia coli HS]
 gi|157067074|gb|ABV06329.1| putative flagellin [Escherichia coli HS]
          Length = 349

 Score =  130 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 37/349 (10%), Positives = 89/349 (25%), Gaps = 11/349 (3%)

Query: 2   KTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNH 61
               I+T+S+         +         E + +G   +      A       +      
Sbjct: 1   MAQVINTNSLSLITQNNINKNQSALSTSIERLSSGLRINSAKDDAAGQAIANRFTSNIKG 60

Query: 62  IAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSY 121
           + +   + +       T++  LS +   +Q +    V    G   ++        ++   
Sbjct: 61  LTQAARNANDGISLAQTAEGALSEINNNLQRIRELTVQASTGTNSDSDLSSIQDEIKSRL 120

Query: 122 ESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQ 181
           +     +  T          N S K   G     +++             +         
Sbjct: 121 DEIDRVSGQTQFNGVNVLSKNDSMKIQIGANDNQTISIGLQQIDSTTLNLKGFTVSGMAD 180

Query: 182 HLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMR 241
                   A         ++D         +    AS+               +   +  
Sbjct: 181 FSAAKLTAADGTAIAAADVKDAGGKQVNLLSYTDTASNSTK-----------YAVVDSAT 229

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
           G      VA+ GT               T   L  +   ++ + + R+ LG  +  ++  
Sbjct: 230 GKYMEATVAITGTAAAVTVGAAEVAGAATADPLKALDAAIAKVDKFRSSLGAVQNRLDSA 289

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              L N    +    S+    +  T  + +S      +    + +K  +
Sbjct: 290 VTNLNNTTTNLSEAQSRIQDADYATEVSNMSKAQIIQQAGNSVLSKANQ 338


>gi|14278884|dbj|BAB58978.1| flagellin [Bacillus subtilis]
          Length = 306

 Score =  130 bits (325), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 29/333 (8%), Positives = 84/333 (25%), Gaps = 27/333 (8%)

Query: 11  IFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNS 70
                +      +  + K  E++ +G   +      A +    +   +   +     +  
Sbjct: 1   AALNTSRQLNAGSNSAAKNMEKLSSGLRINRAGDDAAGLAISEKMRSQIRGLDMASKNAQ 60

Query: 71  LVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANM 130
                + TS+  L+    I+Q M             ++        +          +  
Sbjct: 61  DGISLIQTSEGALNETHSILQRMSELATQAANDTNTDSDRFELQKEMDQLASEVTRISTD 120

Query: 131 TDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNA 190
           T+          +          +      S ++M    L+  +           S    
Sbjct: 121 TEFNTKKLLDGTAKRLTFQIGANEGQTMSLSINKMDSESLKVGTTYTAQADGTLKSGDGT 180

Query: 191 QQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVA 250
              T   +++ D     E    +   A   + K    +     +  + + +     +   
Sbjct: 181 STATWAEEEVTDGKVTKEAGYYDDKGALVGSEKIEEGEKLSKGIDISSSAKAASSAL--- 237

Query: 251 VIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNN 310
                                   +T++  +  +  +RA LG  +  +      L   + 
Sbjct: 238 ------------------------TTIKTAIDTVSSERAKLGAVQNRLEHTINNLGTSSE 273

Query: 311 IIDTYISKSIGVEQHTAHAQLSTLINKIEMSYM 343
            + +  S+   V+  +   + +      + S  
Sbjct: 274 NLTSAESRIRDVDMASEMMEYTKNNILTQASQA 306


>gi|109899395|ref|YP_662650.1| flagellar hook-associated protein FlgL [Pseudoalteromonas atlantica
           T6c]
 gi|109701676|gb|ABG41596.1| flagellar hook-associated protein 3 [Pseudoalteromonas atlantica
           T6c]
          Length = 408

 Score =  130 bits (325), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 47/407 (11%), Positives = 106/407 (26%), Gaps = 53/407 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST  +++R      +   D   + +++ TG+              ++   +E + IA
Sbjct: 1   MRISTGQLYDRSIRAVLDNQDDLSDVQQQLSTGKKLLRPSDDPVGSAQVIRLTEEIDLIA 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +N+L+T  +   +  L ++   +Q     ++    G  D N     +  +    + 
Sbjct: 61  QYNKNNNLLTNSIEQEETILGNVTDNIQRARQLMIQAGNGILDVNDRNAISIEIGQIRDQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTK--------------------------DSL 157
                N              S  P   Y                              + 
Sbjct: 121 IFDAMNSQSANGEYIFAGYQSSTPAFSYTAGAAGNKYVFEGDEGLNDIRISNTFSLAMNN 180

Query: 158 AKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNA 217
           + ++  + +   L+    S               +   F KQ  D  +            
Sbjct: 181 SGQTVFEDVYARLDSQITSTSGVASASTRISAQSEFDQFHKQNYDPVTPANNEYQISITG 240

Query: 218 SDHNIKYRIKDTEGIDVSANVNMRGI---------------------------RDIMFVA 250
            D      +     +      +                                    + 
Sbjct: 241 VDEVTITNVGTGTVVGTQPYTSGEPFEFQGQEFTIEGAVGDTVNYTLQKPEKKNIAETLN 300

Query: 251 VIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNN 310
                   +N++DG         L  V   L+ I +  ++LG              +   
Sbjct: 301 DFYNSLRDENISDGDYEQAISDALIGVDNSLTSIADSISLLGGKLNVAQSVFASNLDLEI 360

Query: 311 IIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
              T  +    V+   A ++LS     ++ +     K+  LS+ +Y+
Sbjct: 361 SNKTARANIEEVDYAEAVSELSKQEAALQAAQATFAKVTGLSLFDYI 407


>gi|149927805|ref|ZP_01916056.1| flagellar hook-associated protein 3 [Limnobacter sp. MED105]
 gi|149823427|gb|EDM82658.1| flagellar hook-associated protein 3 [Limnobacter sp. MED105]
          Length = 325

 Score =  129 bits (324), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 46/358 (12%), Positives = 97/358 (27%), Gaps = 35/358 (9%)

Query: 1   MKTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKN 60
           M    IST+  F+       +   + VKL  ++ TGQ           ++  L  +    
Sbjct: 1   MAIGRISTNQYFKLSTDRMSKQQTELVKLQGQLATGQRVLKPSDDPLAMSVALGAKAGVK 60

Query: 61  HIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDS 120
            I     + + V  +L      L S   I+  +    +             I A  +   
Sbjct: 61  TIDSYQSNITYVNNQLGQMDVALQSASDIMVSIKEAFLQAGNAALSPADREIIAQDIEGR 120

Query: 121 YESFVTFANMTDEGQYL-FSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLA 179
            E     AN TD   Y  FSG    ++P        +           G      +  +A
Sbjct: 121 MEELRGIANRTDANGYYMFSGTFQDQEPFQTPGGAITGTFLETSTAAAGEAVVGREIQVA 180

Query: 180 GQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVN 239
                  S+  Q         ED F+                                  
Sbjct: 181 SGRFVNLSITGQDAFVDPNTNEDAFAILRD------------------------------ 210

Query: 240 MRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNIN 299
                  +                           + +      +   R  +G+  + + 
Sbjct: 211 ----AVALLRNPAYPNGQEGATPQDTYLRAFNDKGAQLDDIFDQVQISRTKVGVRLREVE 266

Query: 300 EERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             +   Q+    ++    +++G++   A ++LS    +++ +        +L++ N++
Sbjct: 267 TLQQINQSAQLELERVAGEAVGLDYAKAISELSQGQLQLQAAQQSFASTSQLTLFNFI 324


>gi|284810836|gb|ADB96214.1| FliC* [Yersinia enterocolitica]
          Length = 369

 Score =  129 bits (324), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 34/359 (9%), Positives = 86/359 (23%), Gaps = 11/359 (3%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              I+T+S+         +         E + +G   +      A       +    N +
Sbjct: 1   MAVINTNSLSLLTQNNLNKSQSSLGTAIERLSSGLRINSAKDDAAGQAIANRFTSNINGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
                + +       T++  L  +   +Q +    V         +        +    E
Sbjct: 61  TVAARNANDGISLSQTAEGALGEINNNLQRVRDLTVQAQNSSNSASDIDSIQSEVNQRME 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                   TD          ++      +       ++    + +      + +   G  
Sbjct: 121 EINRVTKQTDFNGIKVLDNRTATDSSYDFQVGSKDNEQISIAIGKSSGWNLATAKADGTS 180

Query: 183 LEVSS-----------MNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEG 231
            +  +                             DD       + A+   +  +      
Sbjct: 181 TDTVNTYAFTKKAALDTAQTDYDTANTAYLKAVKDDAANGTTTATAAKTALDGKSTLLAT 240

Query: 232 IDVSANVNMRGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVL 291
               +      +             +     D A        L+ + + L  +  QR+VL
Sbjct: 241 AVKDSTAVNEAVNGKARTVAAKGFDVLSGTVDSAGVATGTTPLADIDKALKAVDTQRSVL 300

Query: 292 GISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
           G S+         L N  N + +  S+    +  T  + +S      +    +  +  +
Sbjct: 301 GASQNRFESTITNLNNTVNNLTSARSRIQDADYSTEVSNMSRAQILQQAGTSVLAQANQ 359


>gi|149182553|ref|ZP_01861025.1| hypothetical protein BSG1_08911 [Bacillus sp. SG-1]
 gi|148849745|gb|EDL63923.1| hypothetical protein BSG1_08911 [Bacillus sp. SG-1]
          Length = 413

 Score =  129 bits (324), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 35/403 (8%), Positives = 93/403 (23%), Gaps = 56/403 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+ +             NK      E++ +G   +      A +    +   +   + 
Sbjct: 1   MRINHNIEALNTFRQMGAANKGMANSMEKLSSGLRINKAGDDAAGLAISEKMRGQIRGLE 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +       + T++  L+    I+Q M    V       + +        L    + 
Sbjct: 61  QAGRNAQDGISMIQTAEGALNETHSILQRMRELAVQASNDTNNTDDRKAIGDELVQLKDE 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               ++ T+         + S         +   +  +         + +    +AG + 
Sbjct: 121 IDRISSTTEFNGKGLLDGSLSTGLHASNGAQVGDSLTTSAANAISVSKIDVSGAVAGTNY 180

Query: 184 EVSSMNAQ---------------------------------------------------- 191
             S  ++                                                     
Sbjct: 181 TFSDDDSGKLTLSATISGKTVSQSIDVADMTTSGKQTLDFNTLGISIELTGGGTGDTGTV 240

Query: 192 QMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIMFVAV 251
              D    L    +     +  +   S+          +   + ++            A 
Sbjct: 241 VANDITSDLVSIDTAAGDGSAKFLVGSNGTNTQETISFDFKKLDSSTLGSETNFSETTAG 300

Query: 252 IGTEFLSKNLTDGARNVLTKKMLST----VQQGLSGIIEQRAVLGISEKNINEERVFLQN 307
            G      NL     +V +K         +   +  +  QR+ +G  +  ++     L  
Sbjct: 301 TGNGGNIHNLITDNTSVDSKDKSDALIKVLDDAIIDVSTQRSAMGAVQNRLDHTINNLGT 360

Query: 308 KNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
               +    S+   V+        +      + S  +  K  +
Sbjct: 361 SAENLTAAESRIRDVDMAKEMMNQTRESILAQASQAMLAKANQ 403


>gi|264676577|ref|YP_003276483.1| flagellar hook-associated protein 3 [Comamonas testosteroni CNB-2]
 gi|262207089|gb|ACY31187.1| flagellar hook-associated protein 3 [Comamonas testosteroni CNB-2]
          Length = 404

 Score =  129 bits (324), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 49/403 (12%), Positives = 103/403 (25%), Gaps = 46/403 (11%)

Query: 1   MKTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKN 60
           M    I T+++++             V L E+   G+                       
Sbjct: 1   MSINRIGTANMYDSTINNLGSRQSSLVDLMEKTTAGKRVLRASDDPVAAAQAERARTRIT 60

Query: 61  HIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDS 120
                          ++  ++ L      +QD    +V    G  D          ++  
Sbjct: 61  RSENDQRVLGAQRDVIAQGESELGKAHGALQDFRDLVVQAGNGSYDQVARDALVQQMQSL 120

Query: 121 YESFVTFANMTDEGQ-YLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLA 179
            +  + +AN  D     +F G+ S + PL       S                 S    A
Sbjct: 121 RDQILGYANAKDSNGLPIFRGLGSPDTPLQSTPPGSSSQLNPGQSTGSDNGLPISLDGHA 180

Query: 180 GQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVN 239
                 +      +          ++D     +      D       KD    +VS  +N
Sbjct: 181 AWLNVPTGNGVFVVNGAASNSGKAWADVGSVTDPSKVTGDSYTLVFTKDPTTGEVSYEIN 240

Query: 240 MRGIR---------------------------------------------DIMFVAVIGT 254
                                                                 +     
Sbjct: 241 SSSATATNPVVPTTPYKEGQAITVGGQQISIKGTPADGDSFTMSPSTRTDIFSVLDQAIA 300

Query: 255 EFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDT 314
                     A      + LS +  G++ +   R+  G   K  +     ++++    + 
Sbjct: 301 TVKGGTGGSTALQQGLGRALSELDSGMNRVQAMRSYAGDQLKRADGLESDMKDQALTQEG 360

Query: 315 YISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
             S++  ++  TA +Q+ T    ++ +     ++QKLS+ NY+
Sbjct: 361 ARSRAEDIDMITALSQVDTQKVGLQAALQSYAQMQKLSLFNYI 403


>gi|118589964|ref|ZP_01547368.1| flagellar hook-associated protein L [Stappia aggregata IAM 12614]
 gi|118437461|gb|EAV44098.1| flagellar hook-associated protein L [Stappia aggregata IAM 12614]
          Length = 348

 Score =  129 bits (324), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 85/357 (23%), Positives = 160/357 (44%), Gaps = 9/357 (2%)

Query: 1   MKTTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKN 60
           MKTT IST ++ +      +       +L  E+ +G+  D GL LG +    +    E +
Sbjct: 1   MKTTYISTITLADASRRQIQNQASLVQRLSIEVSSGRKYDVGLDLGTKTGESVSLRSEFH 60

Query: 61  HIAERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDS 120
            +     +N+L   RL  SQA +  + K  QD +  LV L E     +   I       +
Sbjct: 61  FLNGITDTNALTASRLDVSQAAMGDVLKDAQDFLSTLVALRENSGTAD---IVKADAVGN 117

Query: 121 YESFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAG 180
            E   +  N    G ++F+GIN+ ++P   Y    +  K + D              +A 
Sbjct: 118 LELLTSRLNTQLNGNFVFAGINTDQEPFVDYSDPGAPNKLAADAAFLTEFG------IAQ 171

Query: 181 QHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNM 240
            +  VS +    M+ ++    D    D  W  +WS+A+D  +  RI  +E +  S + N 
Sbjct: 172 TNPGVSGITPAAMSTYLNGAFDLMFQDPAWGTSWSSATDSVMVSRISASETVSSSVSANE 231

Query: 241 RGIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINE 300
           +  RD+     + ++  +++L      V+  K +  +  G++ I  Q   LG  ++ +  
Sbjct: 232 QAFRDLAAAYTMMSDLGNEDLDPETLKVVVNKAIEKLGTGIAEITSQMGQLGNVQEQVKL 291

Query: 301 ERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
               L+ + +I++  I+    V+      +L+T + ++E +Y +T+++Q+LSILNYL
Sbjct: 292 ASERLKVQTDILNRRINDLENVDPEETAVRLNTALTQLETTYAVTSRMQRLSILNYL 348


>gi|332305622|ref|YP_004433473.1| flagellar hook-associated protein 3 [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172951|gb|AEE22205.1| flagellar hook-associated protein 3 [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 408

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 44/407 (10%), Positives = 106/407 (26%), Gaps = 53/407 (13%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             IST  +++R      +   D   + +++ TG+              ++   +E + I 
Sbjct: 1   MRISTGQLYDRSIRAVLDNQDDLSDVQQQLSTGKKLLRPSDDPVGSAQVIRLTEEIDLIN 60

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
           +   +N+L+T  +   +  L ++   +Q     ++    G  D +     A  +    + 
Sbjct: 61  QYNKNNNLLTNSIEQEETILGNVTDNIQRARQLMIQAGNGILDVDDRKAIAIEIGQIRDQ 120

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTK--------------------------DSL 157
                N              S  P   Y                              + 
Sbjct: 121 IFDAMNSQSANGEYIFAGYQSATPAFSYTAGASGNKYAFEGDEGLNEIRISNTFSLAMNN 180

Query: 158 AKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNA 217
           + ++  + +   L+    S               +   F  Q  D             +A
Sbjct: 181 SGQTVFEDVYARLDSQITSSSGVASASTRISTQNEFDQFHSQNYDPVVAANNEFQISISA 240

Query: 218 SDHNIKYRIKDTEGIDVSANVNMRGI---------------------------RDIMFVA 250
           ++      +     +     ++                                    + 
Sbjct: 241 AEQVTITNVGTGAVVGTQPFISGEPFEFKGQEFTIEGVVGDTVNYALQKPEKKNIAETLN 300

Query: 251 VIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNN 310
                   +N++D          L  V   L+ I +  ++LG              +   
Sbjct: 301 DFYNSLNDENISDQDYAQAISDALIGVDNSLTSIADSISLLGGKLNVAQSVFASNLDLEI 360

Query: 311 IIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
              T  +    V+   A ++LS     ++ +     K+  LS+ +Y+
Sbjct: 361 SNKTARANIEEVDYAEAVSELSKQEAALQAAQATFAKVTGLSLFDYI 407


>gi|228920470|ref|ZP_04083815.1| Flagellin [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228839100|gb|EEM84396.1| Flagellin [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1]
          Length = 373

 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 32/358 (8%), Positives = 88/358 (24%), Gaps = 11/358 (3%)

Query: 4   TGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIA 63
             I+T+    R     ++         + + +G+  +      A +      +  +  + 
Sbjct: 6   MRINTNINSLRTQEYMRQNQSKMSTAMDRLSSGKRINNASDDAAGLAIATRMKARQGGLN 65

Query: 64  ERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYES 123
               +       + T+ + L+S+  I+  M         G   +              E 
Sbjct: 66  VAARNTQDGISLIRTADSALNSVSNILLRMRDLANQSATGTNTDTNKVALQKEFTQLKEQ 125

Query: 124 FVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHL 183
               A  T          +S +  +    + D+  +               K L  G   
Sbjct: 126 INYIAANTQFNDKNLLDGSSDQIKIQTLDSDDASKQIEIKLNSSTLDALKIKDLAIGSEG 185

Query: 184 EVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSANVNMRGI 243
              +               K +D          A       +         +     +  
Sbjct: 186 ASKTQLETLTNKMDALKTVKAADVSGMKTAVDEAKTAFEAVKSYMAPADVATLEGKFKDF 245

Query: 244 RDIMFVAVIGTEFLSKNLTDGARNVLTKK-----------MLSTVQQGLSGIIEQRAVLG 292
                 A       +   +    +                 +  +   L  I + +A LG
Sbjct: 246 DGKSVAADQEASAKAIQTSFDTISKSATMPKAAADADALGAVKQIDVALKTIADNQATLG 305

Query: 293 ISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
            +   +      L+++ N + +  S+    +     ++++      E    + ++  +
Sbjct: 306 ATLNRLEFNVTNLKSQENSMASSASQIEDADMAKEMSEMTKFKILNEAGISMLSQANQ 363


>gi|496296|gb|AAA93103.1| thermoregulated motility protein [Yersinia enterocolitica (type
           O:8)]
          Length = 358

 Score =  129 bits (323), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 36/349 (10%), Positives = 83/349 (23%), Gaps = 2/349 (0%)

Query: 3   TTGISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHI 62
              I+T+S+         +         E + +G   +      A       +    N +
Sbjct: 1   MAVINTNSLSLLTQNNLNKSQSSLSTAIERLSSGLRINSAKDDAAGQAIANRFTSNINGL 60

Query: 63  AERLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYE 122
                +  L      T++  L  +   +Q +    V         +        +    E
Sbjct: 61  TVAARNAELGISLSQTAEGALGEINNNLQRVRDLTVQAQNSSNSASDIDSIQSEVNQRME 120

Query: 123 SFVTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH 182
                   TD          +       +       ++    +        + +   G  
Sbjct: 121 EINRVTKQTDFNGIKVLDNRTKTDSSYDFQVGSKDNEQISIAIGASSGWNLATANADGTS 180

Query: 183 LEVSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDV-SANVNMR 241
            +  +  A   T  +   +  +            A   N        +   V  A     
Sbjct: 181 SDTVNTYAFTKTTALDTKQAAYDSANGAYLAAVKADATNGTTTAAALKNAAVKDATAVNE 240

Query: 242 GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEE 301
            +             +                L+ + + L G+I    VLG S+      
Sbjct: 241 AVNGKSRTVAAKGFDVLNGTVAADGKATGTSPLADIDKALKGLIPAH-VLGASQNRFEST 299

Query: 302 RVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQK 350
              L N  N + +  S+    +  T  + +S      +    +  +  +
Sbjct: 300 ITNLNNTVNNLTSARSRIQDADYSTEVSNMSRAQILQQAGTSVLAQANQ 348


>gi|241765798|ref|ZP_04763739.1| flagellar hook-associated protein 3 [Acidovorax delafieldii 2AN]
 gi|241364309|gb|EER59459.1| flagellar hook-associated protein 3 [Acidovorax delafieldii 2AN]
          Length = 418

 Score =  129 bits (323), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 42/410 (10%), Positives = 92/410 (22%), Gaps = 57/410 (13%)

Query: 5   GISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAE 64
            + T+++++       E       L E + +G+                      + I  
Sbjct: 8   RVGTANMYDNALRNLGERQTSLSSLQENLTSGKRVVRASDDPVSAAQAERALTRLSRIQT 67

Query: 65  RLHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESF 124
              +       ++ +++ +     +VQ+    +V    G    N     A  L+   E  
Sbjct: 68  EQRALETQRNAIAQAESAMGEAVGLVQNARELIVSAGNGTLTPNDRATIANQLKGLREQL 127

Query: 125 VTFANMTDEGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQH-- 182
              AN  D       G   S           S          Q      S          
Sbjct: 128 SEVANRKDTNGVPLLGALGSALAPFLGPLTTSPDYTFDGLAGQNSSTGVSIPNTLDGDSA 187

Query: 183 -------------------------------LEVSSMNAQQMTDFIKQLEDKFSDDEYWA 211
                                             + +   Q T     +    +     A
Sbjct: 188 FMFQPQRDGVYNASVSTIPNGRQLTTDGIKPTNTALVTGDQYTIAFSAVGPGATTGTTTA 247

Query: 212 NN------------------------WSNASDHNIKYRIKDTEGIDVSANVNMRGIRDIM 247
                                      + A           T        V ++    + 
Sbjct: 248 TYTITNTTTGAVSAPVTVPDFPSDKPVTIAVTGVPGLSFNITGTPATGDTVTLQPSASMF 307

Query: 248 FVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKNINEERVFLQN 307
                    +     + A      + L+ V  GL  +   R+  G      +        
Sbjct: 308 STLDSAIRDIGGAANNNAATQAVGQALANVDIGLERMHNMRSYAGELLNRADRITGDQDK 367

Query: 308 KNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357
           ++  ++   S++  ++     +         E +      +QKLS+ N++
Sbjct: 368 RSIQLEGDRSRAEDLDMIKGISDFQNQQVGYEAALKSYASIQKLSLFNFI 417


>gi|229178168|ref|ZP_04305539.1| Flagellin [Bacillus cereus 172560W]
 gi|228605298|gb|EEK62748.1| Flagellin [Bacillus cereus 172560W]
          Length = 355

 Score =  129 bits (323), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 32/345 (9%), Positives = 95/345 (27%), Gaps = 7/345 (2%)

Query: 13  ERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLV 72
            R     ++         + + +G+  +      A +         ++ +    ++    
Sbjct: 1   MRTQEYMRQNQAKMSNAMDRLSSGKRINNASDDAAGLAIATRMRARESGLGVAANNTQDG 60

Query: 73  TKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFVTFANMTD 132
              + T+ + ++S+  I+  M         G   N              E     +  T+
Sbjct: 61  ISLIRTADSAMNSVSNILLRMRDLANQSANGTNTNENQAALNKEFDALKEQIDYISTNTE 120

Query: 133 EGQYLFSGINSS