RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780523|ref|YP_003064936.1| flagellar hook-associated protein FlgL [Candidatus Liberibacter asiaticus str. psy62] (357 letters) >gnl|CDD|31535 COG1344, FlgL, Flagellin and related hook-associated proteins [Cell motility and secretion]. Length = 360 Score = 57.0 bits (137), Expect = 7e-09 Identities = 61/360 (16%), Positives = 118/360 (32%), Gaps = 13/360 (3%) Query: 6 ISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAER 65 I+T+ + + K E + +G + A + L + +++ Sbjct: 3 INTNMAALNALRNLNKNQSELAKSQERLSSGLRINSASDDAAGLAIALRLRSQIRGLSQA 62 Query: 66 LHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFV 125 + +L T++ LS + KI+Q + V G + + + Sbjct: 63 KDNAQDGISKLQTAEGALSEISKILQRIKELAVQAANGTLSDADRAAIQKEIEQLLDELD 122 Query: 126 TFANMTD-EGQYLFSGINSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLE 184 AN T G+YLF+G + +KP + K SF+ G L + Sbjct: 123 NIANTTSFNGEYLFAGSKT-DKPFDFQNAGGETIKGSFNSDSSGT----VSVGLDITNTG 177 Query: 185 VSSMNAQQMTDFIKQLEDKFSDDEYWANNWSNASDHNI----KYRIKDTEGIDVSANVNM 240 S + T + ++ + A+ + K T + ANV Sbjct: 178 DLSFTSLGTTAKDEPIDAGDVTAGPTNLFGAGANAADGASLGKALDAATTNTQIGANVGQ 237 Query: 241 R---GIRDIMFVAVIGTEFLSKNLTDGARNVLTKKMLSTVQQGLSGIIEQRAVLGISEKN 297 I D + L+ + A + L T+ L I RA LG + Sbjct: 238 TTTLNINDGNVMTASAAGALADPGSSVATADGAQAALGTIDSALDNITSARAELGAVQNR 297 Query: 298 INEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLSTLINKIEMSYMITTKLQKLSILNYL 357 + L N+++ + S+ + V+ +L+ L + S + +LS+L Sbjct: 298 LESAINNLSNQSDNLTAAESRIVDVDMAEESTELTKLQILQQASLQALAQANQLSLLVLS 357 >gnl|CDD|144340 pfam00700, Flagellin_C, Bacterial flagellin C-terminal helical region. Flagellins polymerize to form bacterial flagella. There is some similarity between this family and pfam00669, particularly the motif NRFXSXIXXL. It has been suggested that these two regions associate and this is shown to be correct as structurally this family forms an extended helix that interacts with pfam00700. Length = 84 Score = 49.1 bits (118), Expect = 2e-06 Identities = 19/84 (22%), Positives = 44/84 (52%) Query: 274 LSTVQQGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLST 333 + + + ++ + QR+ LG + + L+N+++ + IS+ V+ A +++ Sbjct: 1 IDILDEAITQLTSQRSDLGAVQNRLESANTNLKNQSDNLKAAISRIEDVDPAEASTRVTK 60 Query: 334 LINKIEMSYMITTKLQKLSILNYL 357 L ++ SY +T + +LS+LN L Sbjct: 61 LQILLQASYALTAQANQLSLLNLL 84 >gnl|CDD|144315 pfam00669, Flagellin_N, Bacterial flagellin N-terminal helical region. Flagellins polymerize to form bacterial flagella. This family includes flagellins and hook associated protein 3. Structurally this family forms an extended helix that interacts with pfam00700. Length = 139 Score = 43.1 bits (102), Expect = 1e-04 Identities = 33/143 (23%), Positives = 57/143 (39%), Gaps = 9/143 (6%) Query: 6 ISTSSIFERMNILTKELNKDSVKLHEEMVTGQSSDYGLQLGARVTSILEWEQEKNHIAER 65 IST+++ + K EE+ TG D L LGA + + +++ Sbjct: 1 ISTNALALAARRTLNRNQAELQKAQEELSTGLRIDSALDLGAGTAISVSLRSQIRGLSQA 60 Query: 66 LHSNSLVTKRLSTSQAHLSSMQKIVQDMVGPLVILLEGKTDNNKFPINAGMLRDSYESFV 125 + +N+L RL T+Q LS + I+Q + L + I+ + + Sbjct: 61 VRNNNLGISRLQTAQGALSEVTDILQRLRE----LAVQAANGGNSDIDRASAQAEIQQLT 116 Query: 126 TFANMTDE-----GQYLFSGINS 143 + N G+YLFSG N+ Sbjct: 117 SELNNIANTTSFNGEYLFSGTNT 139 >gnl|CDD|30672 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]. Length = 308 Score = 29.1 bits (65), Expect = 2.1 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Query: 159 KKSFDQML-QGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEY 209 + D ML QG +EE G HL++ +M A + + L+ S +E Sbjct: 208 NRRVDAMLEQGLIEEVKALYARGLHLDLPAMQAIGYKEILAYLDGGISLEEA 259 >gnl|CDD|73064 cd02658, Peptidase_C19B, A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.. Length = 311 Score = 28.7 bits (64), Expect = 2.4 Identities = 17/63 (26%), Positives = 28/63 (44%) Query: 148 LNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDD 207 L+G ++K + K D G K+L+ H E S+M Q +F+ L DK + Sbjct: 58 LSGRYSKPASLKSENDPYQVGIKPSMFKALIGKGHPEFSTMRQQDALEFLLHLIDKLDRE 117 Query: 208 EYW 210 + Sbjct: 118 SFK 120 >gnl|CDD|36641 KOG1428, KOG1428, KOG1428, Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms]. Length = 3738 Score = 28.2 bits (62), Expect = 3.3 Identities = 23/101 (22%), Positives = 41/101 (40%), Gaps = 11/101 (10%) Query: 142 NSSEKPLNGYFTKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDF----- 196 N ++ L + ++ + +DQ EN+ SL ++VS A D Sbjct: 1435 NCEKETLASLTSFPNILRFLYDQTFMRNAYENTSSLAEAILVKVSRDLAIPTDDTLMGPV 1494 Query: 197 IKQLEDKF---SDDEYWANNWSNASDHNIKYRIKDTEGIDV 234 + Q +F S W + S+ I +R+ D+EGI + Sbjct: 1495 VHQTSSRFRRRSAQPTW--DMSDGCADAIAFRV-DSEGIKL 1532 >gnl|CDD|35088 COG5529, COG5529, Pyocin large subunit [General function prediction only]. Length = 326 Score = 28.2 bits (62), Expect = 3.3 Identities = 11/37 (29%), Positives = 16/37 (43%) Query: 201 EDKFSDDEYWANNWSNASDHNIKYRIKDTEGIDVSAN 237 +F+D WA N A++ + R G SAN Sbjct: 225 LTEFADAPLWAKNDYWAAEGKVAQRHFWEHGAAFSAN 261 >gnl|CDD|31710 COG1521, COG1521, Putative transcriptional regulator, homolog of Bvg accessory factor [Transcription]. Length = 251 Score = 28.0 bits (62), Expect = 4.5 Identities = 16/85 (18%), Positives = 28/85 (32%), Gaps = 2/85 (2%) Query: 153 TKDSLAKKSFDQMLQGFLEENSKSLLAGQHLEVSSMNAQQMTDFIKQLEDKFSDDEYWAN 212 T+D L + L + NS + G + +SS+ L++ F Sbjct: 30 TEDLLTEDELGLQLHNLFDGNSVRDIDG--IVISSVVPPLGIFLEAVLKEYFKVKPLVVI 87 Query: 213 NWSNASDHNIKYRIKDTEGIDVSAN 237 + + Y + G D AN Sbjct: 88 SPKQLLGIRVLYDNPEELGADRIAN 112 >gnl|CDD|111841 pfam02995, DUF229, Protein of unknown function (DUF229). Members of this family are uncharacterized. They are 500-1200 amino acids in length and share a long region conservation that probably corresponds to several domains. The Go annotation for the protein indicates that it is involved in nematode larval development and has a positive regulation on growth rate. Length = 498 Score = 26.9 bits (60), Expect = 8.6 Identities = 7/27 (25%), Positives = 16/27 (59%) Query: 195 DFIKQLEDKFSDDEYWANNWSNASDHN 221 D+++Q ++ D ++ WSN+ H+ Sbjct: 281 DYLRQFLPRYRDSPFFGFFWSNSLSHD 307 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.314 0.129 0.348 Gapped Lambda K H 0.267 0.0713 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,793,354 Number of extensions: 188263 Number of successful extensions: 309 Number of sequences better than 10.0: 1 Number of HSP's gapped: 307 Number of HSP's successfully gapped: 13 Length of query: 357 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 262 Effective length of database: 4,210,882 Effective search space: 1103251084 Effective search space used: 1103251084 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 58 (26.2 bits)