RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780527|ref|YP_003064940.1| hypothetical protein CLIBASIA_02070 [Candidatus Liberibacter asiaticus str. psy62] (397 letters) >gnl|CDD|178750 PLN03211, PLN03211, ABC transporter G-25; Provisional. Length = 659 Score = 29.1 bits (65), Expect = 1.9 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 7/34 (20%) Query: 183 FSEDVPLNPVDFLLEKQLDTASLGEEICNLKGFS 216 FS P+NP DFLL+ L +C G S Sbjct: 303 FSPSFPMNPADFLLD-------LANGVCQTDGVS 329 >gnl|CDD|185366 PRK15469, ghrA, bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional. Length = 312 Score = 28.6 bits (64), Expect = 3.0 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 5/35 (14%) Query: 102 FTVRDLSASEKDFPSIESFASKSPQDIEDISGFLS 136 F +R S S K +P ++SFA + E++S FLS Sbjct: 160 FPLRCWSRSRKSWPGVQSFAGR-----EELSAFLS 189 >gnl|CDD|151793 pfam11352, DUF3155, Protein of unknown function (DUF3155). This family of proteins with unknown function appears to be restricted to Cyanobacteria. Length = 90 Score = 27.9 bits (62), Expect = 4.4 Identities = 11/30 (36%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Query: 348 FTHSNEFEKKKLYFPER-ERTEKKFFWGEK 376 F H+N + L R E T ++FW EK Sbjct: 40 FIHANGIQPPALLLVRRNEHTTDRYFWAEK 69 >gnl|CDD|179755 PRK04158, PRK04158, transcriptional repressor CodY; Validated. Length = 256 Score = 27.8 bits (63), Expect = 4.9 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 6/66 (9%) Query: 1 MKEVNNISYKGLLEANQYSLGHNDDRLNSIQEEKRNNSTKTINKNPNKQDFDVQNKSLFE 60 +++ N + +LE Q+ +N+ +L ++ E + N ++ F V+NK LF Sbjct: 55 KEKIENDRVEQMLEERQFPEEYNE-KLLNVYETEAN-----LDVESELTVFPVENKCLFP 108 Query: 61 IFLTTI 66 LTTI Sbjct: 109 DKLTTI 114 >gnl|CDD|149618 pfam08624, CRC_subunit, Chromatin remodelling complex subunit. This family has been identified as a subunit of chromatin remodelling complexes. Saccharomyces cerevisiae RSC7 and its paralogue the SWI/SNF global transcription activator complex subunit SWP82 have been identified as subunits of the RSC chromatin remodelling complex, and SWI/SNF chromatin remodelling complex respectively. Length = 139 Score = 28.0 bits (63), Expect = 5.1 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 9/44 (20%) Query: 49 QDFDVQNKSLFEIFLTTIPDADNHIHEDEERLIDNDLIYNSYKG 92 F ++ SL++I T +++E LID +I SYKG Sbjct: 64 YLFFQKHPSLYKIITT---------QDEKEDLIDRGIIPYSYKG 98 >gnl|CDD|182650 PRK10691, PRK10691, hypothetical protein; Provisional. Length = 219 Score = 27.7 bits (62), Expect = 6.0 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Query: 173 SNYLRHRKEMFSEDVPLNPVDFL 195 SNY +H KEM S P PV F+ Sbjct: 24 SNYAKHIKEMGSA-TPEEPVLFI 45 >gnl|CDD|183527 PRK12437, PRK12437, prolipoprotein diacylglyceryl transferase; Reviewed. Length = 269 Score = 27.6 bits (62), Expect = 6.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Query: 311 ALNFSGYTMDRFDVEFVRKDSL 332 AL Y++ RF +E +R DSL Sbjct: 208 ALYLIWYSIGRFFIEGLRTDSL 229 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.315 0.132 0.372 Gapped Lambda K H 0.267 0.0538 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 6,291,123 Number of extensions: 396193 Number of successful extensions: 473 Number of sequences better than 10.0: 1 Number of HSP's gapped: 473 Number of HSP's successfully gapped: 22 Length of query: 397 Length of database: 5,994,473 Length adjustment: 95 Effective length of query: 302 Effective length of database: 3,941,713 Effective search space: 1190397326 Effective search space used: 1190397326 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 58 (26.6 bits)