RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780527|ref|YP_003064940.1| hypothetical protein CLIBASIA_02070 [Candidatus Liberibacter asiaticus str. psy62] (397 letters) >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} (F:1-76) Length = 76 Score = 28.9 bits (64), Expect = 1.2 Identities = 8/35 (22%), Positives = 15/35 (42%), Gaps = 8/35 (22%) Query: 259 SIKALTIQMKPNSPDNIVATLCLSGEKLSVKLRVE 293 ++K L +K + D S L++K +E Sbjct: 21 ALKKLQASLKLYADD--------SAPALAIKATME 47 >1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} (A:1-54,A:321-467) Length = 201 Score = 26.6 bits (59), Expect = 6.0 Identities = 8/20 (40%), Positives = 12/20 (60%) Query: 160 DVFSQLKSDSGSFSNYLRHR 179 V+ L +DSG+ YL +R Sbjct: 43 AVYIDLLTDSGTEEEYLHYR 62 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.315 0.132 0.372 Gapped Lambda K H 0.267 0.0633 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 2,817,703 Number of extensions: 124433 Number of successful extensions: 203 Number of sequences better than 10.0: 1 Number of HSP's gapped: 203 Number of HSP's successfully gapped: 8 Length of query: 397 Length of database: 4,956,049 Length adjustment: 90 Effective length of query: 307 Effective length of database: 1,913,599 Effective search space: 587474893 Effective search space used: 587474893 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 56 (25.6 bits)