Query         gi|254780528|ref|YP_003064941.1| chemotaxis protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 396
No_of_seqs    40 out of 42
Neff          4.5 
Searched_HMMs 33803
Date          Wed Jun  1 17:45:13 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780528.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >3ljn_A Hypothetical protein;   51.7      13  0.0004   16.4   3.0   68   66-133    37-104 (115)
  2 >3chj_A Alpha-14 giardin; calc  46.9     3.6 0.00011   19.8  -0.6   63   87-149     5-67  (80)
  3 >1qvr_A CLPB protein; coiled c  37.0      24  0.0007   14.9   2.3   46  128-173     5-58  (88)
  4 >1yyh_A HN1;, notch 1, ankyrin  36.4      25 0.00074   14.7   2.4   38   67-104    55-92  (100)
  5 >1u09_A Polyprotein; protein-D  28.2      34   0.001   13.9   3.5   40  238-277     2-41  (73)
  6 >1n11_A Ankyrin; clathrin, BAN  27.5      35   0.001   13.8   2.1   44   67-110    26-69  (97)
  7 >2fo1_E LIN-12 protein; beta-b  26.6      33 0.00098   14.0   1.7   65   42-106    44-108 (109)
  8 >2dvw_A 26S proteasome non-ATP  26.2      33 0.00097   14.0   1.6   73   62-134    54-126 (133)
  9 >2pnn_A Transient receptor pot  25.0      35   0.001   13.8   1.5   38   71-108    47-84  (84)
 10 >1d9s_A Cyclin-dependent kinas  24.9      38  0.0011   13.7   1.7   33   77-109     4-36  (67)
 11 >2cwb_A Chimera of immunoglobu  24.8      30 0.00088   14.3   1.1   16   80-95     93-108 (108)
 12 >1bi7_B P16INK4A, MTS1, multip  23.2      37  0.0011   13.7   1.4   33   78-110     1-33  (83)
 13 >1l9z_H Sigma factor SIGA; hel  22.9      43  0.0013   13.3   5.4   82  179-265     1-87  (103)
 14 >2pnn_A Transient receptor pot  22.7      44  0.0013   13.3   2.9   50   61-110    38-87  (99)
 15 >3b7b_A Euchromatic histone-ly  22.1      45  0.0013   13.2   2.4   42   69-110    31-72  (106)
 16 >2dvw_A 26S proteasome non-ATP  21.4      46  0.0014   13.1   2.6   40   70-109    28-67  (98)
 17 >2fo1_E LIN-12 protein; beta-b  21.1      47  0.0014   13.1   3.0   50   60-109   144-193 (195)
 18 >1r6b_X CLPA protein; AAA+, N-  20.3      49  0.0014   13.0   2.4   33  141-173    26-58  (91)

No 1  
>>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} (A:1-115)
Probab=51.75  E-value=13  Score=16.36  Aligned_cols=68  Identities=7%  Similarity=-0.153  Sum_probs=44.3

Q ss_pred             HHHHHCCHHHHCCHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCCHHHHHHHH
Q ss_conf             99861696760562337999998974898899999986188984326999999997269879999983
Q gi|254780528|r   66 VQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKEL  133 (396)
Q Consensus        66 ~~l~~a~~~vw~d~rNv~Aa~iY~lSGG~P~~lr~l~~~d~~~~~d~~L~~g~laY~~Gr~~~a~~~L  133 (396)
                      .-|.....+++....+..-++-|+...|++++++.|++.+...+...-.+---.|=..|+.+-++-++
T Consensus        37 k~Ll~~gad~~~~d~~g~tpL~~A~~~g~~~iv~~Ll~~ga~~~~~~g~TpLh~Aa~~g~~~iv~~Ll  104 (115)
T 3ljn_A           37 RRLIETGVSPTIQNRFGCTALHLACKFGCVDTAKYLASVGEVHSLWHGQKPIHLAVXANKTDLVVALV  104 (115)
T ss_dssp             HHHHHTTCCTTCCCTTCCCHHHHHHHHCCHHHHHHHHHHCCCCCCBTTBCHHHHHHHTTCHHHHHHHH
T ss_pred             HHHHHCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             99998788999889999999999998689999999997688545547997778887620035788998


No 2  
>>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A (A:1-80)
Probab=46.86  E-value=3.6  Score=19.76  Aligned_cols=63  Identities=13%  Similarity=0.122  Sum_probs=54.1

Q ss_pred             HHHHCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHCCCCHHCCCCCCCHHH
Q ss_conf             989748988999999861889843269999999972698799999831267100361000138
Q gi|254780528|r   87 IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYL  149 (396)
Q Consensus        87 iY~lSGG~P~~lr~l~~~d~~~~~d~~L~~g~laY~~Gr~~~a~~~L~~i~~~~lp~~lg~~l  149 (396)
                      -|-||-|-.+++.++...-.....--.|++.+.-|--++.+...+.|..|--+.+++-|.-|+
T Consensus         5 n~qmstgv~avvqkvveacqdeskrldlieia~~yppnqlrnmqrtfqaitgtfldaflkkhl   67 (80)
T 3chj_A            5 NYQMSTGVTAVVQKVVEACQDESKRLDLIEIARSYPPNQLRNMQRTFQAITGTFLDAFLKKHL   67 (80)
T ss_dssp             ------CHHHHHHHHHHHHHCGGGTTHHHHHHHHSCHHHHHHHHHHHHHHHSSCHHHHHHTTS
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCHHHHHHHHC
T ss_conf             899887589999999998148300537999982499999999999999997967899998884


No 3  
>>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} (A:332-394,A:515-539)
Probab=37.02  E-value=24  Score=14.90  Aligned_cols=46  Identities=17%  Similarity=0.132  Sum_probs=27.3

Q ss_pred             HHHHHHCCCCHHC--------CCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             9999831267100--------361000138887666643219899999999999
Q gi|254780528|r  128 ESSKELSKIKDKD--------NTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVR  173 (396)
Q Consensus       128 ~a~~~L~~i~~~~--------lp~~lg~~laLv~a~l~~~~dp~~Al~llD~aR  173 (396)
                      ++.++|..+.+.|        -+..|..-+.|..--.--++=|.+|+.++|++.
T Consensus         5 eti~ILrglk~~YE~hH~V~itdeAL~aaV~LS~RYI~dR~LPDKAIDLLDeA~   58 (88)
T 1qvr_A            5 ETISILRGLKEKYEVHHGVRISDSAIIAAATLSHRYITERRLPDKAIDLIDEAA   58 (88)
T ss_dssp             HHHHHHHHHHHHHHHHTTCEECHHHHHHHHHHHHHHCCSSCTHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             999999967999975479750499999998724432103668635666799986


No 4  
>>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 1ot8_A (A:154-253)
Probab=36.41  E-value=25  Score=14.74  Aligned_cols=38  Identities=8%  Similarity=-0.161  Sum_probs=21.1

Q ss_pred             HHHHCCHHHHCCHHHHHHHHHHHHCCCCHHHHHHHHHC
Q ss_conf             98616967605623379999989748988999999861
Q gi|254780528|r   67 QLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAK  104 (396)
Q Consensus        67 ~l~~a~~~vw~d~rNv~Aa~iY~lSGG~P~~lr~l~~~  104 (396)
                      -|.....++.....+.+-++.|+...|++++++.|+..
T Consensus        55 ~L~~~gad~n~~d~~g~TpLh~A~~~g~~~~v~~Ll~~   92 (100)
T 1yyh_A           55 VLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDLE   92 (100)
T ss_dssp             HHHHTTCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHC-
T ss_pred             HHHHCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHCC
T ss_conf             99987999988689998999999986889999997166


No 5  
>>1u09_A Polyprotein; protein-DNA complex, RNA-dependent RNA polymerase, transferase; 1.91A {Foot-and-mouth disease virus c-s8c1} (A:404-476)
Probab=28.19  E-value=34  Score=13.92  Aligned_cols=40  Identities=18%  Similarity=0.115  Sum_probs=34.4

Q ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCHHHHHHHH
Q ss_conf             8789999985781025799999999998539647999999
Q gi|254780528|r  238 DEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAI  277 (396)
Q Consensus       238 ~~~l~~ils~~d~~~q~~lYL~IAR~Ali~G~~~lA~~As  277 (396)
                      .+.|..+||+..|+...+-.+.||+-|.-+|+.+-.++..
T Consensus         2 t~~LeAmLS~~rPGTL~EKL~Sva~LA~HsG~~~YdrLF~   41 (73)
T 1u09_A            2 SKTLEAILSFARRGTIQEKLISVAGLAVHSGPDEYRRLFE   41 (73)
T ss_dssp             HHHHHHHHTEEETTCHHHHHHHHHHHHGGGCHHHHHHHHG
T ss_pred             HHHHHHEEEECCCCCHHHHHHHHHHHHHHCCHHHHHHHHH
T ss_conf             8996121256888997999999999999748999999999


No 6  
>>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} (A:106-202)
Probab=27.50  E-value=35  Score=13.84  Aligned_cols=44  Identities=9%  Similarity=-0.042  Sum_probs=26.5

Q ss_pred             HHHHCCHHHHCCHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCC
Q ss_conf             98616967605623379999989748988999999861889843
Q gi|254780528|r   67 QLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYF  110 (396)
Q Consensus        67 ~l~~a~~~vw~d~rNv~Aa~iY~lSGG~P~~lr~l~~~d~~~~~  110 (396)
                      .|.....++-....+.+-.+.|+-.+|+.++++.|++.....+.
T Consensus        26 ~Ll~~ga~~~~~~~~~~t~l~~A~~~~~~~~v~~Ll~~gad~n~   69 (97)
T 1n11_A           26 ALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNA   69 (97)
T ss_dssp             HHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTC
T ss_pred             HHHHHHHHHCCCCCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCC
T ss_conf             33222321013366776267776642839999999977898531


No 7  
>>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} (E:196-304)
Probab=26.63  E-value=33  Score=14.00  Aligned_cols=65  Identities=8%  Similarity=-0.063  Sum_probs=45.0

Q ss_pred             HHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCHHHHCCHHHHHHHHHHHHCCCCHHHHHHHHHCCC
Q ss_conf             99999659889999999999999899861696760562337999998974898899999986188
Q gi|254780528|r   42 ALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDT  106 (396)
Q Consensus        42 lQD~Va~Gd~sA~~~q~~Ll~~i~~~l~~a~~~vw~d~rNv~Aa~iY~lSGG~P~~lr~l~~~d~  106 (396)
                      +......|.....+....++.............+.....+.+-++.|+-..|+.++++.|++.+.
T Consensus        44 l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~g~TpLh~Aa~~g~~~iV~~Ll~~GA  108 (109)
T 2fo1_E           44 LXIVAHNEGRDQVASAKLLVEKGAKVDYDGAARKDSEKYKGRTALHYAAQVSNXPIVKYLVGEKG  108 (109)
T ss_dssp             HHHHHHSCSTTHHHHHHHHHHHTCCSSCCSGGGTSSSSCCCCCTHHHHHSSCCHHHHHHHHHHSC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCHHHCCCCCHHHHHHHHHHHCC
T ss_conf             10000246543323222333333222111122123320235673120011210245555554148


No 8  
>>2dvw_A 26S proteasome non-ATPase regulatory subunit 10; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.30A {Mus musculus} PDB: 2dwz_A* 1tr4_A 1uoh_A 1qym_A (A:99-231)
Probab=26.17  E-value=33  Score=14.03  Aligned_cols=73  Identities=10%  Similarity=-0.032  Sum_probs=50.1

Q ss_pred             HHHHHHHHHCCHHHHCCHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHC
Q ss_conf             9998998616967605623379999989748988999999861889843269999999972698799999831
Q gi|254780528|r   62 KETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELS  134 (396)
Q Consensus        62 ~~i~~~l~~a~~~vw~d~rNv~Aa~iY~lSGG~P~~lr~l~~~d~~~~~d~~L~~g~laY~~Gr~~~a~~~L~  134 (396)
                      ..+-..+.....++...+.+..-.+.++-+.|+...++.|++.+...+....--.-.+-|+.|..+.++-++.
T Consensus        54 ~~~~~~~~~~~~~~~~~~~~~~~~l~~A~~~~~~~iv~~Ll~~Gadvn~~d~~G~TpLh~A~~~~e~v~~Ll~  126 (133)
T 2dvw_A           54 LKMVHILLFYKASTNIQDTEGNTPLHLACDEERVEEAKFLVTQGASIYIENKEEKTPLQVAKGGLGLILKRLA  126 (133)
T ss_dssp             HHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCTTSCCHHHHSCHHHHHHHHHHH
T ss_pred             HHHHHHHHCCHHHHEEECCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHCCCHHHHHHHH
T ss_conf             3565554100012012046788752021323399999999987899888799999999998588499999998


No 9  
>>2pnn_A Transient receptor potential cation channel subfamily V member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* (A:91-174)
Probab=24.97  E-value=35  Score=13.83  Aligned_cols=38  Identities=8%  Similarity=-0.078  Sum_probs=26.9

Q ss_pred             CCHHHHCCHHHHHHHHHHHHCCCCHHHHHHHHHCCCCC
Q ss_conf             69676056233799999897489889999998618898
Q gi|254780528|r   71 THMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKG  108 (396)
Q Consensus        71 a~~~vw~d~rNv~Aa~iY~lSGG~P~~lr~l~~~d~~~  108 (396)
                      ...++....++.+-++.|+-..|+.++++.|++.+..|
T Consensus        47 ~~~~~~~~~~~g~TpLh~A~~~g~~~~v~~Ll~~GAdp   84 (84)
T 2pnn_A           47 KKTKGRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQP   84 (84)
T ss_dssp             SSCSSSCCCCSCBSHHHHHHHTTCHHHHHHHHHCSSCC
T ss_pred             CCCCCCCCCCCCCCCCHHHHHCCCCCCCCCHHHHCCCC
T ss_conf             32223444447987004888709864333001101221


No 10 
>>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat; NMR {Mus musculus} (A:70-136)
Probab=24.87  E-value=38  Score=13.68  Aligned_cols=33  Identities=9%  Similarity=-0.136  Sum_probs=16.7

Q ss_pred             CCHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCC
Q ss_conf             562337999998974898899999986188984
Q gi|254780528|r   77 VDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGY  109 (396)
Q Consensus        77 ~d~rNv~Aa~iY~lSGG~P~~lr~l~~~d~~~~  109 (396)
                      +++.|.+..+-|+-..|+.++++.|++.+...+
T Consensus         4 ~~~~~g~tpLh~Aa~~g~~~iv~~Li~~gad~~   36 (67)
T 1d9s_A            4 ADPATLTRPVHDAAREGFLDTLVVLHRAGARLD   36 (67)
T ss_dssp             CBTTTTBCHHHHHHHHTCHHHHHHHHHTCCCCC
T ss_pred             CCCCCCHHHHCCCCCCHHHHHHCCCCCCCCCCC
T ss_conf             222220011101232101332013212222221


No 11 
>>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A (A:)
Probab=24.78  E-value=30  Score=14.28  Aligned_cols=16  Identities=13%  Similarity=0.036  Sum_probs=9.1

Q ss_pred             HHHHHHHHHHHCCCCH
Q ss_conf             3379999989748988
Q gi|254780528|r   80 RNIDAVWIYTIISQDL   95 (396)
Q Consensus        80 rNv~Aa~iY~lSGG~P   95 (396)
                      -||.+||-|+|||+.|
T Consensus        93 Gdv~~Ave~Ll~~~~~  108 (108)
T 2cwb_A           93 GDIQAALELIFAGGAP  108 (108)
T ss_dssp             SCHHHHHHHHHHTSCC
T ss_pred             CCHHHHHHHHHCCCCC
T ss_conf             9999999999727998


No 12 
>>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} (B:74-156)
Probab=23.23  E-value=37  Score=13.74  Aligned_cols=33  Identities=9%  Similarity=-0.136  Sum_probs=18.8

Q ss_pred             CHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCC
Q ss_conf             623379999989748988999999861889843
Q gi|254780528|r   78 DNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYF  110 (396)
Q Consensus        78 d~rNv~Aa~iY~lSGG~P~~lr~l~~~d~~~~~  110 (396)
                      |+.|.+-.+.|+-..|+..+++.|++.+...+.
T Consensus         1 ~D~~G~TpLh~Aa~~g~~~~v~~Ll~~ga~~~~   33 (83)
T 1bi7_B            1 DPATLTRPVHDAAREGFLDTLVVLHRAGARLDV   33 (83)
T ss_dssp             CTTTCCCHHHHHHHHTCHHHHHHHHHHTCCSSC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             222223332211222221111111222222110


No 13 
>>1l9z_H Sigma factor SIGA; helix-turn-helix, coiled-coil, transcription/DNA complex; 6.50A {Thermus aquaticus} (H:110-212)
Probab=22.87  E-value=43  Score=13.31  Aligned_cols=82  Identities=17%  Similarity=0.075  Sum_probs=45.2

Q ss_pred             CHHHHHHHHHHHHH--HHCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHH---HHHCCCHHH
Q ss_conf             29999987767887--5225258999999999997204846566999999985200135778789999---985781025
Q gi|254780528|r  179 TFLEEIALRNLLEI--TQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFT---ISFFSLEEQ  253 (396)
Q Consensus       179 TLvEEAALRRsi~l--a~~g~~~k~~~~a~~Y~rRf~~S~YA~~F~~~f~~~~v~~~~~~~~~~l~~i---ls~~d~~~q  253 (396)
                      ||-||.-|-|.+.=  +..+.....-.+-...+|...++---|.-+   +..++........+.++.+   |-.++.+  
T Consensus         1 tleeeidlarrveeg~~a~~~lae~tgld~~lir~v~ra~v~g~ar---i~~ipg~~~~~dp~ti~~vd~rlralpre--   75 (103)
T 1l9z_H            1 TLEEEIDLARKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTAR---IQKIPGLKEKPDPKTVEEVDGKLKSLPKE--   75 (103)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHH---HHCCCCHHHCCHHHHHHHHHHHHHHHHHH--
T ss_conf             9899999999999899999999973300089999999877545777---63040010022020089998887641999--


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             799999999998
Q gi|254780528|r  254 RAIYLKIAQNSV  265 (396)
Q Consensus       254 ~~lYL~IAR~Al  265 (396)
                      ..-||-|||-+-
T Consensus        76 ~krylhiar~ge   87 (103)
T 1l9z_H           76 LKRYLHIAREGE   87 (103)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999986415


No 14 
>>2pnn_A Transient receptor potential cation channel subfamily V member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* (A:175-273)
Probab=22.67  E-value=44  Score=13.29  Aligned_cols=50  Identities=14%  Similarity=0.060  Sum_probs=38.4

Q ss_pred             HHHHHHHHHHCCHHHHCCHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCC
Q ss_conf             99998998616967605623379999989748988999999861889843
Q gi|254780528|r   61 VKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYF  110 (396)
Q Consensus        61 l~~i~~~l~~a~~~vw~d~rNv~Aa~iY~lSGG~P~~lr~l~~~d~~~~~  110 (396)
                      +-.-+.........+-..+.+..-++.|+-..|+.++++.|++.+..|.-
T Consensus        38 ~~~~~~~~~~~~~~~~~~~~~g~T~L~~Aa~~g~~~~v~~Ll~~gadG~T   87 (99)
T 2pnn_A           38 ILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLAYILQREIHEPE   87 (99)
T ss_dssp             HHHHHHHHCTTCCGGGCCCTTSCCHHHHHHHTTCHHHHHHHHHHHTC---
T ss_pred             HHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHCCCCCCC
T ss_conf             99831330135220127689998999999984879999999968999999


No 15 
>>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} (A:1-106)
Probab=22.11  E-value=45  Score=13.22  Aligned_cols=42  Identities=10%  Similarity=-0.049  Sum_probs=22.7

Q ss_pred             HHCCHHHHCCHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCC
Q ss_conf             616967605623379999989748988999999861889843
Q gi|254780528|r   69 RATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYF  110 (396)
Q Consensus        69 ~~a~~~vw~d~rNv~Aa~iY~lSGG~P~~lr~l~~~d~~~~~  110 (396)
                      ....+++..-..+.+-++.|+-.+|++++++.|++++...+.
T Consensus        31 l~~g~~~~~~~~~g~t~l~~A~~~~~~~~~~~Ll~~g~din~   72 (106)
T 3b7b_A           31 VQAGANIDTCSEDQRTPLMEAAENNHLEAVKYLIKAGALVDP   72 (106)
T ss_dssp             HHTTCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHTTTCCCCC
T ss_pred             HHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCC
T ss_conf             987989785589999723022222222222102103875440


No 16 
>>2dvw_A 26S proteasome non-ATPase regulatory subunit 10; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.30A {Mus musculus} PDB: 2dwz_A* 1tr4_A 1uoh_A 1qym_A (A:1-98)
Probab=21.37  E-value=46  Score=13.13  Aligned_cols=40  Identities=8%  Similarity=0.005  Sum_probs=21.9

Q ss_pred             HCCHHHHCCHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCC
Q ss_conf             1696760562337999998974898899999986188984
Q gi|254780528|r   70 ATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGY  109 (396)
Q Consensus        70 ~a~~~vw~d~rNv~Aa~iY~lSGG~P~~lr~l~~~d~~~~  109 (396)
                      ....++=.-..+.+-++-|+...|++..++.|+.++...+
T Consensus        28 ~~~~~~~~~d~~g~tpLh~Aa~~g~~~~v~~Ll~~g~~~~   67 (98)
T 2dvw_A           28 ADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVN   67 (98)
T ss_dssp             HCGGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCSC
T ss_pred             HCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             4997476748999899999998642033221222222222


No 17 
>>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} (E:1-195)
Probab=21.14  E-value=47  Score=13.10  Aligned_cols=50  Identities=10%  Similarity=0.111  Sum_probs=24.9

Q ss_pred             HHHHHHHHHHHCCHHHHCCHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCC
Q ss_conf             99999899861696760562337999998974898899999986188984
Q gi|254780528|r   60 IVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGY  109 (396)
Q Consensus        60 Ll~~i~~~l~~a~~~vw~d~rNv~Aa~iY~lSGG~P~~lr~l~~~d~~~~  109 (396)
                      ++..+-..|.....++=....+.+-++.|+...|+.++++.|++.+...+
T Consensus       144 ll~~~~~~Ll~~Gadin~~d~~g~TpL~~A~~~g~~~iv~~Ll~~GAdiN  193 (195)
T 2fo1_E          144 LIVHEAKECIAAGADVNAXDCDENTPLXLAVLARRRRLVAYLXKAGADPT  193 (195)
T ss_dssp             HHHHHHHHHHHTCCCTTCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCCSC
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCHHHHEEHHHCCCCCCC
T ss_conf             98630678997699746447788717999886332544303300343322


No 18 
>>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} (X:349-439)
Probab=20.34  E-value=49  Score=13.00  Aligned_cols=33  Identities=9%  Similarity=0.108  Sum_probs=20.9

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             361000138887666643219899999999999
Q gi|254780528|r  141 NTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVR  173 (396)
Q Consensus       141 lp~~lg~~laLv~a~l~~~~dp~~Al~llD~aR  173 (396)
                      -+..|..-+.|..-=.--++=|.+|+.++|++-
T Consensus        26 ~deal~~aV~LS~rYi~~R~LPDKAIDLLDea~   58 (91)
T 1r6b_X           26 TAKAVRAAVELAVKYINDRHLPDKAIDVIDEAG   58 (91)
T ss_dssp             CHHHHHHHHHHHHHHCTTSCTTHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHH
T ss_conf             135899999989876468889459999999999


Done!