BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780528|ref|YP_003064941.1| chemotaxis protein [Candidatus
Liberibacter asiaticus str. psy62]
         (396 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780528|ref|YP_003064941.1| chemotaxis protein [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040205|gb|ACT57001.1| chemotaxis protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 396

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/396 (100%), Positives = 396/396 (100%)

Query: 1   MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDI 60
           MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDI
Sbjct: 1   MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDI 60

Query: 61  VKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKK 120
           VKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKK
Sbjct: 61  VKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKK 120

Query: 121 YFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTF 180
           YFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTF
Sbjct: 121 YFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTF 180

Query: 181 LEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDED 240
           LEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDED
Sbjct: 181 LEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDED 240

Query: 241 IVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYEN 300
           IVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYEN
Sbjct: 241 IVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYEN 300

Query: 301 ILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLL 360
           ILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLL
Sbjct: 301 ILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLL 360

Query: 361 DKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR 396
           DKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR
Sbjct: 361 DKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR 396


>gi|315122281|ref|YP_004062770.1| chemotaxis protein [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495683|gb|ADR52282.1| chemotaxis protein [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 397

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 313/399 (78%), Gaps = 5/399 (1%)

Query: 1   MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDI 60
           MNQK LI  M++ M+VF SFA +QDL  +  PY  +R LQR LD +++     +KKI DI
Sbjct: 1   MNQKCLIMIMIMVMEVFPSFAMNQDLENSNAPYARIRFLQRVLDSSLQEGGYSKKKILDI 60

Query: 61  VKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKK 120
           V+E G+QLR T+M  F D+RN+DAV+IYTIIS+++S+++ LIA D KGYFD++IV+AL+K
Sbjct: 61  VEEVGLQLRTTNMSFFADHRNVDAVFIYTIISENISILNYLIANDKKGYFDLSIVHALRK 120

Query: 121 YFSGQLEESSKELSKIKDKDNT--RGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPG 178
           YF+G+ EES K L+ IKD D+   +GI PY +LL+GRAMM  +S++A+ FFD VRLTS G
Sbjct: 121 YFAGEFEESIKALNTIKDNDHIHIKGIEPYFYLLMGRAMMKLNSKEAIQFFDRVRLTSSG 180

Query: 179 TFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLP 237
           T LEE++LRNLLEIT N+ + E  FGYIR Y+ QF+HSIYKD+FI++LLRFFLH ++KL 
Sbjct: 181 TALEEMSLRNLLEITLNQGIEEHVFGYIRDYIRQFYHSIYKDNFINLLLRFFLHSKIKLQ 240

Query: 238 DEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQL 297
           D+DIVF +SF  ++EQRAIY KIAQ++VI GKRKIG LAI+QLK ++ +LD++DLATI L
Sbjct: 241 DKDIVFVMSFLEVDEQRAIYFKIAQHAVIFGKRKIGLLAIQQLKEMVYKLDHRDLATIWL 300

Query: 298 YENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKD 357
           Y +++NIPFVD + LQRS CNIP YSLME+DR LKK+SE+I+SE+ KS I+IDF+HI K 
Sbjct: 301 YNDLMNIPFVDTVLLQRSLCNIPEYSLMEKDRNLKKSSEVILSEMRKSSINIDFDHIDKY 360

Query: 358 LLLDKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR 396
           L+LD K+  HT+    +ESFIKKNR +IE IDV L   R
Sbjct: 361 LVLDTKQHEHTH--WNLESFIKKNRQKIEVIDVYLEGTR 397


>gi|116250496|ref|YP_766334.1| chemotaxis protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255144|emb|CAK06218.1| putative chemotaxis MotC protein precursor (motility protein c)
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 431

 Score =  148 bits (373), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 104/395 (26%), Positives = 187/395 (47%), Gaps = 30/395 (7%)

Query: 30  IVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYT 89
           + PY+ +RSLQ   D  + GD S  +    ++     +LR     +F D+RN+DA  IYT
Sbjct: 32  LAPYKMLRSLQFVQDSVVTGDHSAGEMQRFMLGTIDTRLRTVEPSIFDDDRNVDAALIYT 91

Query: 90  IISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYL 149
           +   +   ++ LIA D  GYFD  +   L+KY SG+    +K L +   +   + I PYL
Sbjct: 92  MSGGNPQTLEYLIAHDVNGYFDNRVTDVLRKYLSGKGLLVAKTLQETAREYRDKKIGPYL 151

Query: 150 HLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAY 208
            L+ G  ++      A+  +D  RL +PGT +EE ALR  + I  ++ + +R   Y + Y
Sbjct: 152 ALIGGNVLIATKPTDALDLYDQARLAAPGTIVEEAALRRSVAICVDKGMLDRGMAYSQRY 211

Query: 209 VTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISG 268
           V +F HS Y   F  + +   +     +  +D++  +SF     QR +YL+IA+ + ISG
Sbjct: 212 VRRFLHSPYASQFADLFVTLVVGHDHDVKPQDVIDILSFMDAPRQREVYLRIARAAAISG 271

Query: 269 KRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQD 328
           K ++  +A+ +++ +    D         Y  +  +P  DI    ++   I   +L  +D
Sbjct: 272 KPELARMAVGRVQSLGGGTDNAFGPLADFYGGMAGLPTEDIDQAAKNVSGIDGNALSRRD 331

Query: 329 RYLKKASEIIMSEIGK----------SLIDIDFEHIQKD----LLLDKKEPRHTN--VSM 372
           + L++A+  +  +I +          S ++ D + I  +    + +    P   +  V  
Sbjct: 332 QALQEAARSVAEQILRAPDPASLTQASNLNTDHQEITSEKAAAIAMQPGAPGALSEPVPG 391

Query: 373 GIES-------------FIKKNRSQIESIDVLLAE 394
           G+ S             F+  +RS+++ ID LLA+
Sbjct: 392 GVASTGQSQDTDPSFNAFVTTSRSKLDEIDGLLAQ 426


>gi|218461677|ref|ZP_03501768.1| chemotaxis protein [Rhizobium etli Kim 5]
          Length = 442

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 109/405 (26%), Positives = 192/405 (47%), Gaps = 50/405 (12%)

Query: 30  IVPYQCVRSLQRALDEAMRGDIS---LQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
           + PY+ +RSLQ   D  + GD S   +Q+ +   + E   +LR     ++ D+RN+DA  
Sbjct: 32  LSPYKMLRSLQFVQDSVVAGDHSAGEMQRFMLGTIDE---RLRTADTSIYDDDRNVDAAL 88

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQ-------LEESSKELSKIKDK 139
           IYT+   +   ++ LIA D  GYFD  +   L+KY SG+       LEE+++E    +DK
Sbjct: 89  IYTMSGGNPQTLEYLIAHDVNGYFDNRVTEVLRKYLSGKGLLVARTLEETAREY---RDK 145

Query: 140 DNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VG 198
                I PYL L+ G  ++      A++ +D  RL +PGT +EE ALR  + I  ++ + 
Sbjct: 146 K----IGPYLALIGGNVLIATKPTDALNLYDQARLAAPGTIVEEAALRRSVAICVDKGML 201

Query: 199 ERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYL 258
           +R   Y + Y  +F HS Y   F  + ++  +     +  +D+V  +SF     QR +YL
Sbjct: 202 DRGLAYSQRYARRFLHSPYASQFADLFVKLVVAHDRDVKPQDVVDILSFMDAPRQREVYL 261

Query: 259 KIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCN 318
           +IA+ + ISGK ++  +A+++++ +    D         Y  +  +P  DI    ++   
Sbjct: 262 RIARAAAISGKPELARMAVERVQSLGAGTDNAFGPLADFYGGMAGLPTQDIDQAAKNVSG 321

Query: 319 IPYYSLMEQDRYLKKASEIIMSEIGKS--------LIDIDFEH------------IQKDL 358
           I   +L  +D+ L+ A+  +  +I ++          D +  H            +Q   
Sbjct: 322 IDGKALSPRDQALQAAARSVAEQILRAPDPASLTQASDPNTSHQEITSDKAAANAMQPGA 381

Query: 359 LLDKKEPRHTNVSMGIES---------FIKKNRSQIESIDVLLAE 394
                EP    V+   +S         F+  +RS+++ ID LLA+
Sbjct: 382 PGAHPEPVPGGVASTGQSQDTDPSFNAFVTTSRSKLDEIDGLLAQ 426


>gi|222084881|ref|YP_002543410.1| chemotaxis motility protein [Agrobacterium radiobacter K84]
 gi|221722329|gb|ACM25485.1| chemotaxis motility protein [Agrobacterium radiobacter K84]
          Length = 433

 Score =  147 bits (370), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 104/403 (25%), Positives = 189/403 (46%), Gaps = 45/403 (11%)

Query: 30  IVPYQCVRSLQRALDEAMRGDIS---LQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
           + PY+ +RSL+   D  + GD S   +Q+ +   + E   +LR     VF D+RN+DA  
Sbjct: 32  LPPYKILRSLEFIQDSVVAGDSSAGEMQRFMLSTIDE---RLRNADKSVFDDSRNVDAAL 88

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIV 146
           IY +   +   ++ L+++D  G FD  +   L+KY +G+       L+ I  +   + I 
Sbjct: 89  IYAMSGGNPDTLEYLMSRDVNGNFDNRVADVLRKYLNGKGLLVVNTLADIAREYRDKKIG 148

Query: 147 PYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYI 205
           PYL L+    M   + ++A+  +D+ RL SPGT +EE ALR  L ++ +  +  +  GY 
Sbjct: 149 PYLSLVAANVMSAKNPKEALKLYDWARLASPGTIVEESALRRSLALSADAGMVPQGLGYA 208

Query: 206 RAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSV 265
             Y  +F HS Y   F  + ++  +     +  +DI+  +SF     QR +YL++A+ + 
Sbjct: 209 ARYTRRFLHSPYASQFADLFVQLVVDHDADVKQQDIIDILSFMDPPRQREVYLRMARRAA 268

Query: 266 ISGKRKIGFLAIKQLKRIIDRLDYKDL--ATIQLYENILNIPFVDIMSLQRSTCNIPYYS 323
           I+GK  +  LA  + + I +  D  D   A    Y  +  +   ++ +  R    +P   
Sbjct: 269 IAGKADLAALASGRAQAITN--DGSDAFSALAGFYGGVAGVSTPNMGTAIRKIDQMPAGE 326

Query: 324 LMEQDRYLKKASEIIMSEI-----------GKSLIDIDFEHIQKDLLLDKKEPRHTNVSM 372
           L +QDR L++A+ ++  EI           G  L  ++ EH + D  +  +    +  + 
Sbjct: 327 LNQQDRALREAARLVADEILRAPDPTSLKQGSPLNLLNQEHTEHDAAVTNQSGAQSPGTA 386

Query: 373 GIE-----------------------SFIKKNRSQIESIDVLL 392
           G+E                       +F+  +RS++++ID LL
Sbjct: 387 GVEAGAAVNAAHTPEEGRQEADPSFNAFVTTSRSKLDAIDGLL 429


>gi|241203120|ref|YP_002974216.1| chemotaxis protein [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857010|gb|ACS54677.1| chemotaxis motility protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 431

 Score =  146 bits (369), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 109/405 (26%), Positives = 188/405 (46%), Gaps = 50/405 (12%)

Query: 30  IVPYQCVRSLQRALDEAMRGDIS---LQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
           + PY+ +RSLQ   D  + GD S   +Q+ +   + E   +LR      F D+RN+DA  
Sbjct: 32  LAPYKMLRSLQFVQDSVVSGDHSAGEMQRFMLGTIDE---RLRTVDPSTFDDDRNVDAAL 88

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQ-------LEESSKELSKIKDK 139
           IY +   +   ++ LIA D  GYFD  +   L+KY SG+       LEE+++E    K  
Sbjct: 89  IYAMSGGNPQTLEYLIAHDVNGYFDNRVTDVLRKYLSGKGLLVAKTLEETAREYRDKK-- 146

Query: 140 DNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VG 198
                I PYL L+ G  ++      A+  +D  RL +PGT +EE ALR  + I  ++ + 
Sbjct: 147 -----IGPYLALIGGNVLIATKPTDALDLYDQARLAAPGTIVEEAALRRSVAICVDKGML 201

Query: 199 ERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYL 258
           +R   Y + YV +F HS Y   F  + +   +     +  +D++  +SF     QR +YL
Sbjct: 202 DRGMAYSQRYVRRFLHSPYASQFADLFVTLVVGHDHDVKPQDVIDILSFMDAPRQREVYL 261

Query: 259 KIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCN 318
           +IA+ + ISGK ++  +A+ +++ +    D    +    Y  +  +P  DI    ++   
Sbjct: 262 RIARAAAISGKPELARMAVGRVQSLGAGTDNPFGSLADFYGGMAGLPTEDIDQAAKNVSG 321

Query: 319 IPYYSLMEQDRYLKKASEIIMSEIGKS--------LIDIDFEH------------IQKDL 358
           I   +L  +D+ L++A+  +  +I ++          D + +H             Q   
Sbjct: 322 IDGNALSPRDQALQEAARSVADQILRAPDPASLTQASDPNTDHQEITSEKAAAIATQPGA 381

Query: 359 LLDKKEPRHTNVSMGIES---------FIKKNRSQIESIDVLLAE 394
                EP    V+   +S         F+  NRS+++ ID LLA+
Sbjct: 382 PGALPEPVPGGVASTGQSQDTDPSFNAFVTTNRSKLDEIDGLLAQ 426


>gi|218680024|ref|ZP_03527921.1| chemotaxis protein [Rhizobium etli CIAT 894]
          Length = 357

 Score =  146 bits (368), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 89/314 (28%), Positives = 157/314 (50%), Gaps = 1/314 (0%)

Query: 30  IVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYT 89
           + PY+ +RSLQ   D  + GD S  +    ++     +LR     VF D+RN+DA  IY 
Sbjct: 38  LAPYKMLRSLQFVQDSVVGGDHSAGEMQRFMLGTIDQRLRTVETSVFEDDRNVDAALIYA 97

Query: 90  IISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYL 149
           +   +   ++ LIA D  GYFD  +   L+KY SG+    +K L ++  +   + I PYL
Sbjct: 98  MSGGNPQTLEYLIAHDVNGYFDNRVTDVLRKYLSGKGLLVAKTLEEMAREYRDKKIGPYL 157

Query: 150 HLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAY 208
            L+ G  ++      A+  +D  RL +PGT +EE ALR  + I  ++ + ++   Y + Y
Sbjct: 158 ALIGGNVLIATKPTDALDLYDQARLAAPGTIVEEAALRRSVAICVDKGLLDKGMAYSQRY 217

Query: 209 VTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISG 268
           V +F HS Y   F  + +   +     +  +D+V  +SF     QR +YL+IA+ + ISG
Sbjct: 218 VRRFLHSPYASQFADLFVALVVGHDHDVKPQDVVDILSFMDAPRQREVYLRIARAAAISG 277

Query: 269 KRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQD 328
           K  +  +A+++++ +    D         Y  +  +P  DI    ++   I   +L  +D
Sbjct: 278 KPDLAHMAVERVQSLGAGTDNAFGPLADFYGGMAGLPTEDIDRAAKNVSGIAGNALSPRD 337

Query: 329 RYLKKASEIIMSEI 342
           + L+ A++ +  +I
Sbjct: 338 QALQAAAQSVAEQI 351


>gi|327193054|gb|EGE59966.1| chemotaxis motility protein [Rhizobium etli CNPAF512]
          Length = 431

 Score =  142 bits (358), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/324 (28%), Positives = 163/324 (50%), Gaps = 21/324 (6%)

Query: 30  IVPYQCVRSLQRALDEAMRGDIS---LQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
           + PY+ +RSLQ   D  + GD S   +Q+ +   + E   +LR     ++ D+RN+DA  
Sbjct: 32  LSPYKMLRSLQFVQDSVVAGDHSAGEMQRFMLGTIDE---RLRTADTSIYDDDRNVDAAL 88

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQ-------LEESSKELSKIKDK 139
           IY +   +   ++ LIA D  GYFD  +   L+KY SG+       LEE+++E    +DK
Sbjct: 89  IYAMSGGNPQTLEYLIAHDVNGYFDNRVTDVLRKYLSGKGLLVAKTLEETAREY---RDK 145

Query: 140 DNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VG 198
                I PYL L+ G  ++      A+  +D  RL +PGT +EE ALR  + I  ++ + 
Sbjct: 146 K----IGPYLALIGGNVLIATKPTDALDLYDQARLAAPGTIVEEAALRRSVAICVDKGLL 201

Query: 199 ERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYL 258
           ++   Y + Y  +F HS Y   F  + ++  +     +  +D+V  +SF     QR +YL
Sbjct: 202 DKGLAYSQRYARRFLHSPYASQFADLFVKLVVAHDRDVKPQDVVDILSFMDAPRQREVYL 261

Query: 259 KIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCN 318
           +IA+ + ISGK ++  +A+++++ +    D         Y  +  +P  DI    ++   
Sbjct: 262 RIARAAAISGKPELARMAVERVQSLGAGTDNAFGPLADFYGGMAGLPTQDIDQAAKNVSG 321

Query: 319 IPYYSLMEQDRYLKKASEIIMSEI 342
           I   +L  +D+ L+ A+  +  +I
Sbjct: 322 IDGNALSPRDQALQAAARSVAEQI 345


>gi|190890378|ref|YP_001976920.1| chemotaxis motility protein [Rhizobium etli CIAT 652]
 gi|190695657|gb|ACE89742.1| chemotaxis motility protein [Rhizobium etli CIAT 652]
          Length = 431

 Score =  139 bits (351), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 90/324 (27%), Positives = 161/324 (49%), Gaps = 21/324 (6%)

Query: 30  IVPYQCVRSLQRALDEAMRGDIS---LQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
           + PY+ +RSLQ   D  + GD S   +Q+ +   + E   +LR     ++ D+RN+DA  
Sbjct: 32  LSPYKMLRSLQFVQDSVVAGDHSAGEMQRFMLGTIDE---RLRTADTAIYDDDRNVDAAL 88

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQ-------LEESSKELSKIKDK 139
           IY +   +   ++ LIA D  GYFD  +   L+KY SG+       LEE+++E  + K  
Sbjct: 89  IYAMSGGNPQTLEYLIAHDVNGYFDNRVTDVLRKYLSGKGLLVAKTLEETAREYREKK-- 146

Query: 140 DNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VG 198
                I PYL L+ G  ++      A+  +D  RL +PGT +EE ALR  + I  ++ + 
Sbjct: 147 -----IGPYLALIGGNVLIATKPTDALDLYDQARLAAPGTIVEEAALRRSVAICVDKGML 201

Query: 199 ERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYL 258
           ++   Y + Y  +F HS Y   F  + ++  +     +  +D+V  +S      QR +YL
Sbjct: 202 DKGLAYSQRYARRFLHSPYASQFADLFVKLVVAHDRDVKPQDVVDILSLMDAPRQREVYL 261

Query: 259 KIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCN 318
           +IA+ + ISGK ++  +A+++++ +    D         Y  +  +P  DI    ++   
Sbjct: 262 RIARAAAISGKPELARMAVERVQSLGAGTDNAFGPLADFYGGMAGLPTQDIDRAAKNVSG 321

Query: 319 IPYYSLMEQDRYLKKASEIIMSEI 342
           I   +L  +D+ L+ A+  +  +I
Sbjct: 322 IDGNALSPRDQALQAAARSVAEQI 345


>gi|307318925|ref|ZP_07598356.1| chemotaxis protein [Sinorhizobium meliloti AK83]
 gi|306895339|gb|EFN26094.1| chemotaxis protein [Sinorhizobium meliloti AK83]
          Length = 434

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 151/308 (49%), Gaps = 7/308 (2%)

Query: 30  IVPYQCVRSLQRALDEAMRGD---ISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
           + PY+ +RSLQ   D  + GD   I +Q+ +   + E   +LRA     F D RN+DA  
Sbjct: 31  LTPYKMIRSLQYVQDSVVLGDHSAIEMQRFMLGAIDE---RLRAADPSAFRDPRNVDAAL 87

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIV 146
           +Y +   + + +D L  +D +G FD  +  AL++Y +G+     + L+K   +     I 
Sbjct: 88  VYVMSGGNPATLDLLADRDIEGNFDSRVTDALRQYLNGKGPLIVENLTKAAPEYKNSRIG 147

Query: 147 PYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEI-TQNEVGERAFGYI 205
           PYL L++G AM      +A+  +D+ RLT+PGT +EE ALR  + +  Q  + E+ F Y 
Sbjct: 148 PYLFLILGNAMSQQDPIEAMKHYDWARLTAPGTIIEEAALRRSVSLAAQAGLPEKGFRYA 207

Query: 206 RAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSV 265
             Y  ++  S Y   F  V +   +    +  D  +   +SF     QR +YL++A+ + 
Sbjct: 208 LNYARRYLTSPYASQFADVFVELAVAHFDEAADGRVSEILSFMDSARQREVYLRVARRAA 267

Query: 266 ISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLM 325
           I+G + +  LA ++ + +      +       YE +  +P  D+ S   +   IP   L 
Sbjct: 268 IAGNQALARLASRRAEELAGDDSSRSQVLASFYEGLAAVPSADVFSAAEALEAIPDEKLS 327

Query: 326 EQDRYLKK 333
            +DR L++
Sbjct: 328 PRDRALRE 335


>gi|307311570|ref|ZP_07591211.1| chemotaxis protein [Sinorhizobium meliloti BL225C]
 gi|306899587|gb|EFN30216.1| chemotaxis protein [Sinorhizobium meliloti BL225C]
          Length = 434

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 151/308 (49%), Gaps = 7/308 (2%)

Query: 30  IVPYQCVRSLQRALDEAMRGD---ISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
           + PY+ +RSLQ   D  + GD   I +Q+ +   + E   +LRA     F D RN+DA  
Sbjct: 31  LTPYKMIRSLQYVQDSVVLGDHSAIEMQRFMLGAIDE---RLRAADHSAFRDPRNVDAAL 87

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIV 146
           +Y +   + + +D L  +D +G FD  +  AL++Y +G+     + L+K   +     I 
Sbjct: 88  VYVMSGGNPATLDLLADRDIEGNFDSRVTDALRQYLNGKGPLIVENLTKAAPEYKNSRIG 147

Query: 147 PYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEI-TQNEVGERAFGYI 205
           PYL L++G AM      +A+  +D+ RLT+PGT +EE ALR  + +  Q  + E+ F Y 
Sbjct: 148 PYLFLILGNAMSQQDPIEAMKHYDWARLTAPGTIIEEAALRRSVSLAAQAGLPEKGFRYA 207

Query: 206 RAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSV 265
             Y  ++  S Y   F  V +   +    +  D  +   +SF     QR +YL++A+ + 
Sbjct: 208 LNYARRYLTSPYASQFADVFVELAVAHFDEAADGRVSEILSFMDSARQREVYLRVARRAA 267

Query: 266 ISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLM 325
           I+G + +  LA ++ + +      +       YE +  +P  D+ S   +   IP   L 
Sbjct: 268 IAGNQALARLASRRAEELAGDDSSRSQVLASFYEGLAAVPSADVFSAAEALEAIPDEKLS 327

Query: 326 EQDRYLKK 333
            +DR L++
Sbjct: 328 PRDRALRE 335


>gi|15887915|ref|NP_353596.1| chemotaxis protein [Agrobacterium tumefaciens str. C58]
 gi|15155509|gb|AAK86381.1| Chemotaxis protein [Agrobacterium tumefaciens str. C58]
          Length = 426

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 91/325 (28%), Positives = 159/325 (48%), Gaps = 4/325 (1%)

Query: 19  SFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVD 78
           +F+  QD    ++PY  +RSLQ   D    GD S  +    +++    +L++    +F D
Sbjct: 27  AFSQSQD---NLMPYAMLRSLQFVQDSVAMGDHSASEMQRFLLQTIDERLKSAPSAIFKD 83

Query: 79  NRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKD 138
            RN+DA  IY +   + + ++ L+A+D  G FD  +   L+KY SG+    ++ ++ +  
Sbjct: 84  PRNVDAALIYAMSGGNPATLELLVARDVDGNFDSRVADILRKYLSGKGTLVAQSIAAMVP 143

Query: 139 KDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEIT-QNEV 197
           +     I  YL L+ G   +P     A+ F+D  RL +PGT +EE ALR  L I  ++  
Sbjct: 144 EYRGTRIGAYLALIGGNVTIPRDPLAALTFYDIARLEAPGTIVEEAALRRSLAIAVEDGD 203

Query: 198 GERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIY 257
             +   Y + Y  +F HS Y   F  +L+   +     + +E I  T +    E Q+  Y
Sbjct: 204 ATKGVDYAQRYARRFLHSPYASQFADLLVSLVVKRADSIGEEAIQETFAMMDAERQKEAY 263

Query: 258 LKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTC 317
           L++++ + ISGK  +  +A  + K +   L         LYE++ NI   D++S   +  
Sbjct: 264 LRLSRLAAISGKDSLARMAAVKAKTLSPALPGTPEVQANLYESLSNIGTPDVVSAIEAIG 323

Query: 318 NIPYYSLMEQDRYLKKASEIIMSEI 342
            IP   L ++DR L+ A+  I  ++
Sbjct: 324 QIPEAQLSDRDRALRDAARAIADQV 348


>gi|82940570|emb|CAJ44301.1| putative Chemotaxis precursor (Motility protein C MotC) [Rhizobium
           leguminosarum bv. viciae]
          Length = 334

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 91/313 (29%), Positives = 154/313 (49%), Gaps = 21/313 (6%)

Query: 30  IVPYQCVRSLQRALDEAMRGDIS---LQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
           + PY+ +RSLQ   D  + GD S   +Q+ +   + E   +LR      F D+RN+DA  
Sbjct: 32  LAPYKMLRSLQFVQDSVVSGDHSAGEMQRFMLGTIDE---RLRTVDPSTFDDDRNVDAAL 88

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQ-------LEESSKELSKIKDK 139
           IY +   +   ++ LIA D  GYFD  +   L+KY SG+       LEE+++E    K  
Sbjct: 89  IYAMSGGNPQTLEYLIAHDVNGYFDNRVTDVLRKYLSGKGLLVAKTLEETAREYRDKK-- 146

Query: 140 DNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VG 198
                I PYL L+ G  ++      A+  +D  RL +PGT +EE ALR  + I  ++ + 
Sbjct: 147 -----IGPYLALIGGNVLIATKPTDALDLYDQARLAAPGTIVEEAALRRSVAICVDKGML 201

Query: 199 ERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYL 258
           ++   Y + YV +F HS Y   F  + +   +     +  +D++  +SF     QR +YL
Sbjct: 202 DKGMAYSQRYVRRFLHSPYASQFADLFVTLVVGHDHDVKPQDVIDILSFMDAPRQREVYL 261

Query: 259 KIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCN 318
           +IA+ + ISGK ++  +A+ +++ +    D        LY  +  +P  DI    ++   
Sbjct: 262 RIARAAAISGKPELARMAVGRVQSLGAATDNAFGPLADLYGGMAGLPTEDIDRAAKNVSG 321

Query: 319 IPYYSLMEQDRYL 331
           I   +L  +D+ L
Sbjct: 322 IDGNTLSPRDQAL 334


>gi|2275157|gb|AAB81409.1| MotC [Sinorhizobium meliloti]
          Length = 434

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 90/312 (28%), Positives = 153/312 (49%), Gaps = 15/312 (4%)

Query: 30  IVPYQCVRSLQRALDEAMRGD---ISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
           + PY+ +RSLQ   D  + GD   I +Q+ +   + E   +LRA     F D RN+DA  
Sbjct: 31  LTPYKMIRSLQYVQDSVVLGDHSAIEMQRFMLGAIDE---RLRAADPSAFRDPRNVDAAL 87

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIV 146
           +Y +   + + +D L  +D +G FD  +  AL++Y +G+     + L+K   +     I 
Sbjct: 88  VYVMSGGNPATLDLLADRDIEGNFDSRVTDALRQYLNGKGPLIVENLTKAAPEYKNSRIG 147

Query: 147 PYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN----EVGER-A 201
           PYL L++G AM      +A+  +D+ RLT+PGT +EE ALR  + +       E G R A
Sbjct: 148 PYLFLILGNAMSQQDPIEAMKHYDWARLTAPGTIIEEAALRRSVSLAAGAGLPEKGFRYA 207

Query: 202 FGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
             Y R Y+T  + S + D F+ + +  F        D  +   +SF     QR +YL++A
Sbjct: 208 LNYARRYLTSPYASQFADVFVELAVAHFDEAA----DGRVSEILSFMDSARQREVYLRVA 263

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
           + + I+G + +  LA ++ + +      +       YE +  +P  D+ S   +   IP 
Sbjct: 264 RRAAIAGNQALARLASRRAEELAGDDSSRSQVLASFYEGLAAVPSADVFSAAEALEAIPD 323

Query: 322 YSLMEQDRYLKK 333
             L  +DR L++
Sbjct: 324 EKLSPRDRALRE 335


>gi|150395499|ref|YP_001325966.1| chemotaxis protein [Sinorhizobium medicae WSM419]
 gi|150027014|gb|ABR59131.1| chemotaxis precursor (motility protein C) transmembrane
           [Sinorhizobium medicae WSM419]
          Length = 433

 Score =  137 bits (345), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 86/306 (28%), Positives = 150/306 (49%), Gaps = 7/306 (2%)

Query: 30  IVPYQCVRSLQRALDEAMRGD---ISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
           + P++ +RSLQ   D  + GD   I +Q+ +   + E   +LRA     F D RN+DA  
Sbjct: 31  LAPFKMIRSLQYVQDSVVLGDHSAIEMQRFMLGAIDE---RLRAADPSAFRDPRNVDAAL 87

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIV 146
           +Y +   + + +D L  +D +G FD  +  AL++Y +G+     + L+K   +     I 
Sbjct: 88  VYVMSGGNPATLDLLADRDIEGNFDSRVTDALRQYLNGKGPLIVENLTKAAPEYKNSRIG 147

Query: 147 PYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEI-TQNEVGERAFGYI 205
           PYL L++G AM      +A+  +D+ RLT+PGT +EE ALR  + +  Q  + E+ F Y 
Sbjct: 148 PYLFLILGNAMSQQDPIEAMKHYDWARLTAPGTIIEEAALRRSVSLAAQAGLPEKGFRYA 207

Query: 206 RAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSV 265
             Y  ++  S Y   F  V +   +    +  D  +   +SF     QR +YL++A+ + 
Sbjct: 208 LNYARRYLTSPYASQFADVFVELAVAHFDESADGRVSEILSFMDSARQREVYLRVARRAA 267

Query: 266 ISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLM 325
           I+G + +  +A K+ + ++     +       YE +  +P  D+ S   +   IP   L 
Sbjct: 268 IAGNQALARVASKRAEELVGDDGSRSQMLASFYEGLAAVPSADVFSAAEALAAIPDDKLS 327

Query: 326 EQDRYL 331
            +DR L
Sbjct: 328 PRDRAL 333


>gi|15964428|ref|NP_384781.1| chemotaxis protein [Sinorhizobium meliloti 1021]
 gi|17380484|sp|Q52963|MOTC_RHIME RecName: Full=Chemotaxis protein motC; AltName: Full=Motility
           protein C; Flags: Precursor
 gi|15073605|emb|CAC45247.1| Chemotaxis precursor (motility protein C) transmembrane
           [Sinorhizobium meliloti 1021]
          Length = 434

 Score =  137 bits (344), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 86/308 (27%), Positives = 151/308 (49%), Gaps = 7/308 (2%)

Query: 30  IVPYQCVRSLQRALDEAMRGD---ISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
           + PY+ +RSLQ   D  + GD   I +Q+ +   + E   +LRA     F D RN+DA  
Sbjct: 31  LTPYKMIRSLQYVQDSVVLGDHSAIEMQRFMLGAIDE---RLRAADHSAFRDPRNVDAAL 87

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIV 146
           +Y +   + + +D L  +D +G FD  +  AL++Y +G+     + L+K   +     I 
Sbjct: 88  VYVMSGGNPATLDLLADRDIEGNFDSRVTDALRQYLNGKGPLIVENLTKAAPEYKNSRIG 147

Query: 147 PYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEI-TQNEVGERAFGYI 205
           PYL L++G AM      +A+  +D+ RLT+PGT +EE ALR  + +  Q  + E+ F Y 
Sbjct: 148 PYLFLILGNAMSQQDPIEAMKHYDWARLTAPGTIIEEAALRRSVSLAAQAGLPEKGFRYA 207

Query: 206 RAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSV 265
             Y  ++  S +   F  V +   +    +  D  +   +SF     QR +YL++A+ + 
Sbjct: 208 LNYARRYLTSPFASQFADVFVELAVAHFDEAADGRVSEILSFMDSARQREVYLRVARRAA 267

Query: 266 ISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLM 325
           I+G + +  LA ++ + +      +       YE +  +P  D+ S   +   IP   L 
Sbjct: 268 IAGNQALARLASRRAEELAGDDSSRSQVLASFYEGLAAVPSADVFSAAEALEAIPDEKLS 327

Query: 326 EQDRYLKK 333
            +DR L++
Sbjct: 328 PRDRALRE 335


>gi|209547942|ref|YP_002279859.1| chemotaxis protein [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209533698|gb|ACI53633.1| chemotaxis motility protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 431

 Score =  137 bits (344), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 109/405 (26%), Positives = 193/405 (47%), Gaps = 50/405 (12%)

Query: 30  IVPYQCVRSLQRALDEAMRGDIS---LQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
           + PY+ +RSLQ   D  + GD S   +Q+ +   + E   +LR+    VF D+RN+DA  
Sbjct: 32  LAPYKMLRSLQFVQDSVVSGDHSAGEMQRFMLGTIDE---RLRSVDTSVFDDDRNVDAAL 88

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQ-------LEESSKELSKIKDK 139
           IY +   +   ++ LIA D  G+FD  +   L+KY SG+       LEE+++E    +DK
Sbjct: 89  IYAMSGGNPQTLEYLIAHDVNGHFDNRVTDVLRKYLSGKGLLVAKTLEETAREY---RDK 145

Query: 140 DNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VG 198
                I PYL L+ G  ++  +   A+  +D  RL +PGT +EE ALR  + I  ++ + 
Sbjct: 146 K----IGPYLALIGGNVLIATNPTDALDLYDQARLAAPGTIVEEAALRRSVAICVDKGML 201

Query: 199 ERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYL 258
           +R   Y + Y+ +F HS Y   F  + +   +     +  +D++  +SF     QR +YL
Sbjct: 202 DRGMAYSQRYIRRFLHSPYASQFADLFVTLVVGHDHDVKPQDVIDILSFMDAPRQREVYL 261

Query: 259 KIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCN 318
           +IA+ + I+GK ++  +A+++++ +    D         Y  +  +P  DI    ++   
Sbjct: 262 RIARAAAIAGKPQLAHMAVERVQSLGAGTDNAFGPLADFYGGMAGLPTEDIDQAAKNVSG 321

Query: 319 IPYYSLMEQDRYLKKASEIIMSEI-----GKSLIDIDFEHIQKDLLLDKK---------- 363
           I   +L  +D+ L++A+  +  +I       SL      +     +  +K          
Sbjct: 322 IAGNTLSPRDQALQEAARSVAEQILRAPDPASLTQASDPNTSDQEITSEKAAAIAPQPGA 381

Query: 364 -----EP-----RHTNVSMGIE----SFIKKNRSQIESIDVLLAE 394
                EP       T  S G +    +F+  NRS+++ ID LLA+
Sbjct: 382 PGALPEPVPGGVASTGQSQGTDPSFNAFVTTNRSKLDEIDGLLAQ 426


>gi|27763657|gb|AAO20255.1| MotC [Agrobacterium sp. H13-3]
          Length = 425

 Score =  136 bits (342), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 92/325 (28%), Positives = 160/325 (49%), Gaps = 6/325 (1%)

Query: 20  FATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDN 79
           FA  QD    ++PY  +RSLQ   D    GD S  +    +++    +L++    +F D 
Sbjct: 28  FAQSQD---NLMPYAMLRSLQFVQDSVTMGDHSATEMQRFLLQTIDERLKSAPSAIFKDP 84

Query: 80  RNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSK-IKD 138
           RN+DA  +Y +   + + ++ L+A+D  G FD  +   L+KY SG+    ++ ++  + +
Sbjct: 85  RNVDAALVYAMSGGNPATLELLVARDVDGNFDSRVADILRKYLSGKGTLVAQSIAAMVPE 144

Query: 139 KDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEIT-QNEV 197
              TR I  YL L+ G   +P     A+ F+D  RL +PGT +EE ALR  L I  ++  
Sbjct: 145 YRGTR-IGAYLALIGGNVTIPRDPVAALGFYDIARLEAPGTIVEEAALRRSLAIAVEDGD 203

Query: 198 GERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIY 257
             R   Y + Y  +F HS Y   F  +L+   +     +  + I  T +    E Q+  Y
Sbjct: 204 AGRGVEYAQRYARRFLHSPYASQFADLLVSLVVKRVDSIGHDTIEETFAMMDAERQKEAY 263

Query: 258 LKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTC 317
           L++++ + ISGK  +  +A  + K +   +  +      LYE++ NI   D++S   +  
Sbjct: 264 LRLSRLAAISGKDSLARMAALKAKALSPDMPDQPQVQANLYESLSNIGTPDVVSAIETIG 323

Query: 318 NIPYYSLMEQDRYLKKASEIIMSEI 342
            IP   L ++DR L+ A+  I  ++
Sbjct: 324 QIPEAQLSDRDRALRDAARAIADQV 348


>gi|325291957|ref|YP_004277821.1| Chemotaxis protein motC [Agrobacterium sp. H13-3]
 gi|325059810|gb|ADY63501.1| Chemotaxis protein motC [Agrobacterium sp. H13-3]
          Length = 423

 Score =  135 bits (341), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 92/325 (28%), Positives = 160/325 (49%), Gaps = 6/325 (1%)

Query: 20  FATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDN 79
           FA  QD    ++PY  +RSLQ   D    GD S  +    +++    +L++    +F D 
Sbjct: 26  FAQSQD---NLMPYAMLRSLQFVQDSVTMGDHSATEMQRFLLQTIDERLKSAPSAIFKDP 82

Query: 80  RNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSK-IKD 138
           RN+DA  +Y +   + + ++ L+A+D  G FD  +   L+KY SG+    ++ ++  + +
Sbjct: 83  RNVDAALVYAMSGGNPATLELLVARDVDGNFDSRVADILRKYLSGKGTLVAQSIAAMVPE 142

Query: 139 KDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEIT-QNEV 197
              TR I  YL L+ G   +P     A+ F+D  RL +PGT +EE ALR  L I  ++  
Sbjct: 143 YRGTR-IGAYLALIGGNVTIPRDPVAALGFYDIARLEAPGTIVEEAALRRSLAIAVEDGD 201

Query: 198 GERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIY 257
             R   Y + Y  +F HS Y   F  +L+   +     +  + I  T +    E Q+  Y
Sbjct: 202 AGRGVEYAQRYARRFLHSPYASQFADLLVSLVVKRVDSIGHDTIEETFAMMDAERQKEAY 261

Query: 258 LKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTC 317
           L++++ + ISGK  +  +A  + K +   +  +      LYE++ NI   D++S   +  
Sbjct: 262 LRLSRLAAISGKDSLARMAALKAKALSPDMPDQPQVQANLYESLSNIGTPDVVSAIETIG 321

Query: 318 NIPYYSLMEQDRYLKKASEIIMSEI 342
            IP   L ++DR L+ A+  I  ++
Sbjct: 322 QIPEAQLSDRDRALRDAARAIADQV 346


>gi|163758027|ref|ZP_02165115.1| chemotaxis motility protein [Hoeflea phototrophica DFL-43]
 gi|162284316|gb|EDQ34599.1| chemotaxis motility protein [Hoeflea phototrophica DFL-43]
          Length = 566

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 94/330 (28%), Positives = 160/330 (48%), Gaps = 12/330 (3%)

Query: 18  FSFATDQDLVRTIVPYQCVRSLQRALDEAMRGD---ISLQKKIPDIVKETGVQLRATHMD 74
           F   +D D    + PY+ +RSLQ   D  + GD   + +Q+ +  ++     +LRA    
Sbjct: 156 FPMPSDLD---GLEPYKLIRSLQYVQDAVVLGDHSAMEMQRFLLGVIDS---RLRAADQS 209

Query: 75  VFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELS 134
           VF D RN+DA  IY +   +   ++ L  +D  G FD  I   L+ Y +G+  ++   L+
Sbjct: 210 VFDDPRNVDAALIYAMSGGNPETLEILALQDKFGNFDNEITTVLRAYLNGRAAKTQTTLA 269

Query: 135 KIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEI-- 192
           ++        I PYL L+        +   A+  FD+ RLT+PGT +EE ALR  L I  
Sbjct: 270 EVVAIYRDSRIGPYLTLIAANVTAALNDPAALELFDWARLTAPGTLVEEAALRRSLFIAA 329

Query: 193 TQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEE 252
            QN V E A  Y + Y  +F +S Y   +  +L+   +    K+ D+ +   ++F     
Sbjct: 330 AQNMVDE-ALEYAQLYARRFINSPYAGQYADLLVDLVVLNYEKVGDDQLNAILTFMDRPR 388

Query: 253 QRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSL 312
           +R +YL+IA+ +VISG R +   A  + + +    D   LA   LY  +  +P   + ++
Sbjct: 389 KREVYLRIARKAVISGLRDLAVFASGKAEELASPEDRIPLALADLYAGMAKVPTDGVDAV 448

Query: 313 QRSTCNIPYYSLMEQDRYLKKASEIIMSEI 342
                 +    L  +DR L+ A++I+ +E+
Sbjct: 449 LEELNAVSERQLSPRDRALRTAAQIVAAEV 478


>gi|86356326|ref|YP_468218.1| chemotaxis protein [Rhizobium etli CFN 42]
 gi|86280428|gb|ABC89491.1| chemotaxis motility protein [Rhizobium etli CFN 42]
          Length = 431

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 93/324 (28%), Positives = 161/324 (49%), Gaps = 21/324 (6%)

Query: 30  IVPYQCVRSLQRALDEAMRGDIS---LQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
           + PY+ +RSLQ   D  + GD S   +Q+ +   + E   +LR     +F D+RN+DA  
Sbjct: 32  LAPYKMLRSLQFVQDSVVAGDHSAGEMQRFMLGTIDE---RLRTADTKIFDDDRNVDAAL 88

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQ-------LEESSKELSKIKDK 139
           IYT+   +   ++ LIA D  GYFD  +   L+KY +G+       LEE+++E    K  
Sbjct: 89  IYTMSGGNPQTLEYLIAHDVNGYFDNRVTDVLRKYLTGKGLLVAKTLEETAREYRDKK-- 146

Query: 140 DNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VG 198
                I PYL L+ G  M+      A+  +D  RL +PGT +EE ALR  L I  ++ + 
Sbjct: 147 -----IGPYLALIGGNVMIATKPTDALDLYDQARLAAPGTIVEEAALRRSLAICVDKGML 201

Query: 199 ERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYL 258
           ++   Y + Y  +F HS Y   F  + ++  +     +  +D+V  +SF     QR +YL
Sbjct: 202 DKGLAYSQRYARRFLHSPYASQFADLFVKLVVAHDHDVKPQDVVDILSFMDAPRQREVYL 261

Query: 259 KIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCN 318
           +IA+ + I+GK ++  +A++ ++ +    D         Y  +  +P  DI    ++   
Sbjct: 262 RIARAAAIAGKPELARMAVEHVQLLGAGTDNAFGPLADFYGGMAGLPTDDIDQAAKNVSG 321

Query: 319 IPYYSLMEQDRYLKKASEIIMSEI 342
           I   +L  +D+ L+ A+  +  +I
Sbjct: 322 IDGEALSPRDQALQAAARSVAEQI 345


>gi|222147585|ref|YP_002548542.1| chemotaxis protein [Agrobacterium vitis S4]
 gi|221734573|gb|ACM35536.1| Chemotaxis protein [Agrobacterium vitis S4]
          Length = 483

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 92/315 (29%), Positives = 150/315 (47%), Gaps = 4/315 (1%)

Query: 30  IVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYT 89
           + PY  +RSLQ   D  +RGD S       ++     +LR      F D RN+DA  IYT
Sbjct: 74  LPPYLMLRSLQFVQDSVVRGDHSAADMQRFLLTRIDKRLRTAAPSDFEDPRNVDAALIYT 133

Query: 90  IISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYL 149
           +   + + +D L+A+D  G+FD  +   L+KY SG+    +  L ++        + PY+
Sbjct: 134 MSGGNPATLDYLVARDVDGHFDNRVSDMLRKYLSGKGVLVASSLGEMVPLYQNGRVGPYI 193

Query: 150 HLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGE--RAFGYIRA 207
            L+ G   +      A+ FFD  RL +PGT +EE ALR   +I   + G+  RA  Y   
Sbjct: 194 ALVAGNVTLVKDPAGALKFFDIARLVAPGTIVEEAALRRSFQIAM-DTGQNGRAMAYANR 252

Query: 208 YVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVIS 267
           Y  +F +S Y   F  +L++  +    +L   DI+ T++    + QR +YL+IA+ + I+
Sbjct: 253 YARRFLYSPYASQFADLLVQLVVDHFSELDKNDILATLATMDPDRQREVYLRIARRATIN 312

Query: 268 GKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQ 327
           G + +  LA  Q + +    D  D   + LY     I   D+ +   +   +P   L   
Sbjct: 313 GNQALASLASSQAQSLAGLPDKNDPQAL-LYGGAALISTTDVKNALNTISQLPKDQLSAS 371

Query: 328 DRYLKKASEIIMSEI 342
           D  L +A+  +  EI
Sbjct: 372 DNALLEAARAVAQEI 386


>gi|227820871|ref|YP_002824841.1| chemotaxis protein [Sinorhizobium fredii NGR234]
 gi|227339870|gb|ACP24088.1| chemotaxis protein motility protein C [Sinorhizobium fredii NGR234]
          Length = 435

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 87/340 (25%), Positives = 164/340 (48%), Gaps = 6/340 (1%)

Query: 6   LICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETG 65
           ++ T ++A+ +    A   +    + P++ VRSLQ   D  + GD S  +    ++ +  
Sbjct: 8   ILATSVLAVPLAIGLARASE-TEELAPFKMVRSLQYVQDSVVLGDHSAIEMQRFMLNKID 66

Query: 66  VQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQ 125
            +LRA    +F D RN+DA  +Y +   +   +D L  +D +G FD  +  AL++Y  G+
Sbjct: 67  KRLRAADEAIFRDPRNVDAALVYVMSGGNPETLDYLTDRDVEGNFDARVAEALRQYLRGK 126

Query: 126 LEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIA 185
                + L+K   +     + PYL L++G A        A+ ++D+ RLT+PGT +EE A
Sbjct: 127 GPLIVENLAKAAPEYKNSRVGPYLFLILGNATSQQDPVAAMKYYDWARLTAPGTIIEEAA 186

Query: 186 LRNLLEIT-QNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFT 244
           LR  + +  Q    E+ F Y   Y  ++  S Y   F  V +   +    +  ++ +   
Sbjct: 187 LRRSVSLAVQAGDPEKGFRYALNYARRYLTSPYASQFADVFVELAVTHFDETVEKRVAEI 246

Query: 245 ISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATI--QLYENIL 302
           ++F     QR +YL++A+ + I G + +  LA  + + +   LD    + +    Y+ + 
Sbjct: 247 LAFMDQSRQREVYLRVARRAAIGGNQTLARLASSRAEELA--LDGGGQSQLLASFYDGLA 304

Query: 303 NIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEI 342
            +P  D+ +  ++   IP   L  +DR L++A+  I  E+
Sbjct: 305 AVPSEDVFTAAQTLAAIPDGKLSRRDRALREAARAIAEEV 344


>gi|218675466|ref|ZP_03525135.1| chemotaxis protein [Rhizobium etli GR56]
          Length = 239

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 115/216 (53%), Gaps = 1/216 (0%)

Query: 67  QLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQL 126
           +LR     ++ D+RN+DA  IY +   +   ++ LIA D  GYFD  +   L+KY +G+ 
Sbjct: 12  RLRTADTSIYDDDRNVDAALIYAMSGGNPQTLEYLIAHDVNGYFDNRVTDVLRKYLTGKG 71

Query: 127 EESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIAL 186
              +K L +   +   + I PYL L+ G  ++      A+  +D  RL +PGT LEE AL
Sbjct: 72  LLVAKTLEETAREYRDKKIGPYLALIGGNVLIATKPTDALDLYDQARLAAPGTILEEAAL 131

Query: 187 RNLLEITQNE-VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTI 245
           R  + I  ++ + ++   Y + Y  +F HS Y   F  + ++  +     +  +D+V  +
Sbjct: 132 RRSVAICVDKGMLDKGLAYSQRYARRFLHSPYASQFADLFVKLVVAHDRDVKPQDVVDIL 191

Query: 246 SFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLK 281
           SF     QR +YL+IA+ + ISGK ++  +A+ +++
Sbjct: 192 SFMDAPRQREVYLRIARAAAISGKPELARMAVDRVQ 227


>gi|218509334|ref|ZP_03507212.1| chemotaxis protein [Rhizobium etli Brasil 5]
          Length = 217

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 107/204 (52%), Gaps = 1/204 (0%)

Query: 67  QLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQL 126
           +LR     ++ D+RN+DA  IY +   +   ++ LIA D  GYFD  +   L+KY SG+ 
Sbjct: 12  RLRTADTSIYDDDRNVDAALIYAMSGGNPQTLEYLIAHDVNGYFDNRVTDVLRKYLSGKG 71

Query: 127 EESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIAL 186
              +K L +   +   + I PYL L+ G  ++      A+  +D  RL +PGT +EE AL
Sbjct: 72  LLVAKTLEETAREYRDKKIGPYLALIGGNVLIATKPTDALDLYDQARLAAPGTIVEEAAL 131

Query: 187 RNLLEITQNE-VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTI 245
           R  + I  ++ + ++   Y + Y  +F HS Y   F  + ++  +     +  +D+V  +
Sbjct: 132 RRSVAICVDKGLLDKGLAYSQRYARRFLHSPYASQFADLFVKLVVAHDRDVRPQDVVDIL 191

Query: 246 SFFSLEEQRAIYLKIAQNSVISGK 269
           SF     QR +YL+IA+ + ISGK
Sbjct: 192 SFMDAPRQREVYLRIARAAAISGK 215


>gi|319781669|ref|YP_004141145.1| hypothetical protein Mesci_1942 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167557|gb|ADV11095.1| hypothetical protein Mesci_1942 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 460

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 82/320 (25%), Positives = 141/320 (44%), Gaps = 17/320 (5%)

Query: 32  PYQCVRSLQRALDEAMRGD---ISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIY 88
           PYQ VRSLQ   D    GD   + +Q K+   ++ T  +LRA + + + D +N  A+ +Y
Sbjct: 32  PYQLVRSLQLIQDRIAAGDHAALPMQAKL---LEMTDARLRAANAEDYKDPKNFRALLVY 88

Query: 89  TIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPY 148
            +   +   V+   ++ T     +AI   + +Y +G+  ++ + L  I        +  +
Sbjct: 89  GMSGGNPVTVEAATSRATADPQSLAIAKGVIEYLNGRPGKAIEALRPIDPMALPPDLGAF 148

Query: 149 LHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNL--LEITQNEVGERAFG--- 203
           L L+ G  +       A+   D  RL SPGT +EE ALR    L + Q +    A     
Sbjct: 149 LALVKGSLLAGDQPATALGLLDEARLLSPGTLVEEAALRRSVGLAVAQGDAARFALASTQ 208

Query: 204 YIRAYVTQFHHSIYKDHFISVLLRFFLH-GQLKLPDEDIVFTISFFSLEEQRAIYLKIAQ 262
           Y+  Y+   + S + D F+S ++   +   Q KL D       S    E ++ IYL+IA+
Sbjct: 209 YVERYLYSPYASQFADSFVSGVIALHMSISQDKLGD-----ITSMMDPEREKVIYLRIAR 263

Query: 263 NSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYY 322
            + I G   +   A  + ++  D    +D     LY ++  +    I  ++     I   
Sbjct: 264 RAAIDGLNDLSAFASARAEQGRDGNTNQDDPRALLYASLSTVTSGTIEDIRAKLGKIDRS 323

Query: 323 SLMEQDRYLKKASEIIMSEI 342
            L E DR L  A++ I  E+
Sbjct: 324 RLSEGDRALLDAAQAIAGEV 343


>gi|90422621|ref|YP_530991.1| chemotaxis protein [Rhodopseudomonas palustris BisB18]
 gi|90104635|gb|ABD86672.1| putative chemotaxis protein precursor [Rhodopseudomonas palustris
           BisB18]
          Length = 396

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 124/273 (45%), Gaps = 9/273 (3%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PYQ VRSLQ   D+  RG++        ++K+ G Q +    +++ D+RN  A   + + 
Sbjct: 30  PYQLVRSLQSLQDDIARGNLDAHNAQRGLLKQLGEQFQQADPNLWKDSRNARAAVTFLLS 89

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             D  VV  L ++D     D AI+     Y  G+ +E+ + L  ++ +     +   + L
Sbjct: 90  GGDPQVVHALRSRDLLS-LDAAILDGAMAYIEGRPDEARERLGGVRARSLPAALGAEIAL 148

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAFGYIRA-YVT 210
           +    +     + ++   D VRL  PGT +EE ALR  + +         F ++   Y  
Sbjct: 149 VQSALLAKSDVKASIDRLDEVRLLMPGTLVEEAALRREIFLVGQADDFDKFEFLATRYFR 208

Query: 211 QFHHSIYKDHF-----ISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSV 265
           ++ HSIY  +F     +SV    F     + P   +V  +       QRA+YL IA+ ++
Sbjct: 209 RYRHSIYAGNFRQRFALSVARFSFAQQTARFP--RLVGVLDHLDGASQRALYLLIARTAL 266

Query: 266 ISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLY 298
           + GK ++  LA +++  + +  D       +LY
Sbjct: 267 VRGKTEMTVLAAERVLALTEDEDSPARGRAELY 299


>gi|260466607|ref|ZP_05812795.1| hypothetical protein MesopDRAFT_5442 [Mesorhizobium opportunistum
           WSM2075]
 gi|259029613|gb|EEW30901.1| hypothetical protein MesopDRAFT_5442 [Mesorhizobium opportunistum
           WSM2075]
          Length = 455

 Score = 85.5 bits (210), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 78/317 (24%), Positives = 135/317 (42%), Gaps = 11/317 (3%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PYQ VRSLQ   D    GD +       +++ T  +LR      F D +N  A+ +Y + 
Sbjct: 32  PYQLVRSLQLIQDRIAAGDHAAMPMQAKLLEMTDARLREADAQDFEDPKNFRALLVYGMS 91

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             +   V+  +++      D+AI   +  Y +G+  ++   L  I        +  +L L
Sbjct: 92  GGNPVTVEAAVSRAAADPGDLAIAKGVIDYLNGRPGDAITALGPIDPMALPGDLGAFLAL 151

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEI--TQNEVGERAFG---YIR 206
           + G  +       A+   D  +L SPGT +EE ALR  + I   Q +    A     Y+ 
Sbjct: 152 VKGSLLAGDDPAAALKLLDEAKLLSPGTLVEEAALRRSVGIAVAQGDAARFALASTQYVE 211

Query: 207 AYVTQFHHSIYKDHFISVLLRFFLH-GQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSV 265
            Y+   + S + D F+S ++   +   Q KL D       S    E ++ IYL+IA+ + 
Sbjct: 212 RYLYSPYASQFADSFVSGVIALHMSISQDKLAD-----ITSMMDPEREKVIYLRIARRAA 266

Query: 266 ISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLM 325
           I G  ++   A  + ++  D    +D     LY ++  +    I  ++     I    L 
Sbjct: 267 IDGLNELSAFASTRAEQGRDGNTNQDDPRALLYSSLSTVTSDTIEDVRTKLGKIDRSKLS 326

Query: 326 EQDRYLKKASEIIMSEI 342
           + DR L  A++ I  E+
Sbjct: 327 DGDRDLLDAAQAIAGEV 343


>gi|110632644|ref|YP_672852.1| chemotaxis protein [Mesorhizobium sp. BNC1]
 gi|110283628|gb|ABG61687.1| chemotaxis precursor (motility protein C) transmembrane
           [Chelativorans sp. BNC1]
          Length = 391

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 94/380 (24%), Positives = 159/380 (41%), Gaps = 31/380 (8%)

Query: 32  PYQCVRSLQRALDEAMRGD---ISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIY 88
           PYQ +RSLQ   D    GD   + +Q+++  I+ E        H   F +  N  A+ IY
Sbjct: 27  PYQMIRSLQLVQDRIADGDHAALPIQRRLLAIIDER------LHTADFENPHNFRALLIY 80

Query: 89  TIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPY 148
           +    + + +D +I++         +   L +Y  G L  + + LS  +       +   
Sbjct: 81  SASGGNPATLDAVISRLKLDEDQSRLSNGLTQYARGDLRAAREMLSATELSTLDPELAAP 140

Query: 149 LHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAFGYI-RA 207
           L L+IG  +   +  +A+ FFD  RL SPGT +EE ALR  L ++        F    R 
Sbjct: 141 LALVIGSLLAQQAPTEALRFFDQARLISPGTLIEEAALRRSLTLSAELRDPERFALASRQ 200

Query: 208 YVTQFHHSIYKDHFISVLLRFFLHGQLKLPDE-DIVFT---ISFFSLEEQRAIYLKIAQN 263
           Y  +F  S Y   F       F+ G + L  E D+      ++    ++   IYL+IA+ 
Sbjct: 201 YAWRFLRSPYASQFAEA----FVSGVVALRGEIDLALVEEIVANMRRDQAHVIYLRIARQ 256

Query: 264 SVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYS 323
           S I G   +   A +   +  D     D  ++ LY N+  +   D+  +  +  +I    
Sbjct: 257 SAIEGYDNLLTFASRNADKYADSGGGLDPRSV-LYGNMALVASEDVKDVLHTLEHIDAKR 315

Query: 324 LMEQDR-YLKKASEIIMSEIGKSLIDIDFEHIQ------KDLLLDKKEPRHTNVSMGIES 376
           L   DR  L  A E+  + + +     +    Q      + ++  + E    N      +
Sbjct: 316 LSPNDRKLLNAAREVARNILSRPAAGSEASARQGSFPQGEAVVAQEGEDEQLN-----GA 370

Query: 377 FIKKNRSQIESIDVLLAEAR 396
           F+      ++SIDVL+AEAR
Sbjct: 371 FVADTLKTLQSIDVLIAEAR 390


>gi|115523190|ref|YP_780101.1| chemotaxis protein [Rhodopseudomonas palustris BisA53]
 gi|115517137|gb|ABJ05121.1| putative chemotaxis protein precursor [Rhodopseudomonas palustris
           BisA53]
          Length = 395

 Score = 80.1 bits (196), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 82/296 (27%), Positives = 128/296 (43%), Gaps = 27/296 (9%)

Query: 5   YLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKET 64
           +L    +  + +  S   D+       PYQ VRSLQ   D+  RG++      P ++K  
Sbjct: 3   HLAKVAIALLALLGSARADEAATSAREPYQLVRSLQSLQDQIARGNLEAHNAQPALLKRL 62

Query: 65  GVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSG 124
           G Q R    +++ D RN  A  ++ +   D  VV  L ++      D AI+     Y  G
Sbjct: 63  GEQFRNADPNLWNDPRNSRAAVVFLLSGGDPQVVAALRSRKLLS-VDEAILDGAIAYVEG 121

Query: 125 QLEESSKELSKIKDKDNTRGIVPYLH----LLIGRAMMPFSSQQA-VHFFDYVRLTSPGT 179
           + EE+   L  +K      G +P        L   A++  S  +A V   D VRL  PGT
Sbjct: 122 RSEEAKARLGGVKS-----GALPATLGAEITLAQSALLAQSDLKATVARLDEVRLLMPGT 176

Query: 180 FLEEIALRNLL----EITQNEVGER-AFGYIRAYVTQFHHSIYKDHF-----ISVLLRFF 229
            +EE ALR  +    +I   +  ER A  Y R Y     HSIY  +F     +SV    F
Sbjct: 177 LIEEAALRREIFLVGQIDDFDKFERLATQYFRRY----RHSIYAGNFRQRFALSVARFSF 232

Query: 230 LHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIID 285
           +    + P   +V  +       QRA+Y  I + +++ GK ++  LA ++   + D
Sbjct: 233 VQQADRFP--RLVGVLDHLDRGSQRALYFLITRTALVRGKTEMANLAAERAISLTD 286


>gi|121602873|ref|YP_989387.1| chemotaxis protein [Bartonella bacilliformis KC583]
 gi|120615050|gb|ABM45651.1| putative flagellar motor protein [Bartonella bacilliformis KC583]
          Length = 456

 Score = 79.7 bits (195), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 92/383 (24%), Positives = 167/383 (43%), Gaps = 23/383 (6%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           P Q VRSLQ   D+ M G     +K P++++E G +      DV+ D  N+ A+ IY + 
Sbjct: 75  PIQLVRSLQNLQDKIMSGQEGALQKQPELLREIGEKFLTLSPDVWQDEHNLYALLIYLLN 134

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             +  VV  ++    +G     ++     Y S + EE  +  + + D++  + + P L L
Sbjct: 135 GGNPRVVRIILEDHGQGRIAQNLITGALAYTSHRREEFFRAFANLSDQE-LQLLPPALFL 193

Query: 152 LIGRAMMPFSSQQ----AVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIR 206
            I  + +  +S++    A+   + VRL +PGT  EE A+R  L +       E     +R
Sbjct: 194 SIVLSTVTNTSEKDPALALKQLNQVRLLAPGTLFEESAIRRELRVAATLGKAELLMLLVR 253

Query: 207 AYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVI 266
            Y  +F  S Y ++F S         +  L DE     +S+     Q   Y ++++ ++I
Sbjct: 254 NYAHRFEKSPYVNNFWSEFRLAIPRIEKDLSDEQFETLVSYAPTMLQLMTYTEVSRAALI 313

Query: 267 SGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLME 326
             + +   L+ ++   +   L+  D A I+LY        V      +    I    L+E
Sbjct: 314 DARMERVKLSAQKALMLAHELNVSD-APIRLYYAASLAGSVTAEEAAKMLQTISSNDLLE 372

Query: 327 QDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLL--------LDKKEPRHT-------NVS 371
           +DR L  A++ I   +  SL D D + ++   L        L+ +  R         +++
Sbjct: 373 RDRPLLTAAQAIADRVSFSLSD-DSQTVETQALISSQSQETLETQSKRRVGQQSDLPSIA 431

Query: 372 MGIESFIKKNRSQIESIDVLLAE 394
              + FI++ R +I  +D LL E
Sbjct: 432 TETDQFIEQTREKINIVDKLLGE 454


>gi|182679601|ref|YP_001833747.1| putative chemotaxis protein precursor [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182635484|gb|ACB96258.1| putative chemotaxis protein precursor [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 420

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 117/249 (46%), Gaps = 10/249 (4%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           P + VRS+    D+ + G   ++  +P I+ +    L A + DV+ D +NI+A+  Y + 
Sbjct: 57  PVEIVRSIMTLQDQVVSGKKPVETAMPKIMSQMADHLLAQNPDVWKDPKNIEALITYLLS 116

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
                V   ++  DT       ++ A+  Y +G    +   L+ +  +  T   +   H+
Sbjct: 117 GGQSRVAKKILEIDTLPSEQRNLLEAVYAYITGHKTRAENLLATVDPQ--TLSALLGAHV 174

Query: 152 LIGRAMMPFSS--QQAVHFFDYVRLTSPGTFLEEIALRN--LLEITQNEVGERAFGYIRA 207
            + +A++   S   +A+ + D  R+ +PGT +EE ALR    L  + N++ +  F   R 
Sbjct: 175 ALIKALLVAESDPAKAISYLDTARILAPGTLIEEAALRREIFLADSANKLSKFVF-LSRQ 233

Query: 208 YVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVF---TISFFSLEEQRAIYLKIAQNS 264
           Y+ +FH+S+Y D+F        +H  L    E +      I+     EQ  IYL IA  S
Sbjct: 234 YIRRFHNSVYFDNFYKHFSAAIIHLGLADNVEQVAKLDDLIAEMKPGEQARIYLAIAYKS 293

Query: 265 VISGKRKIG 273
           +I+G+  + 
Sbjct: 294 LINGRLPVA 302


>gi|319409173|emb|CBI82817.1| putative flagellar motor protein [Bartonella schoenbuchensis R1]
          Length = 463

 Score = 72.8 bits (177), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 81/326 (24%), Positives = 146/326 (44%), Gaps = 15/326 (4%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           P Q VRSLQ   D+ + G   + +K P +++E G +  + +  ++ D +N+ A+ IY   
Sbjct: 69  PMQLVRSLQNLQDQIVSGQEEVLQKQPQLLREIGEKFLSFNPSIWKDKQNLYALLIYLFN 128

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             + SVV  ++    +G     I+  +  Y S + E   K  + + D+D  + I P L  
Sbjct: 129 GGNPSVVRVILKSYGQGVIAENIMTGVLAYLSHKQEVFFKTFANLTDED-IQSIPPALFF 187

Query: 152 -----LIGRAMM--PFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAF-- 202
                 +G  +M  P     A+   D VRL SPGT  EE A+R  +++    +G+     
Sbjct: 188 SIVLSTVGNTIMKDPV---LAMKQLDQVRLLSPGTLFEESAIRREIKVA-TILGQTDLLT 243

Query: 203 GYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQ 262
             +R Y ++F  S Y   F             KL D+ +   IS+     Q   Y+ +++
Sbjct: 244 LLVRNYASRFGKSPYAKDFWREFGIAIPRIDEKLDDQQLEALISYAPPMVQLMAYMDVSR 303

Query: 263 NSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYY 322
            ++I+ + +   L+ ++   +   L+  D A  +LY        V     ++   NI   
Sbjct: 304 TALINARMERAQLSAQKALTLAHELNVND-APARLYYAASLASSVTAHEAEQLLQNISSK 362

Query: 323 SLMEQDRYLKKASEIIMSEIGKSLID 348
            L E+DR L  A++ +  ++  SL+D
Sbjct: 363 DLSEKDRLLFIAAQAVAQKVTSSLVD 388


>gi|170748096|ref|YP_001754356.1| chemotaxis protein [Methylobacterium radiotolerans JCM 2831]
 gi|170654618|gb|ACB23673.1| putative chemotaxis protein precursor [Methylobacterium
           radiotolerans JCM 2831]
          Length = 415

 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 90/381 (23%), Positives = 164/381 (43%), Gaps = 32/381 (8%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           P Q VR+LQ   D    G ++  +  P ++      L A   +++    N+ +   + + 
Sbjct: 48  PVQWVRTLQLLQDRVAAGSLAAHESQPLLIARINADLLAAPPEIWGRRNNLRSAITFALS 107

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
               +V+  L A+D  G  +  +      Y  G+  E+ + L  +   D    + P L  
Sbjct: 108 GGGPAVLRRLTARDGLGEPEATLARGALAYLEGREAEARRLLQDVDTTD----LPPTLAG 163

Query: 152 LIG--RAMMPFSSQ--QAVHFFDYVRLTSPGTFLEEIALRNLLEI-TQNEVGE-RAFGYI 205
            +G  +A +  + Q  +A+   D VR+  PGT  EE ALR   EI T  ++G+ + F  +
Sbjct: 164 AVGLTQASLAVTDQPARAIGLLDRVRVLLPGTLAEEGALRR--EIFTLGQIGDLKTFEAL 221

Query: 206 R-AYVTQFHHSIYKDHF---ISVLLRFFLHGQLKLPDEDIVFT----ISFFSLEEQRAIY 257
              Y+ +F HS+Y  +F   ++  L  F  G     DE    T    +S    E +R +Y
Sbjct: 222 AIQYLRRFPHSVYAGNFRQRLAYQLTQFDIGH----DEGRFGTLNRILSELRPESRRDLY 277

Query: 258 LKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQ---R 314
           L +AQ ++ +GK      A ++   +       +    QLY     I  V++ + Q   R
Sbjct: 278 LLVAQTAIQAGKTAAALRASEKALALCAP-GSAEATQGQLYRAAAEI--VNLATFQSGLR 334

Query: 315 STCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGI 374
           +  ++    L  +D+ L + +      IG+ L       + +   L K      + + G 
Sbjct: 335 TLRSLDRAKLTARDQLLLETALSTAGAIGRGL--AGRSGLPEADSLSKPARAARDPADGP 392

Query: 375 ESFIKKNRSQIESIDVLLAEA 395
            S I K ++ I+ ID++L++A
Sbjct: 393 ASLIPKAQATIDRIDLMLSKA 413


>gi|17984290|gb|AAL53396.1| chemotaxis motc protein precursor [Brucella melitensis bv. 1 str.
           16M]
          Length = 397

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 125/308 (40%), Gaps = 2/308 (0%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY   
Sbjct: 9   PYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYLFN 68

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             +   V  ++A          +V     Y SGQ  E  K  S     +    +   + L
Sbjct: 69  GGNPEAVRKVLANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASIVL 128

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEI-TQNEVGERAFGYIRAYVT 210
           +    MM F    A+   D VRL +PGT  EE A+R  L I  +    ++     R Y+ 
Sbjct: 129 VTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKRGAADKVRLLSRNYLQ 188

Query: 211 QFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKR 270
           +F HS Y   F++  +   L    ++ DE++V  I       Q  +YL+IA+ +++ G+ 
Sbjct: 189 RFRHSPYMRDFMAQFVDTTLKLSDRIGDEELVKLIGSADPLLQYTLYLQIARGALVDGQT 248

Query: 271 KIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRY 330
           +       + +++   L+  D     LY    ++      S  R    I    L E DR 
Sbjct: 249 ERARFMSAEARKLAGHLN-ADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPDRK 307

Query: 331 LKKASEII 338
           L KA+E +
Sbjct: 308 LLKAAETV 315


>gi|161511179|ref|NP_541132.2| chemotaxis protein [Brucella melitensis bv. 1 str. 16M]
 gi|256042870|ref|ZP_05445816.1| chemotaxis protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|260564107|ref|ZP_05834592.1| chemotaxis motc protein [Brucella melitensis bv. 1 str. 16M]
 gi|265989305|ref|ZP_06101862.1| chemotaxis protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|260151750|gb|EEW86843.1| chemotaxis motc protein [Brucella melitensis bv. 1 str. 16M]
 gi|262999974|gb|EEZ12664.1| chemotaxis protein [Brucella melitensis bv. 1 str. Rev.1]
          Length = 430

 Score = 70.9 bits (172), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 125/308 (40%), Gaps = 2/308 (0%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY   
Sbjct: 42  PYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYLFN 101

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             +   V  ++A          +V     Y SGQ  E  K  S     +    +   + L
Sbjct: 102 GGNPEAVRKVLANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASIVL 161

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEI-TQNEVGERAFGYIRAYVT 210
           +    MM F    A+   D VRL +PGT  EE A+R  L I  +    ++     R Y+ 
Sbjct: 162 VTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKRGAADKVRLLSRNYLQ 221

Query: 211 QFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKR 270
           +F HS Y   F++  +   L    ++ DE++V  I       Q  +YL+IA+ +++ G+ 
Sbjct: 222 RFRHSPYMRDFMAQFVDTTLKLSDRIGDEELVKLIGSADPLLQYTLYLQIARGALVDGQT 281

Query: 271 KIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRY 330
           +       + +++   L+  D     LY    ++      S  R    I    L E DR 
Sbjct: 282 ERARFMSAEARKLAGHLN-ADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPDRK 340

Query: 331 LKKASEII 338
           L KA+E +
Sbjct: 341 LLKAAETV 348


>gi|62317961|ref|YP_223814.1| chemotaxis protein [Brucella abortus bv. 1 str. 9-941]
 gi|83269938|ref|YP_419229.1| chemotaxis protein [Brucella melitensis biovar Abortus 2308]
 gi|161621186|ref|YP_001595072.1| chemotaxis protein [Brucella canis ATCC 23365]
 gi|163845461|ref|YP_001623116.1| chemotaxis protein [Brucella suis ATCC 23445]
 gi|189023212|ref|YP_001932953.1| chemotaxis protein [Brucella abortus S19]
 gi|225628432|ref|ZP_03786466.1| chemotaxis protein [Brucella ceti str. Cudo]
 gi|225686889|ref|YP_002734861.1| chemotaxis protein [Brucella melitensis ATCC 23457]
 gi|237817508|ref|ZP_04596498.1| chemotaxis protein [Brucella abortus str. 2308 A]
 gi|254691606|ref|ZP_05154860.1| chemotaxis protein [Brucella abortus bv. 6 str. 870]
 gi|254698193|ref|ZP_05160021.1| chemotaxis protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254699265|ref|ZP_05161093.1| chemotaxis protein [Brucella suis bv. 5 str. 513]
 gi|254702389|ref|ZP_05164217.1| chemotaxis protein [Brucella suis bv. 3 str. 686]
 gi|254706493|ref|ZP_05168321.1| chemotaxis protein [Brucella pinnipedialis M163/99/10]
 gi|254711823|ref|ZP_05173634.1| chemotaxis protein [Brucella ceti M644/93/1]
 gi|254714892|ref|ZP_05176703.1| chemotaxis protein [Brucella ceti M13/05/1]
 gi|254731638|ref|ZP_05190216.1| chemotaxis protein [Brucella abortus bv. 4 str. 292]
 gi|256015902|ref|YP_003105911.1| chemotaxis protein MotC [Brucella microti CCM 4915]
 gi|256158328|ref|ZP_05456232.1| chemotaxis protein [Brucella ceti M490/95/1]
 gi|256252738|ref|ZP_05458274.1| chemotaxis protein [Brucella ceti B1/94]
 gi|256256794|ref|ZP_05462330.1| chemotaxis protein [Brucella abortus bv. 9 str. C68]
 gi|256261974|ref|ZP_05464506.1| chemotaxis motc protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260166799|ref|ZP_05753610.1| chemotaxis protein [Brucella sp. F5/99]
 gi|260544146|ref|ZP_05819967.1| chemotaxis motc protein [Brucella abortus NCTC 8038]
 gi|260568710|ref|ZP_05839179.1| chemotaxis motc protein [Brucella suis bv. 4 str. 40]
 gi|260757238|ref|ZP_05869586.1| chemotaxis protein [Brucella abortus bv. 6 str. 870]
 gi|260759397|ref|ZP_05871745.1| chemotaxis protein [Brucella abortus bv. 4 str. 292]
 gi|260762640|ref|ZP_05874972.1| chemotaxis protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883042|ref|ZP_05894656.1| chemotaxis protein [Brucella abortus bv. 9 str. C68]
 gi|261216581|ref|ZP_05930862.1| chemotaxis protein [Brucella ceti M13/05/1]
 gi|261219817|ref|ZP_05934098.1| chemotaxis protein [Brucella ceti B1/94]
 gi|261313946|ref|ZP_05953143.1| chemotaxis protein [Brucella pinnipedialis M163/99/10]
 gi|261319451|ref|ZP_05958648.1| chemotaxis protein [Brucella ceti M644/93/1]
 gi|261749707|ref|ZP_05993416.1| chemotaxis protein [Brucella suis bv. 5 str. 513]
 gi|261752950|ref|ZP_05996659.1| chemotaxis protein [Brucella suis bv. 3 str. 686]
 gi|261756177|ref|ZP_05999886.1| chemotaxis motc protein [Brucella sp. F5/99]
 gi|265996842|ref|ZP_06109399.1| chemotaxis protein [Brucella ceti M490/95/1]
 gi|297250147|ref|ZP_06933848.1| chemotaxis protein MotC [Brucella abortus bv. 5 str. B3196]
 gi|62198154|gb|AAX76453.1| hypothetical MotC chemotaxis protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82940212|emb|CAJ13268.1| chemotaxis motc protein precursor [Brucella melitensis biovar
           Abortus 2308]
 gi|161337997|gb|ABX64301.1| Hypothetical protein BCAN_B1172 [Brucella canis ATCC 23365]
 gi|163676184|gb|ABY40294.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189021786|gb|ACD74507.1| chemotaxis motc protein precursor [Brucella abortus S19]
 gi|225616278|gb|EEH13326.1| chemotaxis protein [Brucella ceti str. Cudo]
 gi|225642994|gb|ACO02907.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|237787263|gb|EEP61481.1| chemotaxis protein [Brucella abortus str. 2308 A]
 gi|255998562|gb|ACU50249.1| chemotaxis protein MotC [Brucella microti CCM 4915]
 gi|260097417|gb|EEW81291.1| chemotaxis motc protein [Brucella abortus NCTC 8038]
 gi|260155375|gb|EEW90456.1| chemotaxis motc protein [Brucella suis bv. 4 str. 40]
 gi|260669715|gb|EEX56655.1| chemotaxis protein [Brucella abortus bv. 4 str. 292]
 gi|260673061|gb|EEX59882.1| chemotaxis protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260677346|gb|EEX64167.1| chemotaxis protein [Brucella abortus bv. 6 str. 870]
 gi|260872570|gb|EEX79639.1| chemotaxis protein [Brucella abortus bv. 9 str. C68]
 gi|260918401|gb|EEX85054.1| chemotaxis protein [Brucella ceti B1/94]
 gi|260921670|gb|EEX88238.1| chemotaxis protein [Brucella ceti M13/05/1]
 gi|261292141|gb|EEX95637.1| chemotaxis protein [Brucella ceti M644/93/1]
 gi|261302972|gb|EEY06469.1| chemotaxis protein [Brucella pinnipedialis M163/99/10]
 gi|261736161|gb|EEY24157.1| chemotaxis motc protein [Brucella sp. F5/99]
 gi|261739460|gb|EEY27386.1| chemotaxis protein [Brucella suis bv. 5 str. 513]
 gi|261742703|gb|EEY30629.1| chemotaxis protein [Brucella suis bv. 3 str. 686]
 gi|262551139|gb|EEZ07300.1| chemotaxis protein [Brucella ceti M490/95/1]
 gi|263091458|gb|EEZ15994.1| chemotaxis motc protein [Brucella melitensis bv. 2 str. 63/9]
 gi|297174016|gb|EFH33380.1| chemotaxis protein MotC [Brucella abortus bv. 5 str. B3196]
 gi|326411307|gb|ADZ68371.1| chemotaxis protein [Brucella melitensis M28]
 gi|326554596|gb|ADZ89235.1| chemotaxis protein [Brucella melitensis M5-90]
          Length = 430

 Score = 70.9 bits (172), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 124/308 (40%), Gaps = 2/308 (0%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY   
Sbjct: 42  PYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYLFN 101

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             +   V  ++A          +V     Y SGQ  E  K  S     +    +   + L
Sbjct: 102 GGNPEAVRKVLANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASIVL 161

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIRAYVT 210
           +    MM F    A+   D VRL +PGT  EE A+R  L I       ++     R Y+ 
Sbjct: 162 VTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKLGAADKVRLLSRNYLQ 221

Query: 211 QFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKR 270
           +F HS Y   F++  +   L    ++ DE++V  I       Q  +YL+IA+ +++ G+ 
Sbjct: 222 RFRHSPYMRDFMAQFVDTTLKLSDRIGDEELVKLIGSADPLLQYTLYLQIARGALVDGQT 281

Query: 271 KIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRY 330
           +       + +++   L+  D     LY    ++      S  R    I    L E DR 
Sbjct: 282 ERARFMSAEARKLAGHLN-ADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPDRK 340

Query: 331 LKKASEII 338
           L KA+E +
Sbjct: 341 LLKAAETV 348


>gi|256059800|ref|ZP_05449995.1| chemotaxis protein [Brucella neotomae 5K33]
 gi|261323780|ref|ZP_05962977.1| chemotaxis protein [Brucella neotomae 5K33]
 gi|261299760|gb|EEY03257.1| chemotaxis protein [Brucella neotomae 5K33]
          Length = 424

 Score = 70.5 bits (171), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 124/308 (40%), Gaps = 2/308 (0%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY   
Sbjct: 42  PYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYLFN 101

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             +   V  ++A          +V     Y SGQ  E  K  S     +    +   + L
Sbjct: 102 GGNPEAVRKVLANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASIVL 161

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIRAYVT 210
           +    MM F    A+   D VRL +PGT  EE A+R  L I       ++     R Y+ 
Sbjct: 162 VTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKLGAADKVRLLSRNYLQ 221

Query: 211 QFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKR 270
           +F HS Y   F++  +   L    ++ DE++V  I       Q  +YL+IA+ +++ G+ 
Sbjct: 222 RFRHSPYMRDFMAQFVDTTLKLSDRIGDEELVKLIGSADPLLQYTLYLQIARGALVDGQT 281

Query: 271 KIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRY 330
           +       + +++   L+  D     LY    ++      S  R    I    L E DR 
Sbjct: 282 ERARFMSAEARKLAGHLN-ADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPDRK 340

Query: 331 LKKASEII 338
           L KA+E +
Sbjct: 341 LLKAAETV 348


>gi|148558481|ref|YP_001258007.1| chemotaxis protein [Brucella ovis ATCC 25840]
 gi|148369766|gb|ABQ62638.1| putative chemotaxis motC protein [Brucella ovis ATCC 25840]
          Length = 397

 Score = 70.5 bits (171), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 124/308 (40%), Gaps = 2/308 (0%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY   
Sbjct: 9   PYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYLFN 68

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             +   V  ++A          +V     Y SGQ  E  K  S     +    +   + L
Sbjct: 69  GGNPEAVRKVLANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASIVL 128

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIRAYVT 210
           +    MM F    A+   D VRL +PGT  EE A+R  L I       ++     R Y+ 
Sbjct: 129 VTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKLGAADKVRLLSRNYLQ 188

Query: 211 QFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKR 270
           +F HS Y   F++  +   L    ++ DE++V  I       Q  +YL+IA+ +++ G+ 
Sbjct: 189 RFRHSPYMRDFMAQFVDTTLKLSDRIGDEELVKLIGSADPLLQYTLYLQIARGALVDGQT 248

Query: 271 KIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRY 330
           +       + +++   L+  D     LY    ++      S  R    I    L E DR 
Sbjct: 249 ERARFMSAEARKLAGHLN-ADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPDRK 307

Query: 331 LKKASEII 338
           L KA+E +
Sbjct: 308 LLKAAETV 315


>gi|254711222|ref|ZP_05173033.1| chemotaxis protein [Brucella pinnipedialis B2/94]
 gi|256030149|ref|ZP_05443763.1| chemotaxis protein [Brucella pinnipedialis M292/94/1]
 gi|261318814|ref|ZP_05958011.1| chemotaxis protein [Brucella pinnipedialis B2/94]
 gi|265987179|ref|ZP_06099736.1| chemotaxis protein [Brucella pinnipedialis M292/94/1]
 gi|261298037|gb|EEY01534.1| chemotaxis protein [Brucella pinnipedialis B2/94]
 gi|264659376|gb|EEZ29637.1| chemotaxis protein [Brucella pinnipedialis M292/94/1]
          Length = 430

 Score = 70.1 bits (170), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 124/308 (40%), Gaps = 2/308 (0%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY   
Sbjct: 42  PYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYLFN 101

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             +   V  ++A          +V     Y SGQ  E  K  S     +    +   + L
Sbjct: 102 GGNPEAVRKVLANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASIVL 161

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIRAYVT 210
           +    MM F    A+   D VRL +PGT  EE A+R  L I       ++     R Y+ 
Sbjct: 162 VTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKLGAADKVRLLSRNYLQ 221

Query: 211 QFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKR 270
           +F HS Y   F++  +   L    ++ DE++V  I       Q  +YL+IA+ +++ G+ 
Sbjct: 222 RFRHSPYMRDFMAQFVDTTLKLSDRIGDEELVKLIGSADPLLQYTLYLQIARGALVDGQT 281

Query: 271 KIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRY 330
           +       + +++   L+  D     LY    ++      S  R    I    L E DR 
Sbjct: 282 ERARFISAEARKLAGHLN-ADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPDRK 340

Query: 331 LKKASEII 338
           L KA+E +
Sbjct: 341 LLKAAETV 348


>gi|90418367|ref|ZP_01226279.1| putative chemotaxis protein motC [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90338039|gb|EAS51690.1| putative chemotaxis protein motC [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 420

 Score = 70.1 bits (170), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 74/336 (22%), Positives = 150/336 (44%), Gaps = 11/336 (3%)

Query: 28  RTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWI 87
           R  +PY+ VRS+Q   D+  RG+ +  +    +++  G        +V+ D RN+ A  +
Sbjct: 57  RAPMPYEIVRSVQFLQDQVARGNGAAIRVQAQLLRRYGPTFLEQPPEVWTDPRNLRAAAL 116

Query: 88  YTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVP 147
           + +     +V+  +++  T    + A++     Y   +  ++   L  I   +    +  
Sbjct: 117 FVLSGGPPAVLRGILSTATIDGDERALLDGALAYVENRARDARAALVPIDVSEMDTALAA 176

Query: 148 YLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAFG--YI 205
            L+L + + +   +   A+H  + V L +PGT LEE ALR  + + ++ +G  A    Y 
Sbjct: 177 QLNLAVAQLLQKDAPADALHRLEQVMLAAPGTLLEEAALRMGVLLAED-IGSHAAADRYA 235

Query: 206 RAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSL---EEQR-AIYLKIA 261
           R Y  +F  S Y  +F +     +     +  DE  V TI   +    ++QR AI+L +A
Sbjct: 236 RQYFDRFADSAYAGNFRARFSAVYAARPAETKDE-TVATIDNATARIPDDQRLAIFLAVA 294

Query: 262 QNSVISGKRKI-GFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIP 320
           + +++ G   +   +A + L+         D     LY+    +   D +  + +   I 
Sbjct: 295 RRALVGGNLPLAAAMATEALES--GNAVPADSQRALLYKTAATLTTGDPVEARVALEAID 352

Query: 321 YYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQK 356
             +L   DR L +A+  ++SE+ K L+  + +  ++
Sbjct: 353 VATLHPADRKLHEAAYEVLSEMRKPLMAANIDPAER 388


>gi|256112173|ref|ZP_05453094.1| chemotaxis protein [Brucella melitensis bv. 3 str. Ether]
 gi|265993599|ref|ZP_06106156.1| chemotaxis protein [Brucella melitensis bv. 3 str. Ether]
 gi|262764469|gb|EEZ10501.1| chemotaxis protein [Brucella melitensis bv. 3 str. Ether]
          Length = 430

 Score = 69.7 bits (169), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 123/308 (39%), Gaps = 2/308 (0%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY   
Sbjct: 42  PYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYLFN 101

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             +   V   +A          +V     Y SGQ  E  K  S     +    +   + L
Sbjct: 102 GGNPEAVRKALANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASIVL 161

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIRAYVT 210
           +    MM F    A+   D VRL +PGT  EE A+R  L I       ++     R Y+ 
Sbjct: 162 VTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKLGAADKVRLLSRNYLQ 221

Query: 211 QFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKR 270
           +F HS Y   F++  +   L    ++ DE++V  I       Q  +YL+IA+ +++ G+ 
Sbjct: 222 RFRHSPYMRDFMAQFVDTTLKLSDRIGDEELVKLIGSADPLLQYTLYLQIARGALVDGQT 281

Query: 271 KIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRY 330
           +       + +++   L+  D     LY    ++      S  R    I    L E DR 
Sbjct: 282 ERARFMSAEARKLAGHLN-ADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPDRK 340

Query: 331 LKKASEII 338
           L KA+E +
Sbjct: 341 LLKAAETV 348


>gi|306845423|ref|ZP_07477997.1| chemotaxis protein [Brucella sp. BO1]
 gi|306274166|gb|EFM55982.1| chemotaxis protein [Brucella sp. BO1]
          Length = 430

 Score = 69.7 bits (169), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 127/309 (41%), Gaps = 4/309 (1%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY   
Sbjct: 42  PYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYLFN 101

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             +   V  ++A          +V     Y SGQ  E  K  S     D    +   + L
Sbjct: 102 GGNPEAVRKVLANLKSDTVPQELVKGALAYASGQTIEVVKLFSVPLAPDVPAELKASIVL 161

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVG--ERAFGYIRAYV 209
           +    MM F    A+   D VRL +PGT  EE A+R  L I   ++G  ++     R Y+
Sbjct: 162 VTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAA-KLGDADKVRLLSRNYL 220

Query: 210 TQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGK 269
            +F HS Y   F++  +   L    ++ +E++V  I       Q  +YL+IA+ +++ G+
Sbjct: 221 QRFRHSPYMRDFMAQFVDTTLKLSDRIGNEELVKLIGSADPLLQYTLYLQIARGALVDGQ 280

Query: 270 RKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDR 329
            +       + +++   L+  D     LY    ++      S  R    I    L E DR
Sbjct: 281 TERARFMSAEARKLAGHLN-ADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPDR 339

Query: 330 YLKKASEII 338
            L KA+E +
Sbjct: 340 KLLKAAETV 348


>gi|153011512|ref|YP_001372726.1| chemotaxis protein [Ochrobactrum anthropi ATCC 49188]
 gi|151563400|gb|ABS16897.1| conserved hypothetical MotC chemotaxis protein [Ochrobactrum
           anthropi ATCC 49188]
          Length = 431

 Score = 69.7 bits (169), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 86/345 (24%), Positives = 147/345 (42%), Gaps = 25/345 (7%)

Query: 16  VFFSFATDQDLVRT-----IVPYQCVRSLQRALDEAMRGD----ISLQKKIPDIVKETGV 66
            + +F+  Q L  T     + PY+ VRSL+   D+ + G     + L K +  +  + G 
Sbjct: 22  AYPAFSQMQTLAETRALPVLEPYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSADMG- 80

Query: 67  QLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQL 126
             RA++ DV+ +  N+ A  IY     +   V  ++A          +V     Y SGQ 
Sbjct: 81  --RASN-DVWSNPENVYAAIIYLFNGGNPEAVRKVLADLKTDAVPPELVKGALAYASGQT 137

Query: 127 EESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIAL 186
            E  K  S     D    +   + L+    M  F    A+   D VRL +PGT  EE A+
Sbjct: 138 IEVVKLFSVPLSPDVPAELKASIVLVTASQMTAFDPATALMRLDQVRLDAPGTLFEEAAI 197

Query: 187 RNLLEITQNEVG--ERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDE----D 240
           R  + I   ++G  ++     R Y+ +F  S Y   F++     F+   +KL D     +
Sbjct: 198 RRSMPIAA-KLGDADKIRLLSRNYLQRFPRSPYMRDFMAQ----FVDAAVKLNDRIGNAE 252

Query: 241 IVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYEN 300
           +   I       Q ++YL+IA+ +++ G+ +       + K++ DRL   D     LY  
Sbjct: 253 LAKLIGSADPVMQYSLYLQIARGALVDGQTERARFMSAEAKKLADRLK-ADPTRANLYAA 311

Query: 301 ILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKS 345
             ++      S  R    I    L E+DR L KA+E + + + ++
Sbjct: 312 ASDVASDSAGSALRELSQISPDKLQERDRKLLKAAEAVGTVVTRT 356


>gi|114705810|ref|ZP_01438713.1| probable chemotaxis protein precursor [Fulvimarina pelagi HTCC2506]
 gi|114538656|gb|EAU41777.1| probable chemotaxis protein precursor [Fulvimarina pelagi HTCC2506]
          Length = 458

 Score = 69.7 bits (169), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 72/319 (22%), Positives = 143/319 (44%), Gaps = 19/319 (5%)

Query: 28  RTIVPYQCVRSLQRALDEAMRGD---ISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDA 84
           R  +P++ +RSLQ   D+A RG+   + +Q+++   ++  G  L A   DV+ D RN+ A
Sbjct: 100 REPMPFEVIRSLQYLQDQAARGNKAALQVQRRL---LRRFGPSLSARSSDVWTDKRNVRA 156

Query: 85  VWIYTIISQDLSVVDDLIAKDTKGYFD---IAIVYALKKYFSGQLEESSKELSKIKDKDN 141
           V ++ +     + + +L      G F+     ++  +  Y   +++E+  +LS I     
Sbjct: 157 VVLFVLSGGPSAPLSELY---RAGVFEEKHRPLIEGVLAYADNRMDEAEAKLSTIDLSRE 213

Query: 142 TRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVG--E 199
                  + L + +         ++   + V L +PGT L+E ALR  + + +N  G  E
Sbjct: 214 ETIFAAQVRLALAQLREAEDPAGSLMLLEQVMLAAPGTLLDEAALRLGVLLAEN-AGETE 272

Query: 200 RAFGYIRAYVTQFHHSIYKDHF---ISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAI 256
           +A  Y R Y  ++  S+Y  +F    S +      G  +   + +  T+     +++ A+
Sbjct: 273 KADRYARQYFDRYAASVYAGNFRTRFSAVYSDRPKGSEEATLDTLAGTLRLLPDDQKLAM 332

Query: 257 YLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRST 316
           YL +A+ +++ G  ++   A ++    I+  D  D     LYE    +  +D   +  + 
Sbjct: 333 YLSVARRALVGGNLELAAEASRE-ALTIEAADPADRQRALLYEVASTLSALDEGEILATL 391

Query: 317 CNIPYYSLMEQDRYLKKAS 335
             I    L   D  LK+A+
Sbjct: 392 GAIEDEQLHPSDLALKEAA 410


>gi|306841272|ref|ZP_07473983.1| chemotaxis protein [Brucella sp. BO2]
 gi|306288674|gb|EFM60005.1| chemotaxis protein [Brucella sp. BO2]
          Length = 420

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 127/309 (41%), Gaps = 4/309 (1%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY   
Sbjct: 32  PYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYLFN 91

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             +   V  ++A          +V     Y SGQ  E  K  S     D    +   + L
Sbjct: 92  GGNPEAVRKVLANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPDVPAELKASIVL 151

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVG--ERAFGYIRAYV 209
           +    MM F    A+   D VRL +PGT  EE A+R  L I   ++G  ++     R Y+
Sbjct: 152 VTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAA-KLGDADKVRLLSRNYL 210

Query: 210 TQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGK 269
            +F HS Y   F++  +   L    ++ +E++V  I       Q  +YL+IA+ +++ G+
Sbjct: 211 QRFRHSPYMRDFMAQFVDTTLKLSDRIGNEELVKLIGSADPLLQYTLYLQIARGALVDGQ 270

Query: 270 RKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDR 329
            +       + +++   L+  D     LY    ++      S  R    I    L E DR
Sbjct: 271 TERARFMSAEARKLAGHLN-ADPTRANLYAAASDVVSDSAGSALRELSQISPDHLQEPDR 329

Query: 330 YLKKASEII 338
            L KA+E +
Sbjct: 330 KLLKAAETV 338


>gi|254720769|ref|ZP_05182580.1| chemotaxis protein [Brucella sp. 83/13]
 gi|265985827|ref|ZP_06098562.1| chemotaxis protein [Brucella sp. 83/13]
 gi|306840140|ref|ZP_07472925.1| chemotaxis protein [Brucella sp. NF 2653]
 gi|264664419|gb|EEZ34680.1| chemotaxis protein [Brucella sp. 83/13]
 gi|306404785|gb|EFM61079.1| chemotaxis protein [Brucella sp. NF 2653]
          Length = 430

 Score = 67.4 bits (163), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 127/309 (41%), Gaps = 4/309 (1%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY   
Sbjct: 42  PYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMGRAQPEVWDKPENIYAAIIYLFN 101

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             +   V  ++A          +V     Y SGQ  E  K  S     +    +   + L
Sbjct: 102 GGNPEAVRKVLANLKSDTVSQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASIVL 161

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVG--ERAFGYIRAYV 209
           +    MM F    A+   D VRL +PGT  EE A+R  L I   ++G  ++     R Y+
Sbjct: 162 VTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAA-KLGDADKVRLLSRNYL 220

Query: 210 TQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGK 269
            +F HS Y   F++  +   L    ++ +E++V  I       Q  +YL+IA+ +++ G+
Sbjct: 221 QRFRHSPYMRDFMAQFVDTTLKLSDRIGNEELVKLIGSADPLLQYTLYLQIARGALVDGQ 280

Query: 270 RKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDR 329
            +       + +++   L+  D     LY    ++      S  R    I    L E DR
Sbjct: 281 TERARFMSAEARKLAGHLN-ADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPDR 339

Query: 330 YLKKASEII 338
            L KA+E +
Sbjct: 340 KLLKAAETV 348


>gi|294852973|ref|ZP_06793645.1| chemotaxis protein MotC [Brucella sp. NVSL 07-0026]
 gi|294818628|gb|EFG35628.1| chemotaxis protein MotC [Brucella sp. NVSL 07-0026]
          Length = 430

 Score = 67.4 bits (163), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 74/308 (24%), Positives = 123/308 (39%), Gaps = 2/308 (0%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PY+ VRSL+   D+ +         +  ++      +     +V+    NI A  IY   
Sbjct: 42  PYKLVRSLRMLQDQVVADKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYLFN 101

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             +   V  ++A          +V     Y SGQ  E  K  S     +    +   + L
Sbjct: 102 GGNPEAVRKVLANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASIVL 161

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIRAYVT 210
           +    MM F    A+   D VRL +PGT  EE A+R  L I       ++     R Y+ 
Sbjct: 162 VTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKLGAADKVRLLSRNYLQ 221

Query: 211 QFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKR 270
           +F HS Y   F++  +   L    ++ DE++V  I       Q  +YL+IA+ +++ G+ 
Sbjct: 222 RFRHSPYMRDFMAQFVDTTLKLSDRIGDEELVKLIGSADPLLQYTLYLQIARGALVDGQT 281

Query: 271 KIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRY 330
           +       + +++   L+  D     LY    ++      S  R    I    L E DR 
Sbjct: 282 ERARFMSAEARKLAGHLN-ADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPDRK 340

Query: 331 LKKASEII 338
           L KA+E +
Sbjct: 341 LLKAAETV 348


>gi|254695097|ref|ZP_05156925.1| chemotaxis protein [Brucella abortus bv. 3 str. Tulya]
 gi|261215448|ref|ZP_05929729.1| chemotaxis protein [Brucella abortus bv. 3 str. Tulya]
 gi|260917055|gb|EEX83916.1| chemotaxis protein [Brucella abortus bv. 3 str. Tulya]
          Length = 435

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 75/313 (23%), Positives = 124/313 (39%), Gaps = 7/313 (2%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY   
Sbjct: 42  PYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYLFN 101

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             +   V  ++A          +V     Y SGQ  E  K  S     +    +   + L
Sbjct: 102 GGNPEAVRKVLANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASIVL 161

Query: 152 LIGRAMMPFSSQQAVHFFDYVRL-----TSPGTFLEEIALRNLLEITQN-EVGERAFGYI 205
           +    MM F    A+   D VRL      +PGT  EE A+R  L I       ++     
Sbjct: 162 VTANQMMAFDPATALLRLDQVRLDQVRLEAPGTLFEEAAIRRSLPIAAKLGAADKVRLLS 221

Query: 206 RAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSV 265
           R Y+ +F HS Y   F++  +   L    ++ DE++V  I       Q  +YL+IA+ ++
Sbjct: 222 RNYLQRFRHSPYMRDFMAQFVDTTLKLSDRIGDEELVKLIGSADPLLQYTLYLQIARGAL 281

Query: 266 ISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLM 325
           + G+ +       + +++   L+  D     LY    ++      S  R    I    L 
Sbjct: 282 VDGQTERARFMSAEARKLAGHLN-ADPTRANLYAAASDVASDSAGSALRELSQISPDHLQ 340

Query: 326 EQDRYLKKASEII 338
           E DR L KA+E +
Sbjct: 341 EPDRKLLKAAETV 353


>gi|239834430|ref|ZP_04682758.1| chemotaxis protein [Ochrobactrum intermedium LMG 3301]
 gi|239822493|gb|EEQ94062.1| chemotaxis protein [Ochrobactrum intermedium LMG 3301]
          Length = 437

 Score = 63.9 bits (154), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 81/324 (25%), Positives = 136/324 (41%), Gaps = 20/324 (6%)

Query: 32  PYQCVRSLQRALDEAMRGD----ISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWI 87
           PY+ VRSL+   D+ + G     + L K +  +  + G   RA+  DV+ +  N+ A  I
Sbjct: 45  PYKLVRSLRMLQDQIVAGKPEAVVMLNKLLGFVSTDMG---RASG-DVWHNPENVYAAII 100

Query: 88  YTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVP 147
           Y     +   V  ++A          +V     Y SGQ  E  K  S     D    +  
Sbjct: 101 YLFNGGNPEAVRKVLADLKTDAVPPELVKGALAYASGQTIEVVKLFSVPLAPDVPSELKA 160

Query: 148 YLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVG--ERAFGYI 205
            + L+    M  F    A+   D VRL +PGT  EE A+R  + I    +G  ++     
Sbjct: 161 SIVLVTASQMTAFDPATALMRLDQVRLDAPGTLFEEAAIRRSMPIAA-RLGDADKIRLLA 219

Query: 206 RAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDE----DIVFTISFFSLEEQRAIYLKIA 261
           R Y+ +F  S Y   F++     F+   +KL D     ++   I       Q ++YL+IA
Sbjct: 220 RNYLQRFPRSPYMRDFMAQ----FVDAAVKLNDRIGNAELARLIGSADPVMQYSLYLQIA 275

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
           + +++ G+ +       + K++ D+L   D     LY    ++      S  R    I  
Sbjct: 276 RGALVDGQTERARFMSAEAKKLADKLKT-DPTRANLYAAASDVASDSAGSALRELSQISP 334

Query: 322 YSLMEQDRYLKKASEIIMSEIGKS 345
             L E DR L KA+E + + + ++
Sbjct: 335 DKLQEPDRKLLKAAEAVGTVVTRT 358


>gi|319403974|emb|CBI77562.1| putative flagellar motor protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 446

 Score = 63.2 bits (152), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 94/391 (24%), Positives = 169/391 (43%), Gaps = 27/391 (6%)

Query: 26  LVRTIV--PYQCVRSLQRALDEAMRG-DISLQKKIPDIVKETGVQLRATHMDVFVDNRNI 82
           L +TIV  P   VRSLQ   D+ + G +  LQK++  ++ E G +       V+ D  N+
Sbjct: 53  LSKTIVSEPVHLVRSLQNLQDKIISGQEEELQKQL-QLLGEIGDKFLTFDASVWKDKNNL 111

Query: 83  DAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNT 142
            A+ IY     +  VV  ++ K  KG     ++     Y S +     K  +++ ++D  
Sbjct: 112 YALLIYLFNGGNPRVVQSILEKYGKGVISENVMDGALAYASHKKTTFLKTYTQLTEED-I 170

Query: 143 RGIVPYLHLLIGRA----MMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQ--NE 196
           R I P L   +  +    ++      A+   D VRL +PGT  EE A+R  L++     E
Sbjct: 171 RSIPPALFASVVLSTVVNIIEKDPALALKQLDQVRLFAPGTLFEEGAIRRELKVASMLGE 230

Query: 197 VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAI 256
           +   A   IR YV +F  S Y   F    +   L    KL  + +   +++   + Q   
Sbjct: 231 IDLLAL-LIRHYVHRFWKSPYAYDFWHEFIPAVLRLDEKLSIDQLEALLAYAPTKVQFMA 289

Query: 257 YLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRST 316
           Y+ +++ ++I  + +   L+ ++   +   +   D +    Y   L+       +LQ   
Sbjct: 290 YMAVSRAALIDARMEKAKLSAQKALTLAHEIGVDDTSVRLYYAMSLSGSIAAQEALQM-I 348

Query: 317 CNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFE-----------HIQKDLLLDKKEP 365
            NI Y  L E+DR+L  A++ +   +    +D+  E           H +  L L+K + 
Sbjct: 349 QNIIYKDLSEKDRFLFIAAQAVAQRVVSFPLDVLKEKNTQIASQPQSHKELKLTLEKDDK 408

Query: 366 RHTNVSM---GIESFIKKNRSQIESIDVLLA 393
           +    S+    ++ FI+  + +I  ID LL 
Sbjct: 409 QKNTASLIEAEMKQFIQHTQEKINEIDQLLG 439


>gi|319406990|emb|CBI80627.1| putative flagellar motor protein [Bartonella sp. 1-1C]
          Length = 448

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 90/391 (23%), Positives = 170/391 (43%), Gaps = 27/391 (6%)

Query: 26  LVRTIV--PYQCVRSLQRALDEAMRG-DISLQKKIPDIVKETGVQLRATHMDVFVDNRNI 82
           L +T+V  P   VRSLQ   D+ + G +  LQK++  ++ E G +       V+ D  N+
Sbjct: 55  LSKTVVSEPVHLVRSLQNLQDKIISGQEEELQKQL-QLLGEIGDKFLTFDASVWKDKNNL 113

Query: 83  DAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNT 142
            A+ IY     +  VV  ++ K  KG     ++     Y S +     K  +++ ++D  
Sbjct: 114 YALLIYLFNGGNPRVVQSILEKYGKGVISENVMDGALAYASHKKTTFLKTYTQLTEED-I 172

Query: 143 RGIVPYL--HLLIGRAMMPFSSQQAVHF--FDYVRLTSPGTFLEEIALRNLLEITQ--NE 196
           R I P L   +++   +       A+     D VRL +PGT  EE A+R  L++     E
Sbjct: 173 RSIPPALFASVVLSTVVNIIEKDPALALKQLDQVRLFAPGTLFEEGAIRRELKVASMLGE 232

Query: 197 VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAI 256
           +   A   IR YV +F  S Y   F    +   L    KL  + +   +++   + Q   
Sbjct: 233 IDLLAL-LIRHYVHRFWKSPYAYDFWHEFIPAVLRLDEKLSIDQLEALLAYAPTKVQFMA 291

Query: 257 YLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRST 316
           Y+ +++ ++I  + +   L+ ++   +   +   D  +++LY  +     +      +  
Sbjct: 292 YMAVSRAALIDARMEKAKLSAQKALTLAHEIGVDD-TSVRLYYAMSLAGSIAAQEALQMI 350

Query: 317 CNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDI-----------DFEHIQKDLLLDKKEP 365
            NI Y  L E+DR+L  A++ +   +    +D+              H +  L L+K + 
Sbjct: 351 QNIIYKDLSEKDRFLFIAAQAVAQRVISFPLDVLKKKNTQIVSQPQSHEELKLTLEKDDK 410

Query: 366 RHTNVSM---GIESFIKKNRSQIESIDVLLA 393
           ++   S+    ++ FI+  + +I  ID LL 
Sbjct: 411 QNNTTSLIEAEMKQFIQHTQEKINEIDQLLG 441


>gi|217976236|ref|YP_002360383.1| chemotaxis protein [Methylocella silvestris BL2]
 gi|217501612|gb|ACK49021.1| chemotaxis protein [Methylocella silvestris BL2]
          Length = 403

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 87/400 (21%), Positives = 155/400 (38%), Gaps = 27/400 (6%)

Query: 5   YLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKET 64
           +L     VA D   +     D    + P++ VR++    D  + GD + + K+P ++ + 
Sbjct: 14  WLFQGFAVAQDGHSAAPQGGD----VRPFELVRTVAALQDRIVMGDAAAKAKLPLLISQI 69

Query: 65  GVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSG 124
             +L A    V+ + RN  A+  YT+      V+  ++      + +  ++     Y  G
Sbjct: 70  SDRLFACGAAVWAEARNDHAIVAYTLSGGQPRVIRKVLQTGAVPHAEADLMAGALAYAEG 129

Query: 125 QLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEI 184
           Q  ++ + L  I+       +   + L     +     ++A    D  R+ +PGT +EE 
Sbjct: 130 QEAKAKQILLPIEATKLPPSVGGLVALAQAALLSKIDPRRAARLLDEARILAPGTLVEEA 189

Query: 185 ALRNLLEITQNEVGE------RAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPD 238
           ALR    +  +EV +       +  Y R Y    + + ++  F   ++RF L  +   P 
Sbjct: 190 ALRR-SALLADEVADFDRFINASSQYFRRYSKSLYANDFRRRFAESIVRFGLKDEPG-PS 247

Query: 239 EDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRI-IDRLDYKDLATIQL 297
             +   +S      Q  +YL IAQ  V +G  KIG       K + +        +  QL
Sbjct: 248 ARLTGLLSELDRPYQAELYLIIAQAGVRNG--KIGPAKAAAEKALSLSEQGGAARSRAQL 305

Query: 298 YENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKD 357
           Y  I  +  V           I    L   DR LK A   + ++I +S    D    Q  
Sbjct: 306 YAAIAKVLIVSPAEGLTELAQIDDAVLPRGDRDLKSAVAQLATQIQRS---ADGGQAQDA 362

Query: 358 LLLDKK-----EPRHTNVSMGIESFIKKNRSQIESIDVLL 392
             +D+      E    N SM     I+  ++ ++  D LL
Sbjct: 363 SSIDRAPGSGGESHDANGSM----LIQSAQAALQQTDALL 398


>gi|319898652|ref|YP_004158745.1| flagellar motor protein [Bartonella clarridgeiae 73]
 gi|319402616|emb|CBI76161.1| putative flagellar motor protein [Bartonella clarridgeiae 73]
          Length = 428

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 93/384 (24%), Positives = 171/384 (44%), Gaps = 25/384 (6%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           P Q VRSLQ   D+ + G   + ++   +++E G +      DV+ D+ N+ A+ IY   
Sbjct: 41  PIQFVRSLQNLQDKIISGQEEVLQEQLQLLEEIGDKFLTFDSDVWKDDNNLYALLIYLFN 100

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             +  VV  ++ K  KG     I+     Y S +     K  +++ ++D  R I P L  
Sbjct: 101 GGNPRVVQIILEKYGKGVISQNIMDCALAYASHKRAAFVKAYTQLTEED-VRSIPPALFA 159

Query: 152 LIGRAMMPFSSQQ----AVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAF--GYI 205
            +  + +    ++    A+   D +RL +PGT  EE A+R  L++  + +GE       +
Sbjct: 160 SVVLSTVVNIIEKDPILALKQLDQIRLFAPGTLFEEGAIRRELKVA-SILGETDLLALLV 218

Query: 206 RAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSV 265
           R Y  +F  S Y   F        L    KL  E +   +S+   + Q   Y+++++ ++
Sbjct: 219 RHYAHRFWKSPYAHDFWHEFTPAILQIDEKLSVEQLETLVSYAPTKVQFITYMEVSRAAL 278

Query: 266 ISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLM 325
           I  + +   L+ ++   +   +D  D +    Y   L        S+Q    NI Y  L 
Sbjct: 279 IDARMEKAQLSAQKALTLAHEIDVDDTSARLYYAMSLAGSITAQESIQM-LQNITYKDLS 337

Query: 326 EQDRYLKKASE-----IIMSEIG-----KSLIDIDFE-HIQKDLLLD-KKEPRHTNVSMG 373
           ++DR+L  A++     +I S +G     K+ + +  +   +  L+L+ +K+ +  N    
Sbjct: 338 KKDRFLFTAAQAVAKRVISSPLGDQKEKKAQVTLQPQSQGELKLILELEKDAKQQNTISP 397

Query: 374 IES----FIKKNRSQIESIDVLLA 393
           IE+    FI+  R +I  ID LL 
Sbjct: 398 IEAEMNQFIQNTREKINEIDQLLG 421


>gi|27355142|dbj|BAC52126.1| motC [Bradyrhizobium japonicum USDA 110]
          Length = 386

 Score = 60.5 bits (145), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 108/249 (43%), Gaps = 6/249 (2%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PY+ VR+LQ   D    GD +       ++++ G +  A    V+ + +N  AV IY + 
Sbjct: 25  PYELVRALQAVQDGIANGDTAAHGSHIALIRQIGEKFLAADASVWSNAQNGQAVVIYLLS 84

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
                +V  L  +D K   D  +      Y  G+ +E+ + L  +K +    G+   + L
Sbjct: 85  GGAPQLVRKL-PRD-KMNVDARLFDGALAYVEGRQDEARELLKDVKPRTIPSGLGGQVAL 142

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIAL-RNLLEITQNEVGERAFGYIRAYVT 210
           + G       +  A+   D  RL  PGT +EE AL R +L + Q E  ++      AY+ 
Sbjct: 143 VQGALFARTEASLAIERLDDARLLLPGTLVEEAALRREILLVGQAEDFDKFEFLTLAYIR 202

Query: 211 QFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRA---IYLKIAQNSVIS 267
            + +SIY   F            L L +      ++     ++ +   +YL IA+++++ 
Sbjct: 203 HYRNSIYAGDFWQRFSTGLTQSSLALDERRFARIVTMLEQIDRGSRLKLYLVIARSAMVR 262

Query: 268 GKRKIGFLA 276
           G+  +  LA
Sbjct: 263 GRMAVTRLA 271


>gi|161511088|ref|NP_773501.2| chemotaxis protein [Bradyrhizobium japonicum USDA 110]
          Length = 397

 Score = 60.1 bits (144), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 107/249 (42%), Gaps = 6/249 (2%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PY+ VR+LQ   D    GD +       ++++ G +  A    V+ + +N  AV IY + 
Sbjct: 36  PYELVRALQAVQDGIANGDTAAHGSHIALIRQIGEKFLAADASVWSNAQNGQAVVIYLLS 95

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
                +V  L  +D K   D  +      Y  G+ +E+ + L  +K +    G+   + L
Sbjct: 96  GGAPQLVRKL-PRD-KMNVDARLFDGALAYVEGRQDEARELLKDVKPRTIPSGLGGQVAL 153

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIAL-RNLLEITQNEVGERAFGYIRAYVT 210
           + G       +  A+   D  RL  PGT +EE AL R +L + Q E  ++      AY+ 
Sbjct: 154 VQGALFARTEASLAIERLDDARLLLPGTLVEEAALRREILLVGQAEDFDKFEFLTLAYIR 213

Query: 211 QFHHSIYKDHFISVLLRFFLHGQLKLPDE---DIVFTISFFSLEEQRAIYLKIAQNSVIS 267
            + +SIY   F            L L +     IV  +       +  +YL IA+++++ 
Sbjct: 214 HYRNSIYAGDFWQRFSTGLTQSSLALDERRFARIVTMLEQIDRGSRLKLYLVIARSAMVR 273

Query: 268 GKRKIGFLA 276
           G+  +  LA
Sbjct: 274 GRMAVTRLA 282


>gi|319405417|emb|CBI79036.1| putative flagellar motor protein [Bartonella sp. AR 15-3]
          Length = 434

 Score = 57.4 bits (137), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 90/383 (23%), Positives = 162/383 (42%), Gaps = 25/383 (6%)

Query: 32  PYQCVRSLQRALDEAMRG-DISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTI 90
           P   VRSLQ   D+ + G +  LQK++  +++E G +       ++ D  N+ A+ IY  
Sbjct: 49  PVHLVRSLQNLQDKIISGQEKELQKQL-QLLEEIGDKFLTFDSSIWKDKNNLYALLIYLF 107

Query: 91  ISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLH 150
              +  VV  ++ K  KG     I+     Y S +     K  +++  KD  + I P L 
Sbjct: 108 NGGNPRVVQSILEKYGKGVIPQNIIDDALAYVSHKKNAFLKAYTQLTVKD-VQSIPPALF 166

Query: 151 LLIGRAMMPFSSQQ----AVHFFDYVRLTSPGTFLEEIALRNLLEITQ--NEVGERAFGY 204
             I  + +    ++    A++  D VRL +PGT  EE A+R  L++     E+   A   
Sbjct: 167 ASIVLSTVVNIIEKDPVLALNTLDQVRLFAPGTLFEEGAIRRELKVASILGEIDLMAL-L 225

Query: 205 IRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNS 264
           IR YV +F  S Y   F    +   L    KL  E +   + +   + +   Y+ +++ +
Sbjct: 226 IRHYVHRFWKSPYACDFWYEFIPAILRVDEKLSIEQLETLLVYAPTKVRFMTYMAVSRAA 285

Query: 265 VISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSL 324
           +I  + +   ++ ++   +   +   D +    Y   L        +LQ    NI Y  L
Sbjct: 286 LIDARMEKAQISAQKALTLAREIGVDDTSAHLYYAMSLAGSIAAEEALQM-IQNIVYKDL 344

Query: 325 MEQDRYLKKASEIIMSEIGKSLIDI-------------DFEHIQKDLLLDKKEPRH-TNV 370
            E+DR+L  A++ +   +    + I              +E ++  L  D K+    + +
Sbjct: 345 SEKDRFLFIAAQAVAQRVVSFPLGILEKKKEKLALQPQSYEELKLTLEKDAKQQNTISPI 404

Query: 371 SMGIESFIKKNRSQIESIDVLLA 393
              I+ FI+  R +I  ID LL 
Sbjct: 405 ETEIKEFIQHTREKINEIDQLLG 427


>gi|328545494|ref|YP_004305603.1| chemotaxis protein [polymorphum gilvum SL003B-26A1]
 gi|326415235|gb|ADZ72298.1| Probable chemotaxis protein [Polymorphum gilvum SL003B-26A1]
          Length = 400

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 106/249 (42%), Gaps = 12/249 (4%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PY+ VR+LQ    E  +G+         ++ +          + + D RN  A  I+ + 
Sbjct: 32  PYRMVRTLQALQGEVAQGNSHAHTAQRALLLQMDEVFATAPAETWSDPRNARAAVIHLLS 91

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
                V+  L+  D +   D A++     Y  G+ EE+   L+ I   D    +   + L
Sbjct: 92  GGHPRVMRQLLDLDPQPDLDPALMRGALAYVEGRQEEARDLLTAIDPMDLPPNLGGQVAL 151

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVG--ERAFGYIRAYV 209
           +     +    + A+      RL  PGT +EE ALR  + +   ++G  ER       Y+
Sbjct: 152 VRAALAVGDDPEAAMKMLGVARLLMPGTLVEEAALRREVFVA-GKIGDIERFQSLSIRYL 210

Query: 210 TQFHHSIYKDHFISVLLRFFLHGQ-LKLPDEDIVFT-----ISFFSLEEQRAIYLKIAQN 263
            +F  SIY+  F     RF L  + L   + D  F      ++ F  + +R +YL++A+ 
Sbjct: 211 RRFRGSIYEGDFRR---RFALALETLGFGENDAKFALLESLLAEFDSDSRRMLYLRLARQ 267

Query: 264 SVISGKRKI 272
           +++ G  +I
Sbjct: 268 ALVGGHLEI 276


>gi|254502667|ref|ZP_05114818.1| hypothetical protein SADFL11_2706 [Labrenzia alexandrii DFL-11]
 gi|222438738|gb|EEE45417.1| hypothetical protein SADFL11_2706 [Labrenzia alexandrii DFL-11]
          Length = 399

 Score = 53.5 bits (127), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 135/282 (47%), Gaps = 33/282 (11%)

Query: 16  VFFSFATDQDLVR--TIVPYQCVRSLQRALDEAMRGDIS---LQKKIPDIVKETGVQLRA 70
           VFF+   DQ +    T  P++ VR+LQ A ++   G+ S   +Q+ +   + E  +QL  
Sbjct: 16  VFFA---DQAMANQATKEPFEMVRALQSAQEQVASGNDSAAAMQRALLAKMDEIFLQL-- 70

Query: 71  THMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESS 130
             ++ + D RN  A  I+ +   +  VV  L+        D+ ++ A   Y  G+ E+  
Sbjct: 71  -PLEAWQDPRNARASVIHLLSGGNPEVVRHLLTLTPAPVIDLNLMEASLAYVEGREEDM- 128

Query: 131 KELSKIKDKDNTRGIVPYL--HLLIGRAMMPFSSQQAVHFFDYVRLTS---PGTFLEEIA 185
             L+++ D D    + P L  H+ + +A+ P+     V   + +++ S   PGT +EE A
Sbjct: 129 --LTRLADVDPLT-LPPSLGGHIALVKAV-PYIQTDPVRAMELLQIASLLMPGTLVEEAA 184

Query: 186 LRNLLEITQNEVG--ER----AFGYIRAYVTQFHHSIYKDHF-ISVLLRFFLHGQLKLPD 238
           LR  + +    VG  ER    +  Y+R Y    +   ++  F I++    F+  Q K   
Sbjct: 185 LRREV-LVAGLVGDIERFRTLSIRYLRRYRASVYSGDFRRRFAIALDTLGFVEDQDKF-- 241

Query: 239 EDIVFTI-SFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQ 279
            D+++ +   F  + +R +Y+++A+++++ G  +I   A  Q
Sbjct: 242 -DLLYGVLEEFEDDSRRGLYMRLARSALLGGNLQIASKATDQ 282


>gi|218515864|ref|ZP_03512704.1| chemotaxis protein [Rhizobium etli 8C-3]
          Length = 202

 Score = 49.7 bits (117), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 53/104 (50%)

Query: 239 EDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLY 298
           +D+V  +SF     QR +YL+IA+ + ISGK ++  +A+++++ +    D         Y
Sbjct: 13  QDVVDILSFMDAPRQREVYLRIARAAAISGKPELARMAVERVQSLGAGTDNAFGPLADFY 72

Query: 299 ENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEI 342
             +  +P  DI    ++   I   +L  +D+ L+ A+  +  +I
Sbjct: 73  GGMAGLPTQDIDRAAKNVSGIDGNALSPRDQALQAAARSVAEQI 116


>gi|158422248|ref|YP_001523540.1| chemotaxis protein MotC [Azorhizobium caulinodans ORS 571]
 gi|158329137|dbj|BAF86622.1| hypothetical MotC chemotaxis protein [Azorhizobium caulinodans ORS
           571]
          Length = 872

 Score = 49.7 bits (117), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 59/256 (23%), Positives = 112/256 (43%), Gaps = 16/256 (6%)

Query: 31  VPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTI 90
           +PY+ VR LQR  D    GD +  +    ++ E           V+ D RN  A  ++ +
Sbjct: 394 LPYEQVRRLQRLQDRIATGDTAALQAQRALIAEIEDAFHKADPKVWQDPRNARAAVVFFL 453

Query: 91  ISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKD---KDNTRGIVP 147
                  + +L++       D  ++     Y  G+ E++ + L+ I      D   G + 
Sbjct: 454 SGGSPKELRNLLSLKPAPAIDERLLQGALAYVEGRPEDAERYLANINPLQLPDALGGQIA 513

Query: 148 YLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGE-RAFGYI- 205
            +   +     P   ++A+   D  RL  PGT +EE ALR  + +   ++GE   F ++ 
Sbjct: 514 MVQAAVTVGKDP---RKAMAQLDIARLVMPGTLVEEAALRREI-LVAAQLGELNKFEHLS 569

Query: 206 RAYVTQFHHSIY----KDHFISVLLRF-FLHGQLKLPDEDIVFTISFFSLEEQRAIYLKI 260
           + Y+ +F HS+Y    +  F + L R  F++ + +   + +V  +     + +  IYL +
Sbjct: 570 KQYLYRFRHSVYAGNFRQRFAAALTRMAFVNDRDQF--QRLVSLLQPLDRDSRVDIYLMV 627

Query: 261 AQNSVISGKRKIGFLA 276
           A+ ++  GK     LA
Sbjct: 628 ARGALNQGKFTAASLA 643


>gi|118589970|ref|ZP_01547374.1| probable chemotaxis protein precursor [Stappia aggregata IAM 12614]
 gi|118437467|gb|EAV44104.1| probable chemotaxis protein precursor [Stappia aggregata IAM 12614]
          Length = 411

 Score = 49.7 bits (117), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 56/246 (22%), Positives = 108/246 (43%), Gaps = 14/246 (5%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PY+ +RSLQ   ++  +G+    +    ++ +          +V+ + RN  A  ++ + 
Sbjct: 42  PYEMIRSLQSLQEQISQGNTHALQAQRALLTKMDAHFVVLQAEVWQEPRNARAAVVHLLS 101

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
                V+  L++ D     D  ++ A   Y  G+ EE    L+ I   +    +  ++ L
Sbjct: 102 GGHPDVMRYLLSLDPAPAVDRKLMEASLAYVEGREEEMQVLLADIDPLELPASLGGHVAL 161

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRN---LLEITQNEVGERAFGYIRAY 208
           +     +    ++A+       L  PGT +EE ALR    L  +T N    R    IR Y
Sbjct: 162 VKAAPYIRTDPEKAMELLQVASLLMPGTLVEEAALRREVFLAGMTANVDRFRVLS-IR-Y 219

Query: 209 VTQFHHSIYKDHFISVLLRFFLH----GQLKLPDEDIVF--TISFFSLEEQRAIYLKIAQ 262
           + +F  S+Y   F     RF L     G +K  D+  +    +  F  + +R +YL++A+
Sbjct: 220 LRRFRASVYSGDFRR---RFALSLDTLGFVKSEDKFALLDDVLHEFDADSRRGLYLRLAR 276

Query: 263 NSVISG 268
           +++++G
Sbjct: 277 SALLAG 282


>gi|304392496|ref|ZP_07374436.1| putative chemotaxis protein [Ahrensia sp. R2A130]
 gi|303295126|gb|EFL89486.1| putative chemotaxis protein [Ahrensia sp. R2A130]
          Length = 389

 Score = 46.6 bits (109), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 79/176 (44%), Gaps = 14/176 (7%)

Query: 113 AIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYV 172
           A+ +A+     G+   + +   KI+       +VPY+ L  G+ +        +     V
Sbjct: 117 ALAHAVADNIGGRRVRALRRFLKIEMTSLPVSLVPYVALAKGQLLAQSEPDAGIVLLSIV 176

Query: 173 RLTSPGTFLEEIALRNLLEIT-QNEVGERAFGYIRAYVTQFHHSIYKDHFISVL----LR 227
              +PGT LEE ALR  L++  + ++  R +   R Y  +F  S Y+  F   L    + 
Sbjct: 177 GQLAPGTLLEEAALRRKLQLALRGKMAARFYAAARQYTYRFIGSPYRASFAQALQKAAVE 236

Query: 228 FFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRI 283
           F  HG     D D V  +   +L     + ++IA+ ++++G+     LA K ++R+
Sbjct: 237 FPEHGD----DLDAVLALMPENLRSP--MQVRIARMALLAGQDG---LARKMVQRV 283


>gi|156843215|ref|XP_001644676.1| hypothetical protein Kpol_1056p19 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115324|gb|EDO16818.1| hypothetical protein Kpol_1056p19 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 1131

 Score = 43.9 bits (102), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 93/194 (47%), Gaps = 25/194 (12%)

Query: 208 YVTQFHHS--IYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSV 265
           Y TQFH    +  + F+ +L       +  +P+E+ V  I F + +    I + +    +
Sbjct: 730 YNTQFHGVPVLIPNQFMRIL-----RNEYGVPEENRV--IEFKTWKYVPEIRMWVESGII 782

Query: 266 ISGKRKIGFLA-IKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSL 324
                 +G+   +++L   +D LDYKD+    LY N++   ++DI+SL  S+ N+  Y +
Sbjct: 783 DKAANHLGWYPNLQKLNSTLDDLDYKDVKI--LYYNMMKSGYIDIVSLAHSSSNVFSYKI 840

Query: 325 MEQ----DRYLKKASEI-IMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIK 379
            E     D+ LK A +  ++SE+ +S I     +  KD  L K E R  + +M       
Sbjct: 841 KENEIMFDKKLKPAEKAQLLSEL-RSTILPAVRNPAKDPYLFKYEKRLWDETM------- 892

Query: 380 KNRSQIESIDVLLA 393
           K++ + + ID LL 
Sbjct: 893 KSKFEGDDIDTLLT 906


>gi|296447980|ref|ZP_06889886.1| chemotaxis protein [Methylosinus trichosporium OB3b]
 gi|296254490|gb|EFH01611.1| chemotaxis protein [Methylosinus trichosporium OB3b]
          Length = 377

 Score = 42.7 bits (99), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 36/179 (20%), Positives = 75/179 (41%), Gaps = 4/179 (2%)

Query: 111 DIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFD 170
           D  ++ A   Y  G+  ++    ++I  K+    +  +L L+ G  ++   + +A    D
Sbjct: 104 DRPLIDASLAYAEGRSRDAMPMFAQIDPKEQPATLGGHLALVRGGLLIGSDNARARELLD 163

Query: 171 YVRLTSPGTFLEEIALRNLLEITQNEVGERAFGYI-RAYVTQFHHSIYKDHFISVLLRFF 229
             RL  P + +EE ALR  + +         F  + R YV Q+  S +  +F        
Sbjct: 164 LARLLMPSSLVEEAALRREVAVVDPLQDAAKFLLLARRYVAQYSRSPFARNFWGEARAAT 223

Query: 230 LHGQLKLPDEDIVFTISFFSLEEQRA---IYLKIAQNSVISGKRKIGFLAIKQLKRIID 285
           +   L +P+  +   ++ F          +++ IAQN+++ G+  +  L   +   + D
Sbjct: 224 IRVALDIPERQLGEFLALFDATPAATRFDLHMTIAQNAILHGRPALAALETDRAATLAD 282


>gi|312115286|ref|YP_004012882.1| hypothetical protein Rvan_2568 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220415|gb|ADP71783.1| hypothetical protein Rvan_2568 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 386

 Score = 41.6 bits (96), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 54/132 (40%), Gaps = 24/132 (18%)

Query: 162 SQQAVHFFDYVRLTSPGTFLEEIALRNLL-----EITQNEVGERAFGYIRAYVTQFHHSI 216
           +Q+A  ++   RL  PGT +EE ALR  +     ++   E  E A  YIR + T      
Sbjct: 156 AQRAFSYYGLARLLLPGTLVEEAALRQSIVLAGEKLRAQEFAEAALAYIRRFDTSTFAGD 215

Query: 217 YKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYL---------KIAQNSVIS 267
            +   +S L RF          ED         + E R +           ++AQ  V+S
Sbjct: 216 AETRIVSYLPRF----------EDADGAAILERMLEARPMGFGRCPVCFLTEVAQRGVLS 265

Query: 268 GKRKIGFLAIKQ 279
           G+R +  LA  +
Sbjct: 266 GRRSLVLLATGK 277


>gi|323139664|ref|ZP_08074706.1| chemotaxis protein [Methylocystis sp. ATCC 49242]
 gi|322395096|gb|EFX97655.1| chemotaxis protein [Methylocystis sp. ATCC 49242]
          Length = 386

 Score = 41.6 bits (96), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 51/236 (21%), Positives = 105/236 (44%), Gaps = 23/236 (9%)

Query: 44  DEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIA 103
           DE  R +++ Q    D+++ T + L     + + + +N+ A  IY +     + + ++  
Sbjct: 44  DEKARENVARQF---DLIERTIMTL---EPETWTEEKNVRAAAIYLLCGGAPTNLREIF- 96

Query: 104 KDTKGYFD--IAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVP----YLHLLIGRAM 157
            D K   D    ++ A  +Y  GQ E ++K    + D D  R   P    +L L+ G ++
Sbjct: 97  -DAKFVSDELSPLLEAALRYAEGQDEAAAK----LMDFD-ARHFPPILGGHLALVQGGSV 150

Query: 158 MPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEV-GERAFGYIRAYVTQFHHSI 216
           +   + +A+   D  RL  P + +EE ALR  +     E   ++    +  YV ++  S 
Sbjct: 151 IGSDNARAIALLDLARLLMPASLVEEAALRREIRAVDPETDADKVSALVNRYVAKYTASP 210

Query: 217 YKDHFISVLLRFFLHGQLKLPDEDIV---FTISFFSLEEQRAIYLKIAQNSVISGK 269
           Y  +F + L        +    E +      I   S +++  IYL +++ ++++G+
Sbjct: 211 YAQNFWTELRSIVFSPSINADAELLAKFEGAIEKASTDQRLDIYLLLSRRAILNGR 266


>gi|188579879|ref|YP_001923324.1| chemotaxis protein [Methylobacterium populi BJ001]
 gi|179343377|gb|ACB78789.1| putative chemotaxis protein precursor [Methylobacterium populi
           BJ001]
          Length = 429

 Score = 40.0 bits (92), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 56/284 (19%), Positives = 111/284 (39%), Gaps = 25/284 (8%)

Query: 31  VPYQCVRSLQRALDEAMRGDISL---QKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWI 87
           +P +  R+LQ   D   RG       Q+++   +++  ++L     + + +  N+ A   
Sbjct: 66  LPVELTRTLQLLQDRIARGSTQAHLAQRQLLGHIEQRLIEL---DPEAWAEAENVRAAVT 122

Query: 88  YTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVP 147
           + +     + +  L+        +  +      Y  G+  E+  +L+ I  +    G+  
Sbjct: 123 FALAGGGPAALRVLLKSGKAPEAEQPLALGALAYLEGREREARAKLAGIDPRTMPAGLAG 182

Query: 148 YLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAFGYIR- 206
            L L     M+  +  +++   D  RL +PGT +EE ALR  + +       R F  +  
Sbjct: 183 QLALTQSALMVREAPAKSLELLDLARLLAPGTLVEEGALRRQIFVVAQGGDARRFEALAI 242

Query: 207 AYVTQFHHSIY----KDHFISVLLRFFLHGQLKLPDEDIVFTISFFSL------EEQRAI 256
            Y+ +F  S+Y    +  F   L R          D D     S   +      E +R +
Sbjct: 243 QYLRRFRRSVYAGNFRQRFAGALTRLDF-------DSDRTRIASLERMLDEIEPESRRDL 295

Query: 257 YLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYEN 300
           YL +A+  +  G+R+    A ++   +    D +  A  +LY  
Sbjct: 296 YLLVARAGLEQGRRETALFAAERAMGLAA-PDSRPAAQARLYRG 338


>gi|300024595|ref|YP_003757206.1| hypothetical protein Hden_3090 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526416|gb|ADJ24885.1| hypothetical protein Hden_3090 [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 424

 Score = 39.3 bits (90), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 57/135 (42%), Gaps = 3/135 (2%)

Query: 85  VWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRG 144
            ++Y +   D  V+  L   DT+   D  +   + KY  GQ   + K  + +  +     
Sbjct: 113 AFVYVLSGGDYGVLKPLANDDTRHEADRTLAQGIIKYAQGQTSAARKLWADVDPRSVDVS 172

Query: 145 IVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLE--ITQNEVGERAF 202
           +V    L      +     +A+   D  RL  P T +EE A+R  +   +++ E  +RA 
Sbjct: 173 LVGPFALARASLYIGNDDAKAIALLDEARLACPHTAIEEAAVRREIPVLVSKGET-QRAM 231

Query: 203 GYIRAYVTQFHHSIY 217
             +  Y+ ++  SIY
Sbjct: 232 LLLTDYLRRYGRSIY 246


>gi|317128409|ref|YP_004094691.1| peptidase M24 [Bacillus cellulosilyticus DSM 2522]
 gi|315473357|gb|ADU29960.1| peptidase M24 [Bacillus cellulosilyticus DSM 2522]
          Length = 355

 Score = 38.1 bits (87), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 54/121 (44%), Gaps = 18/121 (14%)

Query: 275 LAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKA 334
           L IK+L    D + Y   +T   YE +L             T  +P   LME+ R +K  
Sbjct: 86  LGIKKLGFEKDHVSY---STYDTYEKVLE------------TTLVPVSGLMERLRLVKDE 130

Query: 335 SEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAE 394
            EI + +    + D  FEHIQ  +    KE    +VS  +E F++K  +   S D+++A 
Sbjct: 131 KEIAIIQEAVDIADAAFEHIQTYIRAGVKE---IDVSNELEFFMRKQGAVSSSFDIIVAS 187

Query: 395 A 395
            
Sbjct: 188 G 188


>gi|15669545|ref|NP_248358.1| hypothetical protein MJ_1355 [Methanocaldococcus jannaschii DSM
           2661]
 gi|33516983|sp|Q58750|Y1355_METJA RecName: Full=Uncharacterized protein MJ1355
 gi|1591998|gb|AAB99364.1| conserved hypothetical protein [Methanocaldococcus jannaschii DSM
           2661]
          Length = 571

 Score = 36.6 bits (83), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 52/97 (53%), Gaps = 8/97 (8%)

Query: 254 RAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQ 313
           RA+ L I   + + G + I   A K+L  I+D++D + +  I      ++   + IM L 
Sbjct: 34  RALELFILGFAELKGDKIIFTEAGKKLMEIVDKIDLEKIPDI-----FVDSEIIKIMELL 88

Query: 314 RSTCNIPY-YSLMEQDRYLKKASEIIMSEIGKSLIDI 349
             T N+P  + LM ++R+L  A E  ++EIGK ++ I
Sbjct: 89  EETGNVPEDWMLMLKERFL--ADENGLTEIGKEILKI 123


>gi|297566443|ref|YP_003685415.1| peptidase M24 [Meiothermus silvanus DSM 9946]
 gi|296850892|gb|ADH63907.1| peptidase M24 [Meiothermus silvanus DSM 9946]
          Length = 347

 Score = 36.6 bits (83), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 319 IPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFI 378
           +P Y L+EQ R  K   EI       +L D  FEHI   L   K   R  ++++ +E F+
Sbjct: 109 VPTYDLIEQQRVHKTLEEIGYIRQAAALADRAFEHI---LPFLKPGVREIDIALELEFFL 165

Query: 379 KKNRSQIESIDV 390
           +KN S+  + D 
Sbjct: 166 RKNGSEGVAFDT 177


Searching..................................................done


Results from round 2




>gi|254780528|ref|YP_003064941.1| chemotaxis protein [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040205|gb|ACT57001.1| chemotaxis protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 396

 Score =  466 bits (1199), Expect = e-129,   Method: Composition-based stats.
 Identities = 396/396 (100%), Positives = 396/396 (100%)

Query: 1   MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDI 60
           MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDI
Sbjct: 1   MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDI 60

Query: 61  VKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKK 120
           VKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKK
Sbjct: 61  VKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKK 120

Query: 121 YFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTF 180
           YFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTF
Sbjct: 121 YFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTF 180

Query: 181 LEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDED 240
           LEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDED
Sbjct: 181 LEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDED 240

Query: 241 IVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYEN 300
           IVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYEN
Sbjct: 241 IVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYEN 300

Query: 301 ILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLL 360
           ILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLL
Sbjct: 301 ILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLL 360

Query: 361 DKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR 396
           DKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR
Sbjct: 361 DKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR 396


>gi|315122281|ref|YP_004062770.1| chemotaxis protein [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495683|gb|ADR52282.1| chemotaxis protein [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 397

 Score =  427 bits (1098), Expect = e-117,   Method: Composition-based stats.
 Identities = 237/399 (59%), Positives = 313/399 (78%), Gaps = 5/399 (1%)

Query: 1   MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDI 60
           MNQK LI  M++ M+VF SFA +QDL  +  PY  +R LQR LD +++     +KKI DI
Sbjct: 1   MNQKCLIMIMIMVMEVFPSFAMNQDLENSNAPYARIRFLQRVLDSSLQEGGYSKKKILDI 60

Query: 61  VKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKK 120
           V+E G+QLR T+M  F D+RN+DAV+IYTIIS+++S+++ LIA D KGYFD++IV+AL+K
Sbjct: 61  VEEVGLQLRTTNMSFFADHRNVDAVFIYTIISENISILNYLIANDKKGYFDLSIVHALRK 120

Query: 121 YFSGQLEESSKELSKIKDKDNT--RGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPG 178
           YF+G+ EES K L+ IKD D+   +GI PY +LL+GRAMM  +S++A+ FFD VRLTS G
Sbjct: 121 YFAGEFEESIKALNTIKDNDHIHIKGIEPYFYLLMGRAMMKLNSKEAIQFFDRVRLTSSG 180

Query: 179 TFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLP 237
           T LEE++LRNLLEIT N+ + E  FGYIR Y+ QF+HSIYKD+FI++LLRFFLH ++KL 
Sbjct: 181 TALEEMSLRNLLEITLNQGIEEHVFGYIRDYIRQFYHSIYKDNFINLLLRFFLHSKIKLQ 240

Query: 238 DEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQL 297
           D+DIVF +SF  ++EQRAIY KIAQ++VI GKRKIG LAI+QLK ++ +LD++DLATI L
Sbjct: 241 DKDIVFVMSFLEVDEQRAIYFKIAQHAVIFGKRKIGLLAIQQLKEMVYKLDHRDLATIWL 300

Query: 298 YENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKD 357
           Y +++NIPFVD + LQRS CNIP YSLME+DR LKK+SE+I+SE+ KS I+IDF+HI K 
Sbjct: 301 YNDLMNIPFVDTVLLQRSLCNIPEYSLMEKDRNLKKSSEVILSEMRKSSINIDFDHIDKY 360

Query: 358 LLLDKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR 396
           L+LD K+  HT+    +ESFIKKNR +IE IDV L   R
Sbjct: 361 LVLDTKQHEHTH--WNLESFIKKNRQKIEVIDVYLEGTR 397


>gi|241203120|ref|YP_002974216.1| chemotaxis protein [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857010|gb|ACS54677.1| chemotaxis motility protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 431

 Score =  422 bits (1085), Expect = e-116,   Method: Composition-based stats.
 Identities = 104/414 (25%), Positives = 187/414 (45%), Gaps = 30/414 (7%)

Query: 11  MVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRA 70
            + + +      +      + PY+ +RSLQ   D  + GD S  +    ++     +LR 
Sbjct: 13  ALGLAMLSPAGGNAQDPDDLAPYKMLRSLQFVQDSVVSGDHSAGEMQRFMLGTIDERLRT 72

Query: 71  THMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESS 130
                F D+RN+DA  IY +   +   ++ LIA D  GYFD  +   L+KY SG+    +
Sbjct: 73  VDPSTFDDDRNVDAALIYAMSGGNPQTLEYLIAHDVNGYFDNRVTDVLRKYLSGKGLLVA 132

Query: 131 KELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLL 190
           K L +   +   + I PYL L+ G  ++      A+  +D  RL +PGT +EE ALR  +
Sbjct: 133 KTLEETAREYRDKKIGPYLALIGGNVLIATKPTDALDLYDQARLAAPGTIVEEAALRRSV 192

Query: 191 EITQNE-VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFS 249
            I  ++ + +R   Y + YV +F HS Y   F  + +   +     +  +D++  +SF  
Sbjct: 193 AICVDKGMLDRGMAYSQRYVRRFLHSPYASQFADLFVTLVVGHDHDVKPQDVIDILSFMD 252

Query: 250 LEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDI 309
              QR +YL+IA+ + ISGK ++  +A+ +++ +    D    +    Y  +  +P  DI
Sbjct: 253 APRQREVYLRIARAAAISGKPELARMAVGRVQSLGAGTDNPFGSLADFYGGMAGLPTEDI 312

Query: 310 MSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSL--------IDIDFEH-------- 353
               ++   I   +L  +D+ L++A+  +  +I ++          D + +H        
Sbjct: 313 DQAAKNVSGIDGNALSPRDQALQEAARSVADQILRAPDPASLTQASDPNTDHQEITSEKA 372

Query: 354 ----IQKDLLLDKKEPRHTNVSMGIES---------FIKKNRSQIESIDVLLAE 394
                Q        EP    V+   +S         F+  NRS+++ ID LLA+
Sbjct: 373 AAIATQPGAPGALPEPVPGGVASTGQSQDTDPSFNAFVTTNRSKLDEIDGLLAQ 426


>gi|116250496|ref|YP_766334.1| chemotaxis protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255144|emb|CAK06218.1| putative chemotaxis MotC protein precursor (motility protein c)
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 431

 Score =  418 bits (1074), Expect = e-115,   Method: Composition-based stats.
 Identities = 104/414 (25%), Positives = 191/414 (46%), Gaps = 30/414 (7%)

Query: 11  MVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRA 70
            + + +    A +      + PY+ +RSLQ   D  + GD S  +    ++     +LR 
Sbjct: 13  ALGLAMLSPAAANAQDSDDLAPYKMLRSLQFVQDSVVTGDHSAGEMQRFMLGTIDTRLRT 72

Query: 71  THMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESS 130
               +F D+RN+DA  IYT+   +   ++ LIA D  GYFD  +   L+KY SG+    +
Sbjct: 73  VEPSIFDDDRNVDAALIYTMSGGNPQTLEYLIAHDVNGYFDNRVTDVLRKYLSGKGLLVA 132

Query: 131 KELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLL 190
           K L +   +   + I PYL L+ G  ++      A+  +D  RL +PGT +EE ALR  +
Sbjct: 133 KTLQETAREYRDKKIGPYLALIGGNVLIATKPTDALDLYDQARLAAPGTIVEEAALRRSV 192

Query: 191 EITQNE-VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFS 249
            I  ++ + +R   Y + YV +F HS Y   F  + +   +     +  +D++  +SF  
Sbjct: 193 AICVDKGMLDRGMAYSQRYVRRFLHSPYASQFADLFVTLVVGHDHDVKPQDVIDILSFMD 252

Query: 250 LEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDI 309
              QR +YL+IA+ + ISGK ++  +A+ +++ +    D         Y  +  +P  DI
Sbjct: 253 APRQREVYLRIARAAAISGKPELARMAVGRVQSLGGGTDNAFGPLADFYGGMAGLPTEDI 312

Query: 310 MSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSL--------IDIDFEH-------- 353
               ++   I   +L  +D+ L++A+  +  +I ++          +++ +H        
Sbjct: 313 DQAAKNVSGIDGNALSRRDQALQEAARSVAEQILRAPDPASLTQASNLNTDHQEITSEKA 372

Query: 354 ----IQKDLLLDKKEPRHTNVSMGIES---------FIKKNRSQIESIDVLLAE 394
               +Q        EP    V+   +S         F+  +RS+++ ID LLA+
Sbjct: 373 AAIAMQPGAPGALSEPVPGGVASTGQSQDTDPSFNAFVTTSRSKLDEIDGLLAQ 426


>gi|218461677|ref|ZP_03501768.1| chemotaxis protein [Rhizobium etli Kim 5]
          Length = 442

 Score =  418 bits (1074), Expect = e-115,   Method: Composition-based stats.
 Identities = 105/422 (24%), Positives = 191/422 (45%), Gaps = 30/422 (7%)

Query: 3   QKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVK 62
           Q      M + + +    A        + PY+ +RSLQ   D  + GD S  +    ++ 
Sbjct: 5   QHRYFGFMALGLAMLSPAAGHAQDPDDLSPYKMLRSLQFVQDSVVAGDHSAGEMQRFMLG 64

Query: 63  ETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYF 122
               +LR     ++ D+RN+DA  IYT+   +   ++ LIA D  GYFD  +   L+KY 
Sbjct: 65  TIDERLRTADTSIYDDDRNVDAALIYTMSGGNPQTLEYLIAHDVNGYFDNRVTEVLRKYL 124

Query: 123 SGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLE 182
           SG+    ++ L +   +   + I PYL L+ G  ++      A++ +D  RL +PGT +E
Sbjct: 125 SGKGLLVARTLEETAREYRDKKIGPYLALIGGNVLIATKPTDALNLYDQARLAAPGTIVE 184

Query: 183 EIALRNLLEITQNE-VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDI 241
           E ALR  + I  ++ + +R   Y + Y  +F HS Y   F  + ++  +     +  +D+
Sbjct: 185 EAALRRSVAICVDKGMLDRGLAYSQRYARRFLHSPYASQFADLFVKLVVAHDRDVKPQDV 244

Query: 242 VFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENI 301
           V  +SF     QR +YL+IA+ + ISGK ++  +A+++++ +    D         Y  +
Sbjct: 245 VDILSFMDAPRQREVYLRIARAAAISGKPELARMAVERVQSLGAGTDNAFGPLADFYGGM 304

Query: 302 LNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSL--------IDIDFEH 353
             +P  DI    ++   I   +L  +D+ L+ A+  +  +I ++          D +  H
Sbjct: 305 AGLPTQDIDQAAKNVSGIDGKALSPRDQALQAAARSVAEQILRAPDPASLTQASDPNTSH 364

Query: 354 ------------IQKDLLLDKKEPRHTNVSMGIES---------FIKKNRSQIESIDVLL 392
                       +Q        EP    V+   +S         F+  +RS+++ ID LL
Sbjct: 365 QEITSDKAAANAMQPGAPGAHPEPVPGGVASTGQSQDTDPSFNAFVTTSRSKLDEIDGLL 424

Query: 393 AE 394
           A+
Sbjct: 425 AQ 426


>gi|327193054|gb|EGE59966.1| chemotaxis motility protein [Rhizobium etli CNPAF512]
          Length = 431

 Score =  409 bits (1052), Expect = e-112,   Method: Composition-based stats.
 Identities = 101/424 (23%), Positives = 191/424 (45%), Gaps = 34/424 (8%)

Query: 3   QKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVK 62
           Q   +  M + + +    A +      + PY+ +RSLQ   D  + GD S  +    ++ 
Sbjct: 5   QHRYLGFMALGLAMLSPAAGNAQDPDDLSPYKMLRSLQFVQDSVVAGDHSAGEMQRFMLG 64

Query: 63  ETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYF 122
               +LR     ++ D+RN+DA  IY +   +   ++ LIA D  GYFD  +   L+KY 
Sbjct: 65  TIDERLRTADTSIYDDDRNVDAALIYAMSGGNPQTLEYLIAHDVNGYFDNRVTDVLRKYL 124

Query: 123 SGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLE 182
           SG+    +K L +   +   + I PYL L+ G  ++      A+  +D  RL +PGT +E
Sbjct: 125 SGKGLLVAKTLEETAREYRDKKIGPYLALIGGNVLIATKPTDALDLYDQARLAAPGTIVE 184

Query: 183 EIALRNLLEITQNE-VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDI 241
           E ALR  + I  ++ + ++   Y + Y  +F HS Y   F  + ++  +     +  +D+
Sbjct: 185 EAALRRSVAICVDKGLLDKGLAYSQRYARRFLHSPYASQFADLFVKLVVAHDRDVKPQDV 244

Query: 242 VFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENI 301
           V  +SF     QR +YL+IA+ + ISGK ++  +A+++++ +    D         Y  +
Sbjct: 245 VDILSFMDAPRQREVYLRIARAAAISGKPELARMAVERVQSLGAGTDNAFGPLADFYGGM 304

Query: 302 LNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSL--------IDIDFEH 353
             +P  DI    ++   I   +L  +D+ L+ A+  +  +I ++          D +  H
Sbjct: 305 AGLPTQDIDQAAKNVSGIDGNALSPRDQALQAAARSVAEQILRAPDPTSLTQASDPNTSH 364

Query: 354 IQ-----------------------KDLLLDKKEPRHTNVSMGIESFIKKNRSQIESIDV 390
            +                          +    + + T+ S    +F+  +RS+++ ID 
Sbjct: 365 QEITSEKAAAIAMQPGAPGAPPEPVPGGVASTGQSQDTDPSFN--AFVTTSRSKLDEIDG 422

Query: 391 LLAE 394
           LLA+
Sbjct: 423 LLAQ 426


>gi|86356326|ref|YP_468218.1| chemotaxis protein [Rhizobium etli CFN 42]
 gi|86280428|gb|ABC89491.1| chemotaxis motility protein [Rhizobium etli CFN 42]
          Length = 431

 Score =  403 bits (1036), Expect = e-110,   Method: Composition-based stats.
 Identities = 104/415 (25%), Positives = 187/415 (45%), Gaps = 30/415 (7%)

Query: 10  MMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLR 69
           M + + +    A        + PY+ +RSLQ   D  + GD S  +    ++     +LR
Sbjct: 12  MALGLAMLSPAAGKAQDPDDLAPYKMLRSLQFVQDSVVAGDHSAGEMQRFMLGTIDERLR 71

Query: 70  ATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEES 129
                +F D+RN+DA  IYT+   +   ++ LIA D  GYFD  +   L+KY +G+    
Sbjct: 72  TADTKIFDDDRNVDAALIYTMSGGNPQTLEYLIAHDVNGYFDNRVTDVLRKYLTGKGLLV 131

Query: 130 SKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNL 189
           +K L +   +   + I PYL L+ G  M+      A+  +D  RL +PGT +EE ALR  
Sbjct: 132 AKTLEETAREYRDKKIGPYLALIGGNVMIATKPTDALDLYDQARLAAPGTIVEEAALRRS 191

Query: 190 LEITQNE-VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFF 248
           L I  ++ + ++   Y + Y  +F HS Y   F  + ++  +     +  +D+V  +SF 
Sbjct: 192 LAICVDKGMLDKGLAYSQRYARRFLHSPYASQFADLFVKLVVAHDHDVKPQDVVDILSFM 251

Query: 249 SLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVD 308
               QR +YL+IA+ + I+GK ++  +A++ ++ +    D         Y  +  +P  D
Sbjct: 252 DAPRQREVYLRIARAAAIAGKPELARMAVEHVQLLGAGTDNAFGPLADFYGGMAGLPTDD 311

Query: 309 IMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSL--------IDIDFEH------- 353
           I    ++   I   +L  +D+ L+ A+  +  +I ++          + +  H       
Sbjct: 312 IDQAAKNVSGIDGEALSPRDQALQAAARSVAEQILRAPDPASLTQASNPNTSHQEITSEK 371

Query: 354 -----IQKDLLLDKKEPRHTNVSMGIES---------FIKKNRSQIESIDVLLAE 394
                 Q        EP    V+   +S         F+  +RS+++ ID LLA+
Sbjct: 372 AAAIATQPGTPGAPPEPVPGGVASTGQSQDTDSSFNAFVTTSRSKLDEIDGLLAQ 426


>gi|209547942|ref|YP_002279859.1| chemotaxis protein [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209533698|gb|ACI53633.1| chemotaxis motility protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 431

 Score =  403 bits (1036), Expect = e-110,   Method: Composition-based stats.
 Identities = 104/422 (24%), Positives = 191/422 (45%), Gaps = 31/422 (7%)

Query: 3   QKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVK 62
            +Y+    +    +  + A  QD    + PY+ +RSLQ   D  + GD S  +    ++ 
Sbjct: 6   HRYVGFVALGLAMLSPAAAKAQD-PDDLAPYKMLRSLQFVQDSVVSGDHSAGEMQRFMLG 64

Query: 63  ETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYF 122
               +LR+    VF D+RN+DA  IY +   +   ++ LIA D  G+FD  +   L+KY 
Sbjct: 65  TIDERLRSVDTSVFDDDRNVDAALIYAMSGGNPQTLEYLIAHDVNGHFDNRVTDVLRKYL 124

Query: 123 SGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLE 182
           SG+    +K L +   +   + I PYL L+ G  ++  +   A+  +D  RL +PGT +E
Sbjct: 125 SGKGLLVAKTLEETAREYRDKKIGPYLALIGGNVLIATNPTDALDLYDQARLAAPGTIVE 184

Query: 183 EIALRNLLEITQNE-VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDI 241
           E ALR  + I  ++ + +R   Y + Y+ +F HS Y   F  + +   +     +  +D+
Sbjct: 185 EAALRRSVAICVDKGMLDRGMAYSQRYIRRFLHSPYASQFADLFVTLVVGHDHDVKPQDV 244

Query: 242 VFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENI 301
           +  +SF     QR +YL+IA+ + I+GK ++  +A+++++ +    D         Y  +
Sbjct: 245 IDILSFMDAPRQREVYLRIARAAAIAGKPQLAHMAVERVQSLGAGTDNAFGPLADFYGGM 304

Query: 302 LNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHI------- 354
             +P  DI    ++   I   +L  +D+ L++A+  +  +I ++                
Sbjct: 305 AGLPTEDIDQAAKNVSGIAGNTLSPRDQALQEAARSVAEQILRAPDPASLTQASDPNTSD 364

Query: 355 -------------QKDLLLDKKEPRHTNVSMGIES---------FIKKNRSQIESIDVLL 392
                        Q        EP    V+   +S         F+  NRS+++ ID LL
Sbjct: 365 QEITSEKAAAIAPQPGAPGALPEPVPGGVASTGQSQGTDPSFNAFVTTNRSKLDEIDGLL 424

Query: 393 AE 394
           A+
Sbjct: 425 AQ 426


>gi|190890378|ref|YP_001976920.1| chemotaxis motility protein [Rhizobium etli CIAT 652]
 gi|190695657|gb|ACE89742.1| chemotaxis motility protein [Rhizobium etli CIAT 652]
          Length = 431

 Score =  402 bits (1034), Expect = e-110,   Method: Composition-based stats.
 Identities = 101/424 (23%), Positives = 190/424 (44%), Gaps = 35/424 (8%)

Query: 3   QKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVK 62
            +YL    +    +  +    QD    + PY+ +RSLQ   D  + GD S  +    ++ 
Sbjct: 6   HRYLGFIALGLAMLSPAAGNAQD-PDDLSPYKMLRSLQFVQDSVVAGDHSAGEMQRFMLG 64

Query: 63  ETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYF 122
               +LR     ++ D+RN+DA  IY +   +   ++ LIA D  GYFD  +   L+KY 
Sbjct: 65  TIDERLRTADTAIYDDDRNVDAALIYAMSGGNPQTLEYLIAHDVNGYFDNRVTDVLRKYL 124

Query: 123 SGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLE 182
           SG+    +K L +   +   + I PYL L+ G  ++      A+  +D  RL +PGT +E
Sbjct: 125 SGKGLLVAKTLEETAREYREKKIGPYLALIGGNVLIATKPTDALDLYDQARLAAPGTIVE 184

Query: 183 EIALRNLLEITQNE-VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDI 241
           E ALR  + I  ++ + ++   Y + Y  +F HS Y   F  + ++  +     +  +D+
Sbjct: 185 EAALRRSVAICVDKGMLDKGLAYSQRYARRFLHSPYASQFADLFVKLVVAHDRDVKPQDV 244

Query: 242 VFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENI 301
           V  +S      QR +YL+IA+ + ISGK ++  +A+++++ +    D         Y  +
Sbjct: 245 VDILSLMDAPRQREVYLRIARAAAISGKPELARMAVERVQSLGAGTDNAFGPLADFYGGM 304

Query: 302 LNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSL--------IDIDFEH 353
             +P  DI    ++   I   +L  +D+ L+ A+  +  +I ++          D +  H
Sbjct: 305 AGLPTQDIDRAAKNVSGIDGNALSPRDQALQAAARSVAEQILRAPDPASLTQASDPNTSH 364

Query: 354 IQ-----------------------KDLLLDKKEPRHTNVSMGIESFIKKNRSQIESIDV 390
            +                          +    + + T+ S    +F+  +RS+++ ID 
Sbjct: 365 QEITSEKAAAIAMQPGAPGAPPEPVPGGVASTGQSQDTDPSFN--AFVTTSRSKLDEIDG 422

Query: 391 LLAE 394
           LLA+
Sbjct: 423 LLAQ 426


>gi|218680024|ref|ZP_03527921.1| chemotaxis protein [Rhizobium etli CIAT 894]
          Length = 357

 Score =  390 bits (1001), Expect = e-106,   Method: Composition-based stats.
 Identities = 92/345 (26%), Positives = 167/345 (48%), Gaps = 2/345 (0%)

Query: 3   QKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVK 62
            +Y+    +    +  +    QD    + PY+ +RSLQ   D  + GD S  +    ++ 
Sbjct: 12  HRYVGFVALGLAMLSPATGKAQD-PDDLAPYKMLRSLQFVQDSVVGGDHSAGEMQRFMLG 70

Query: 63  ETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYF 122
               +LR     VF D+RN+DA  IY +   +   ++ LIA D  GYFD  +   L+KY 
Sbjct: 71  TIDQRLRTVETSVFEDDRNVDAALIYAMSGGNPQTLEYLIAHDVNGYFDNRVTDVLRKYL 130

Query: 123 SGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLE 182
           SG+    +K L ++  +   + I PYL L+ G  ++      A+  +D  RL +PGT +E
Sbjct: 131 SGKGLLVAKTLEEMAREYRDKKIGPYLALIGGNVLIATKPTDALDLYDQARLAAPGTIVE 190

Query: 183 EIALRNLLEITQNE-VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDI 241
           E ALR  + I  ++ + ++   Y + YV +F HS Y   F  + +   +     +  +D+
Sbjct: 191 EAALRRSVAICVDKGLLDKGMAYSQRYVRRFLHSPYASQFADLFVALVVGHDHDVKPQDV 250

Query: 242 VFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENI 301
           V  +SF     QR +YL+IA+ + ISGK  +  +A+++++ +    D         Y  +
Sbjct: 251 VDILSFMDAPRQREVYLRIARAAAISGKPDLAHMAVERVQSLGAGTDNAFGPLADFYGGM 310

Query: 302 LNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSL 346
             +P  DI    ++   I   +L  +D+ L+ A++ +  +I ++ 
Sbjct: 311 AGLPTEDIDRAAKNVSGIAGNALSPRDQALQAAAQSVAEQILRAP 355


>gi|82940570|emb|CAJ44301.1| putative Chemotaxis precursor (Motility protein C MotC) [Rhizobium
           leguminosarum bv. viciae]
          Length = 334

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 87/322 (27%), Positives = 154/322 (47%), Gaps = 1/322 (0%)

Query: 11  MVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRA 70
            + + +    A +      + PY+ +RSLQ   D  + GD S  +    ++     +LR 
Sbjct: 13  ALGLAMLSPAAGNAQDPDDLAPYKMLRSLQFVQDSVVSGDHSAGEMQRFMLGTIDERLRT 72

Query: 71  THMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESS 130
                F D+RN+DA  IY +   +   ++ LIA D  GYFD  +   L+KY SG+    +
Sbjct: 73  VDPSTFDDDRNVDAALIYAMSGGNPQTLEYLIAHDVNGYFDNRVTDVLRKYLSGKGLLVA 132

Query: 131 KELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLL 190
           K L +   +   + I PYL L+ G  ++      A+  +D  RL +PGT +EE ALR  +
Sbjct: 133 KTLEETAREYRDKKIGPYLALIGGNVLIATKPTDALDLYDQARLAAPGTIVEEAALRRSV 192

Query: 191 EITQNE-VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFS 249
            I  ++ + ++   Y + YV +F HS Y   F  + +   +     +  +D++  +SF  
Sbjct: 193 AICVDKGMLDKGMAYSQRYVRRFLHSPYASQFADLFVTLVVGHDHDVKPQDVIDILSFMD 252

Query: 250 LEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDI 309
              QR +YL+IA+ + ISGK ++  +A+ +++ +    D        LY  +  +P  DI
Sbjct: 253 APRQREVYLRIARAAAISGKPELARMAVGRVQSLGAATDNAFGPLADLYGGMAGLPTEDI 312

Query: 310 MSLQRSTCNIPYYSLMEQDRYL 331
               ++   I   +L  +D+ L
Sbjct: 313 DRAAKNVSGIDGNTLSPRDQAL 334


>gi|319406990|emb|CBI80627.1| putative flagellar motor protein [Bartonella sp. 1-1C]
          Length = 448

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 85/405 (20%), Positives = 164/405 (40%), Gaps = 23/405 (5%)

Query: 9   TMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQL 68
             +  ++      +         P   VRSLQ   D+ + G     +K   ++ E G + 
Sbjct: 40  VFVAQVEHEIKEPSMLSKTVVSEPVHLVRSLQNLQDKIISGQEEELQKQLQLLGEIGDKF 99

Query: 69  RATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEE 128
                 V+ D  N+ A+ IY     +  VV  ++ K  KG     ++     Y S +   
Sbjct: 100 LTFDASVWKDKNNLYALLIYLFNGGNPRVVQSILEKYGKGVISENVMDGALAYASHKKTT 159

Query: 129 SSKELSKIKDKDNTRGIVPYLHLLIGRAMMPF----SSQQAVHFFDYVRLTSPGTFLEEI 184
             K  +++ ++D  R I P L   +  + +          A+   D VRL +PGT  EE 
Sbjct: 160 FLKTYTQLTEED-IRSIPPALFASVVLSTVVNIIEKDPALALKQLDQVRLFAPGTLFEEG 218

Query: 185 ALRNLLEITQ--NEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIV 242
           A+R  L++     E+   A   IR YV +F  S Y   F    +   L    KL  + + 
Sbjct: 219 AIRRELKVASMLGEIDLLAL-LIRHYVHRFWKSPYAYDFWHEFIPAVLRLDEKLSIDQLE 277

Query: 243 FTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENIL 302
             +++   + Q   Y+ +++ ++I  + +   L+ ++   +   +   D + ++LY  + 
Sbjct: 278 ALLAYAPTKVQFMAYMAVSRAALIDARMEKAKLSAQKALTLAHEIGVDDTS-VRLYYAMS 336

Query: 303 NIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDI-----------DF 351
               +      +   NI Y  L E+DR+L  A++ +   +    +D+             
Sbjct: 337 LAGSIAAQEALQMIQNIIYKDLSEKDRFLFIAAQAVAQRVISFPLDVLKKKNTQIVSQPQ 396

Query: 352 EHIQKDLLLDKKEPRHTNVSM---GIESFIKKNRSQIESIDVLLA 393
            H +  L L+K + ++   S+    ++ FI+  + +I  ID LL 
Sbjct: 397 SHEELKLTLEKDDKQNNTTSLIEAEMKQFIQHTQEKINEIDQLLG 441


>gi|319403974|emb|CBI77562.1| putative flagellar motor protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 446

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 85/405 (20%), Positives = 163/405 (40%), Gaps = 23/405 (5%)

Query: 9   TMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQL 68
             +  ++      +         P   VRSLQ   D+ + G     +K   ++ E G + 
Sbjct: 38  IFVAQVEREIKEPSMLSKTIVSEPVHLVRSLQNLQDKIISGQEEELQKQLQLLGEIGDKF 97

Query: 69  RATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEE 128
                 V+ D  N+ A+ IY     +  VV  ++ K  KG     ++     Y S +   
Sbjct: 98  LTFDASVWKDKNNLYALLIYLFNGGNPRVVQSILEKYGKGVISENVMDGALAYASHKKTT 157

Query: 129 SSKELSKIKDKDNTRGIVPYLHLLIGRAMMPF----SSQQAVHFFDYVRLTSPGTFLEEI 184
             K  +++ ++D  R I P L   +  + +          A+   D VRL +PGT  EE 
Sbjct: 158 FLKTYTQLTEED-IRSIPPALFASVVLSTVVNIIEKDPALALKQLDQVRLFAPGTLFEEG 216

Query: 185 ALRNLLEITQ--NEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIV 242
           A+R  L++     E+   A   IR YV +F  S Y   F    +   L    KL  + + 
Sbjct: 217 AIRRELKVASMLGEIDLLAL-LIRHYVHRFWKSPYAYDFWHEFIPAVLRLDEKLSIDQLE 275

Query: 243 FTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENIL 302
             +++   + Q   Y+ +++ ++I  + +   L+ ++   +   +   D + ++LY  + 
Sbjct: 276 ALLAYAPTKVQFMAYMAVSRAALIDARMEKAKLSAQKALTLAHEIGVDDTS-VRLYYAMS 334

Query: 303 NIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDI-----------DF 351
               +      +   NI Y  L E+DR+L  A++ +   +    +D+             
Sbjct: 335 LSGSIAAQEALQMIQNIIYKDLSEKDRFLFIAAQAVAQRVVSFPLDVLKEKNTQIASQPQ 394

Query: 352 EHIQKDLLLDKKEPRHTNVSM---GIESFIKKNRSQIESIDVLLA 393
            H +  L L+K + +    S+    ++ FI+  + +I  ID LL 
Sbjct: 395 SHKELKLTLEKDDKQKNTASLIEAEMKQFIQHTQEKINEIDQLLG 439


>gi|27763657|gb|AAO20255.1| MotC [Agrobacterium sp. H13-3]
          Length = 425

 Score =  375 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 97/396 (24%), Positives = 176/396 (44%), Gaps = 24/396 (6%)

Query: 20  FATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDN 79
           FA  QD    ++PY  +RSLQ   D    GD S  +    +++    +L++    +F D 
Sbjct: 28  FAQSQD---NLMPYAMLRSLQFVQDSVTMGDHSATEMQRFLLQTIDERLKSAPSAIFKDP 84

Query: 80  RNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDK 139
           RN+DA  +Y +   + + ++ L+A+D  G FD  +   L+KY SG+    ++ ++ +  +
Sbjct: 85  RNVDAALVYAMSGGNPATLELLVARDVDGNFDSRVADILRKYLSGKGTLVAQSIAAMVPE 144

Query: 140 DNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEIT-QNEVG 198
                I  YL L+ G   +P     A+ F+D  RL +PGT +EE ALR  L I  ++   
Sbjct: 145 YRGTRIGAYLALIGGNVTIPRDPVAALGFYDIARLEAPGTIVEEAALRRSLAIAVEDGDA 204

Query: 199 ERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYL 258
            R   Y + Y  +F HS Y   F  +L+   +     +  + I  T +    E Q+  YL
Sbjct: 205 GRGVEYAQRYARRFLHSPYASQFADLLVSLVVKRVDSIGHDTIEETFAMMDAERQKEAYL 264

Query: 259 KIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCN 318
           ++++ + ISGK  +  +A  + K +   +  +      LYE++ NI   D++S   +   
Sbjct: 265 RLSRLAAISGKDSLARMAALKAKALSPDMPDQPQVQANLYESLSNIGTPDVVSAIETIGQ 324

Query: 319 IPYYSLMEQDRYLKKASEIIMSEIGKSLI--------------DIDFEHIQKDLLLDKK- 363
           IP   L ++DR L+ A+  I  ++ +                         +    + K 
Sbjct: 325 IPEAQLSDRDRALRDAARAIADQVVRPPSPQPGADPGVTAGQGAGSGAPANEAASAETKG 384

Query: 364 -----EPRHTNVSMGIESFIKKNRSQIESIDVLLAE 394
                  +  +    +   +   RS+++ ID LL +
Sbjct: 385 IWRVENHKAEDEGENVRQLVTSGRSKLDEIDSLLKK 420


>gi|222084881|ref|YP_002543410.1| chemotaxis motility protein [Agrobacterium radiobacter K84]
 gi|221722329|gb|ACM25485.1| chemotaxis motility protein [Agrobacterium radiobacter K84]
          Length = 433

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 99/403 (24%), Positives = 185/403 (45%), Gaps = 35/403 (8%)

Query: 25  DLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDA 84
           +    + PY+ +RSL+   D  + GD S  +    ++     +LR     VF D+RN+DA
Sbjct: 27  ESQDGLPPYKILRSLEFIQDSVVAGDSSAGEMQRFMLSTIDERLRNADKSVFDDSRNVDA 86

Query: 85  VWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRG 144
             IY +   +   ++ L+++D  G FD  +   L+KY +G+       L+ I  +   + 
Sbjct: 87  ALIYAMSGGNPDTLEYLMSRDVNGNFDNRVADVLRKYLNGKGLLVVNTLADIAREYRDKK 146

Query: 145 IVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFG 203
           I PYL L+    M   + ++A+  +D+ RL SPGT +EE ALR  L ++ +  +  +  G
Sbjct: 147 IGPYLSLVAANVMSAKNPKEALKLYDWARLASPGTIVEESALRRSLALSADAGMVPQGLG 206

Query: 204 YIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQN 263
           Y   Y  +F HS Y   F  + ++  +     +  +DI+  +SF     QR +YL++A+ 
Sbjct: 207 YAARYTRRFLHSPYASQFADLFVQLVVDHDADVKQQDIIDILSFMDPPRQREVYLRMARR 266

Query: 264 SVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYS 323
           + I+GK  +  LA  + + I +       A    Y  +  +   ++ +  R    +P   
Sbjct: 267 AAIAGKADLAALASGRAQAITNDGSDAFSALAGFYGGVAGVSTPNMGTAIRKIDQMPAGE 326

Query: 324 LMEQDRYLKKASEIIMSEIGK-----------SLIDIDFEHIQKDLLLDKKEPRHTNVSM 372
           L +QDR L++A+ ++  EI +            L  ++ EH + D  +  +    +  + 
Sbjct: 327 LNQQDRALREAARLVADEILRAPDPTSLKQGSPLNLLNQEHTEHDAAVTNQSGAQSPGTA 386

Query: 373 GIE-----------------------SFIKKNRSQIESIDVLL 392
           G+E                       +F+  +RS++++ID LL
Sbjct: 387 GVEAGAAVNAAHTPEEGRQEADPSFNAFVTTSRSKLDAIDGLL 429


>gi|325291957|ref|YP_004277821.1| Chemotaxis protein motC [Agrobacterium sp. H13-3]
 gi|325059810|gb|ADY63501.1| Chemotaxis protein motC [Agrobacterium sp. H13-3]
          Length = 423

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 97/396 (24%), Positives = 176/396 (44%), Gaps = 24/396 (6%)

Query: 20  FATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDN 79
           FA  QD    ++PY  +RSLQ   D    GD S  +    +++    +L++    +F D 
Sbjct: 26  FAQSQD---NLMPYAMLRSLQFVQDSVTMGDHSATEMQRFLLQTIDERLKSAPSAIFKDP 82

Query: 80  RNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDK 139
           RN+DA  +Y +   + + ++ L+A+D  G FD  +   L+KY SG+    ++ ++ +  +
Sbjct: 83  RNVDAALVYAMSGGNPATLELLVARDVDGNFDSRVADILRKYLSGKGTLVAQSIAAMVPE 142

Query: 140 DNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEIT-QNEVG 198
                I  YL L+ G   +P     A+ F+D  RL +PGT +EE ALR  L I  ++   
Sbjct: 143 YRGTRIGAYLALIGGNVTIPRDPVAALGFYDIARLEAPGTIVEEAALRRSLAIAVEDGDA 202

Query: 199 ERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYL 258
            R   Y + Y  +F HS Y   F  +L+   +     +  + I  T +    E Q+  YL
Sbjct: 203 GRGVEYAQRYARRFLHSPYASQFADLLVSLVVKRVDSIGHDTIEETFAMMDAERQKEAYL 262

Query: 259 KIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCN 318
           ++++ + ISGK  +  +A  + K +   +  +      LYE++ NI   D++S   +   
Sbjct: 263 RLSRLAAISGKDSLARMAALKAKALSPDMPDQPQVQANLYESLSNIGTPDVVSAIETIGQ 322

Query: 319 IPYYSLMEQDRYLKKASEIIMSEIGKSLI--------------DIDFEHIQKDLLLDKK- 363
           IP   L ++DR L+ A+  I  ++ +                         +    + K 
Sbjct: 323 IPEAQLSDRDRALRDAARAIADQVVRPPSPQPGADPGVTAGQGAGSGAPANEAASAETKG 382

Query: 364 -----EPRHTNVSMGIESFIKKNRSQIESIDVLLAE 394
                  +  +    +   +   RS+++ ID LL +
Sbjct: 383 IWRVENHKAEDEGENVRQLVTSGRSKLDEIDSLLKK 418


>gi|15887915|ref|NP_353596.1| chemotaxis protein [Agrobacterium tumefaciens str. C58]
 gi|15155509|gb|AAK86381.1| Chemotaxis protein [Agrobacterium tumefaciens str. C58]
          Length = 426

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 97/398 (24%), Positives = 176/398 (44%), Gaps = 25/398 (6%)

Query: 19  SFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVD 78
           +F+  QD    ++PY  +RSLQ   D    GD S  +    +++    +L++    +F D
Sbjct: 27  AFSQSQD---NLMPYAMLRSLQFVQDSVAMGDHSASEMQRFLLQTIDERLKSAPSAIFKD 83

Query: 79  NRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKD 138
            RN+DA  IY +   + + ++ L+A+D  G FD  +   L+KY SG+    ++ ++ +  
Sbjct: 84  PRNVDAALIYAMSGGNPATLELLVARDVDGNFDSRVADILRKYLSGKGTLVAQSIAAMVP 143

Query: 139 KDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEIT-QNEV 197
           +     I  YL L+ G   +P     A+ F+D  RL +PGT +EE ALR  L I  ++  
Sbjct: 144 EYRGTRIGAYLALIGGNVTIPRDPLAALTFYDIARLEAPGTIVEEAALRRSLAIAVEDGD 203

Query: 198 GERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIY 257
             +   Y + Y  +F HS Y   F  +L+   +     + +E I  T +    E Q+  Y
Sbjct: 204 ATKGVDYAQRYARRFLHSPYASQFADLLVSLVVKRADSIGEEAIQETFAMMDAERQKEAY 263

Query: 258 LKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTC 317
           L++++ + ISGK  +  +A  + K +   L         LYE++ NI   D++S   +  
Sbjct: 264 LRLSRLAAISGKDSLARMAAVKAKTLSPALPGTPEVQANLYESLSNIGTPDVVSAIEAIG 323

Query: 318 NIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKK-------------- 363
            IP   L ++DR L+ A+  I  ++ +          +     +                
Sbjct: 324 QIPEAQLSDRDRALRDAARAIADQVVRPPSAETGVEAKAAATNEPGGTAPAKEAAVAADT 383

Query: 364 -------EPRHTNVSMGIESFIKKNRSQIESIDVLLAE 394
                    +  +    +   +   RS+++ ID LL +
Sbjct: 384 KSIWRVETQKADDAGENVRQLVTSGRSKLDEIDSLLKK 421


>gi|319405417|emb|CBI79036.1| putative flagellar motor protein [Bartonella sp. AR 15-3]
          Length = 434

 Score =  367 bits (941), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 86/383 (22%), Positives = 155/383 (40%), Gaps = 23/383 (6%)

Query: 31  VPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTI 90
            P   VRSLQ   D+ + G     +K   +++E G +       ++ D  N+ A+ IY  
Sbjct: 48  EPVHLVRSLQNLQDKIISGQEKELQKQLQLLEEIGDKFLTFDSSIWKDKNNLYALLIYLF 107

Query: 91  ISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLH 150
              +  VV  ++ K  KG     I+     Y S +     K  +++  KD  + I P L 
Sbjct: 108 NGGNPRVVQSILEKYGKGVIPQNIIDDALAYVSHKKNAFLKAYTQLTVKDV-QSIPPALF 166

Query: 151 LLIGRAMMPF----SSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQ--NEVGERAFGY 204
             I  + +          A++  D VRL +PGT  EE A+R  L++     E+   A   
Sbjct: 167 ASIVLSTVVNIIEKDPVLALNTLDQVRLFAPGTLFEEGAIRRELKVASILGEIDLMAL-L 225

Query: 205 IRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNS 264
           IR YV +F  S Y   F    +   L    KL  E +   + +   + +   Y+ +++ +
Sbjct: 226 IRHYVHRFWKSPYACDFWYEFIPAILRVDEKLSIEQLETLLVYAPTKVRFMTYMAVSRAA 285

Query: 265 VISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSL 324
           +I  + +   ++ ++   +   +   D +   LY  +     +      +   NI Y  L
Sbjct: 286 LIDARMEKAQISAQKALTLAREIGVDDTS-AHLYYAMSLAGSIAAEEALQMIQNIVYKDL 344

Query: 325 MEQDRYLKKASEIIMSEIGKSLIDI-----------DFEHIQKDLLLDKKEPRHTNVS-- 371
            E+DR+L  A++ +   +    + I              + +  L L+K   +   +S  
Sbjct: 345 SEKDRFLFIAAQAVAQRVVSFPLGILEKKKEKLALQPQSYEELKLTLEKDAKQQNTISPI 404

Query: 372 -MGIESFIKKNRSQIESIDVLLA 393
              I+ FI+  R +I  ID LL 
Sbjct: 405 ETEIKEFIQHTREKINEIDQLLG 427


>gi|227820871|ref|YP_002824841.1| chemotaxis protein [Sinorhizobium fredii NGR234]
 gi|227339870|gb|ACP24088.1| chemotaxis protein motility protein C [Sinorhizobium fredii NGR234]
          Length = 435

 Score =  363 bits (933), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 97/426 (22%), Positives = 181/426 (42%), Gaps = 38/426 (8%)

Query: 6   LICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETG 65
           ++ T ++A+ +    A   +    + P++ VRSLQ   D  + GD S  +    ++ +  
Sbjct: 8   ILATSVLAVPLAIGLARASE-TEELAPFKMVRSLQYVQDSVVLGDHSAIEMQRFMLNKID 66

Query: 66  VQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQ 125
            +LRA    +F D RN+DA  +Y +   +   +D L  +D +G FD  +  AL++Y  G+
Sbjct: 67  KRLRAADEAIFRDPRNVDAALVYVMSGGNPETLDYLTDRDVEGNFDARVAEALRQYLRGK 126

Query: 126 LEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIA 185
                + L+K   +     + PYL L++G A        A+ ++D+ RLT+PGT +EE A
Sbjct: 127 GPLIVENLAKAAPEYKNSRVGPYLFLILGNATSQQDPVAAMKYYDWARLTAPGTIIEEAA 186

Query: 186 LRNLLEIT-QNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFT 244
           LR  + +  Q    E+ F Y   Y  ++  S Y   F  V +   +    +  ++ +   
Sbjct: 187 LRRSVSLAVQAGDPEKGFRYALNYARRYLTSPYASQFADVFVELAVTHFDETVEKRVAEI 246

Query: 245 ISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNI 304
           ++F     QR +YL++A+ + I G + +  LA  + + +      +       Y+ +  +
Sbjct: 247 LAFMDQSRQREVYLRVARRAAIGGNQTLARLASSRAEELALDGGGQSQLLASFYDGLAAV 306

Query: 305 PFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHI---------- 354
           P  D+ +  ++   IP   L  +DR L++A+  I  E+ +   D                
Sbjct: 307 PSEDVFTAAQTLAAIPDGKLSRRDRALREAARAIAEEVVRLPRDESSAQASMPIPEANTG 366

Query: 355 ------------------------QKDLLLDKKEPRHTNVSMGI--ESFIKKNRSQIESI 388
                                         ++     T  +     + F+   RS+I+ I
Sbjct: 367 PAKDGGETGETGSGMSPFAVASDRPPAPGGERPASAETAAASDPALDGFVANGRSKIKEI 426

Query: 389 DVLLAE 394
           D LLAE
Sbjct: 427 DALLAE 432


>gi|222147585|ref|YP_002548542.1| chemotaxis protein [Agrobacterium vitis S4]
 gi|221734573|gb|ACM35536.1| Chemotaxis protein [Agrobacterium vitis S4]
          Length = 483

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 94/326 (28%), Positives = 150/326 (46%), Gaps = 3/326 (0%)

Query: 18  FSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFV 77
            S A   D    + PY  +RSLQ   D  +RGD S       ++     +LR      F 
Sbjct: 63  GSAAVGGD-SDNLPPYLMLRSLQFVQDSVVRGDHSAADMQRFLLTRIDKRLRTAAPSDFE 121

Query: 78  DNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIK 137
           D RN+DA  IYT+   + + +D L+A+D  G+FD  +   L+KY SG+    +  L ++ 
Sbjct: 122 DPRNVDAALIYTMSGGNPATLDYLVARDVDGHFDNRVSDMLRKYLSGKGVLVASSLGEMV 181

Query: 138 DKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-E 196
                  + PY+ L+ G   +      A+ FFD  RL +PGT +EE ALR   +I  +  
Sbjct: 182 PLYQNGRVGPYIALVAGNVTLVKDPAGALKFFDIARLVAPGTIVEEAALRRSFQIAMDTG 241

Query: 197 VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAI 256
              RA  Y   Y  +F +S Y   F  +L++  +    +L   DI+ T++    + QR +
Sbjct: 242 QNGRAMAYANRYARRFLYSPYASQFADLLVQLVVDHFSELDKNDILATLATMDPDRQREV 301

Query: 257 YLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRST 316
           YL+IA+ + I+G + +  LA  Q + +    D  D     LY     I   D+ +   + 
Sbjct: 302 YLRIARRATINGNQALASLASSQAQSLAGLPDKNDP-QALLYGGAALISTTDVKNALNTI 360

Query: 317 CNIPYYSLMEQDRYLKKASEIIMSEI 342
             +P   L   D  L +A+  +  EI
Sbjct: 361 SQLPKDQLSASDNALLEAARAVAQEI 386


>gi|2275157|gb|AAB81409.1| MotC [Sinorhizobium meliloti]
          Length = 434

 Score =  357 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 96/402 (23%), Positives = 173/402 (43%), Gaps = 36/402 (8%)

Query: 27  VRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
              + PY+ +RSLQ   D  + GD S  +    ++     +LRA     F D RN+DA  
Sbjct: 28  TEELTPYKMIRSLQYVQDSVVLGDHSAIEMQRFMLGAIDERLRAADPSAFRDPRNVDAAL 87

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIV 146
           +Y +   + + +D L  +D +G FD  +  AL++Y +G+     + L+K   +     I 
Sbjct: 88  VYVMSGGNPATLDLLADRDIEGNFDSRVTDALRQYLNGKGPLIVENLTKAAPEYKNSRIG 147

Query: 147 PYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYI 205
           PYL L++G AM      +A+  +D+ RLT+PGT +EE ALR  + +     + E+ F Y 
Sbjct: 148 PYLFLILGNAMSQQDPIEAMKHYDWARLTAPGTIIEEAALRRSVSLAAGAGLPEKGFRYA 207

Query: 206 RAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSV 265
             Y  ++  S Y   F  V +   +    +  D  +   +SF     QR +YL++A+ + 
Sbjct: 208 LNYARRYLTSPYASQFADVFVELAVAHFDEAADGRVSEILSFMDSARQREVYLRVARRAA 267

Query: 266 ISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLM 325
           I+G + +  LA ++ + +      +       YE +  +P  D+ S   +   IP   L 
Sbjct: 268 IAGNQALARLASRRAEELAGDDSSRSQVLASFYEGLAAVPSADVFSAAEALEAIPDEKLS 327

Query: 326 EQDRYLKKASEIIMSEIGKSLIDIDFEHI-----------QKDLLLDKKEPRHTNVSMGI 374
            +DR L++A++ +   + +                     Q +L  ++     +     +
Sbjct: 328 PRDRALREAAKAVADAVVRPPFGESPAQAPAPIAERPAGEQSELAAEESGSGMSPFGQPV 387

Query: 375 ES------------------------FIKKNRSQIESIDVLL 392
           E+                        F+   RS+I+ ID LL
Sbjct: 388 EASPGRPSEMTAEADAAASDDPALDGFLASGRSKIDEIDALL 429


>gi|307318925|ref|ZP_07598356.1| chemotaxis protein [Sinorhizobium meliloti AK83]
 gi|306895339|gb|EFN26094.1| chemotaxis protein [Sinorhizobium meliloti AK83]
          Length = 434

 Score =  355 bits (910), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 93/403 (23%), Positives = 173/403 (42%), Gaps = 38/403 (9%)

Query: 27  VRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
              + PY+ +RSLQ   D  + GD S  +    ++     +LRA     F D RN+DA  
Sbjct: 28  TEELTPYKMIRSLQYVQDSVVLGDHSAIEMQRFMLGAIDERLRAADPSAFRDPRNVDAAL 87

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIV 146
           +Y +   + + +D L  +D +G FD  +  AL++Y +G+     + L+K   +     I 
Sbjct: 88  VYVMSGGNPATLDLLADRDIEGNFDSRVTDALRQYLNGKGPLIVENLTKAAPEYKNSRIG 147

Query: 147 PYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQ-NEVGERAFGYI 205
           PYL L++G AM      +A+  +D+ RLT+PGT +EE ALR  + +     + E+ F Y 
Sbjct: 148 PYLFLILGNAMSQQDPIEAMKHYDWARLTAPGTIIEEAALRRSVSLAAQAGLPEKGFRYA 207

Query: 206 RAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSV 265
             Y  ++  S Y   F  V +   +    +  D  +   +SF     QR +YL++A+ + 
Sbjct: 208 LNYARRYLTSPYASQFADVFVELAVAHFDEAADGRVSEILSFMDSARQREVYLRVARRAA 267

Query: 266 ISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLM 325
           I+G + +  LA ++ + +      +       YE +  +P  D+ S   +   IP   L 
Sbjct: 268 IAGNQALARLASRRAEELAGDDSSRSQVLASFYEGLAAVPSADVFSAAEALEAIPDEKLS 327

Query: 326 EQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMG------------ 373
            +DR L++A++ +   + +  +           + ++     + ++              
Sbjct: 328 PRDRALREAAKAVADAVVRPPLGESPAQAP-APIAERPAGEQSELAAEESGSGMSPFGQP 386

Query: 374 ------------------------IESFIKKNRSQIESIDVLL 392
                                   ++ F+   RS+I+ ID LL
Sbjct: 387 VEASPGRPSEMTAEADVAASDDPALDGFLASGRSKIDEIDALL 429


>gi|319409173|emb|CBI82817.1| putative flagellar motor protein [Bartonella schoenbuchensis R1]
          Length = 463

 Score =  353 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 93/421 (22%), Positives = 170/421 (40%), Gaps = 39/421 (9%)

Query: 10  MMVAMDVFFSFATDQDLVRTIV---PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGV 66
           M V     FS +    +    V   P Q VRSLQ   D+ + G   + +K P +++E G 
Sbjct: 44  MFVVQAAPFSKSEKSSVGSEAVLSHPMQLVRSLQNLQDQIVSGQEEVLQKQPQLLREIGE 103

Query: 67  QLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQL 126
           +  + +  ++ D +N+ A+ IY     + SVV  ++    +G     I+  +  Y S + 
Sbjct: 104 KFLSFNPSIWKDKQNLYALLIYLFNGGNPSVVRVILKSYGQGVIAENIMTGVLAYLSHKQ 163

Query: 127 EESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPF----SSQQAVHFFDYVRLTSPGTFLE 182
           E   K  + + D+D  + I P L   I  + +          A+   D VRL SPGT  E
Sbjct: 164 EVFFKTFANLTDED-IQSIPPALFFSIVLSTVGNTIMKDPVLAMKQLDQVRLLSPGTLFE 222

Query: 183 EIALRNLLEITQN-EVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDI 241
           E A+R  +++       +     +R Y ++F  S Y   F             KL D+ +
Sbjct: 223 ESAIRREIKVATILGQTDLLTLLVRNYASRFGKSPYAKDFWREFGIAIPRIDEKLDDQQL 282

Query: 242 VFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENI 301
              IS+     Q   Y+ +++ ++I+ + +   L+ ++   +   L+  D    +LY   
Sbjct: 283 EALISYAPPMVQLMAYMDVSRTALINARMERAQLSAQKALTLAHELNVNDAP-ARLYYAA 341

Query: 302 LNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDI-------DFEHI 354
                V     ++   NI    L E+DR L  A++ +  ++  SL+D        D    
Sbjct: 342 SLASSVTAHEAEQLLQNISSKDLSEKDRLLFIAAQAVAQKVTSSLVDGQKEVKTQDSTQP 401

Query: 355 QKDLLLD----------------------KKEPRHTNVSMGIESFIKKNRSQIESIDVLL 392
           Q    LD                      +++   ++ S  I   I++ + +I+ +D LL
Sbjct: 402 QSQKELDTMSKETVSKEVEVVSKEAKEAVEQQNAPSSTSTEINQLIEQAQEKIDEVDKLL 461

Query: 393 A 393
            
Sbjct: 462 G 462


>gi|307311570|ref|ZP_07591211.1| chemotaxis protein [Sinorhizobium meliloti BL225C]
 gi|306899587|gb|EFN30216.1| chemotaxis protein [Sinorhizobium meliloti BL225C]
          Length = 434

 Score =  352 bits (904), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 93/403 (23%), Positives = 173/403 (42%), Gaps = 38/403 (9%)

Query: 27  VRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
              + PY+ +RSLQ   D  + GD S  +    ++     +LRA     F D RN+DA  
Sbjct: 28  TEELTPYKMIRSLQYVQDSVVLGDHSAIEMQRFMLGAIDERLRAADHSAFRDPRNVDAAL 87

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIV 146
           +Y +   + + +D L  +D +G FD  +  AL++Y +G+     + L+K   +     I 
Sbjct: 88  VYVMSGGNPATLDLLADRDIEGNFDSRVTDALRQYLNGKGPLIVENLTKAAPEYKNSRIG 147

Query: 147 PYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQ-NEVGERAFGYI 205
           PYL L++G AM      +A+  +D+ RLT+PGT +EE ALR  + +     + E+ F Y 
Sbjct: 148 PYLFLILGNAMSQQDPIEAMKHYDWARLTAPGTIIEEAALRRSVSLAAQAGLPEKGFRYA 207

Query: 206 RAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSV 265
             Y  ++  S Y   F  V +   +    +  D  +   +SF     QR +YL++A+ + 
Sbjct: 208 LNYARRYLTSPYASQFADVFVELAVAHFDEAADGRVSEILSFMDSARQREVYLRVARRAA 267

Query: 266 ISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLM 325
           I+G + +  LA ++ + +      +       YE +  +P  D+ S   +   IP   L 
Sbjct: 268 IAGNQALARLASRRAEELAGDDSSRSQVLASFYEGLAAVPSADVFSAAEALEAIPDEKLS 327

Query: 326 EQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMG------------ 373
            +DR L++A++ +   + +  +           + ++     + ++              
Sbjct: 328 PRDRALREAAKAVADAVVRPPLGESPAQAP-APIAERPAGEQSELAAEESGSGMSPFGQP 386

Query: 374 ------------------------IESFIKKNRSQIESIDVLL 392
                                   ++ F+   RS+I+ ID LL
Sbjct: 387 VEASPGRPSEMTAEADVAASDDPALDGFLASGRSKIDEIDALL 429


>gi|319898652|ref|YP_004158745.1| flagellar motor protein [Bartonella clarridgeiae 73]
 gi|319402616|emb|CBI76161.1| putative flagellar motor protein [Bartonella clarridgeiae 73]
          Length = 428

 Score =  352 bits (903), Expect = 6e-95,   Method: Composition-based stats.
 Identities = 89/407 (21%), Positives = 166/407 (40%), Gaps = 25/407 (6%)

Query: 9   TMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQL 68
             +  +D      +    V    P Q VRSLQ   D+ + G   + ++   +++E G + 
Sbjct: 18  VFVTQLDHKIKEPSMLSEVVISEPIQFVRSLQNLQDKIISGQEEVLQEQLQLLEEIGDKF 77

Query: 69  RATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEE 128
                DV+ D+ N+ A+ IY     +  VV  ++ K  KG     I+     Y S +   
Sbjct: 78  LTFDSDVWKDDNNLYALLIYLFNGGNPRVVQIILEKYGKGVISQNIMDCALAYASHKRAA 137

Query: 129 SSKELSKIKDKDNTRGIVPYLHLLIGRAMMPF----SSQQAVHFFDYVRLTSPGTFLEEI 184
             K  +++ ++D  R I P L   +  + +          A+   D +RL +PGT  EE 
Sbjct: 138 FVKAYTQLTEEDV-RSIPPALFASVVLSTVVNIIEKDPILALKQLDQIRLFAPGTLFEEG 196

Query: 185 ALRNLLEITQNEVGERAF--GYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIV 242
           A+R  L++    +GE       +R Y  +F  S Y   F        L    KL  E + 
Sbjct: 197 AIRRELKVAS-ILGETDLLALLVRHYAHRFWKSPYAHDFWHEFTPAILQIDEKLSVEQLE 255

Query: 243 FTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENIL 302
             +S+   + Q   Y+++++ ++I  + +   L+ ++   +   +D  D +  +LY  + 
Sbjct: 256 TLVSYAPTKVQFITYMEVSRAALIDARMEKAQLSAQKALTLAHEIDVDDTS-ARLYYAMS 314

Query: 303 NIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFE---------- 352
               +      +   NI Y  L ++DR+L  A++ +   +  S +    E          
Sbjct: 315 LAGSITAQESIQMLQNITYKDLSKKDRFLFTAAQAVAKRVISSPLGDQKEKKAQVTLQPQ 374

Query: 353 ---HIQKDLLLDKKEPRHTNVS---MGIESFIKKNRSQIESIDVLLA 393
               ++  L L+K   +   +S     +  FI+  R +I  ID LL 
Sbjct: 375 SQGELKLILELEKDAKQQNTISPIEAEMNQFIQNTREKINEIDQLLG 421


>gi|150395499|ref|YP_001325966.1| chemotaxis protein [Sinorhizobium medicae WSM419]
 gi|150027014|gb|ABR59131.1| chemotaxis precursor (motility protein C) transmembrane
           [Sinorhizobium medicae WSM419]
          Length = 433

 Score =  351 bits (901), Expect = 9e-95,   Method: Composition-based stats.
 Identities = 101/422 (23%), Positives = 176/422 (41%), Gaps = 36/422 (8%)

Query: 6   LICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETG 65
           +    ++A+ +    A        + P++ +RSLQ   D  + GD S  +    ++    
Sbjct: 8   IFAASVLAVPLALGPARASG-TEELAPFKMIRSLQYVQDSVVLGDHSAIEMQRFMLGAID 66

Query: 66  VQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQ 125
            +LRA     F D RN+DA  +Y +   + + +D L  +D +G FD  +  AL++Y +G+
Sbjct: 67  ERLRAADPSAFRDPRNVDAALVYVMSGGNPATLDLLADRDIEGNFDSRVTDALRQYLNGK 126

Query: 126 LEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIA 185
                + L+K   +     I PYL L++G AM      +A+  +D+ RLT+PGT +EE A
Sbjct: 127 GPLIVENLTKAAPEYKNSRIGPYLFLILGNAMSQQDPIEAMKHYDWARLTAPGTIIEEAA 186

Query: 186 LRNLLEITQ-NEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFT 244
           LR  + +     + E+ F Y   Y  ++  S Y   F  V +   +    +  D  +   
Sbjct: 187 LRRSVSLAAQAGLPEKGFRYALNYARRYLTSPYASQFADVFVELAVAHFDESADGRVSEI 246

Query: 245 ISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNI 304
           +SF     QR +YL++A+ + I+G + +  +A K+ + ++     +       YE +  +
Sbjct: 247 LSFMDSARQREVYLRVARRAAIAGNQALARVASKRAEELVGDDGSRSQMLASFYEGLAAV 306

Query: 305 PFVDIMSLQRSTCNIPYYSLMEQDRYLKK-------------ASEIIMSE---------- 341
           P  D+ S   +   IP   L  +DR L++             A E +             
Sbjct: 307 PSADVFSAAEALAAIPDDKLSPRDRALREAARAVADAVVRPPAIESLAQAPFPIAERRPG 366

Query: 342 -----------IGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIESIDV 390
                       G S      E           E    +    I+ F+   RS+IE ID 
Sbjct: 367 QEDGVAAEEDGSGMSPFGQPVEESPSRPSEMTAEADAASGDPAIDGFLASGRSKIEEIDA 426

Query: 391 LL 392
           LL
Sbjct: 427 LL 428


>gi|15964428|ref|NP_384781.1| chemotaxis protein [Sinorhizobium meliloti 1021]
 gi|17380484|sp|Q52963|MOTC_RHIME RecName: Full=Chemotaxis protein motC; AltName: Full=Motility
           protein C; Flags: Precursor
 gi|15073605|emb|CAC45247.1| Chemotaxis precursor (motility protein C) transmembrane
           [Sinorhizobium meliloti 1021]
          Length = 434

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 92/403 (22%), Positives = 173/403 (42%), Gaps = 38/403 (9%)

Query: 27  VRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
              + PY+ +RSLQ   D  + GD S  +    ++     +LRA     F D RN+DA  
Sbjct: 28  TEELTPYKMIRSLQYVQDSVVLGDHSAIEMQRFMLGAIDERLRAADHSAFRDPRNVDAAL 87

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIV 146
           +Y +   + + +D L  +D +G FD  +  AL++Y +G+     + L+K   +     I 
Sbjct: 88  VYVMSGGNPATLDLLADRDIEGNFDSRVTDALRQYLNGKGPLIVENLTKAAPEYKNSRIG 147

Query: 147 PYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQ-NEVGERAFGYI 205
           PYL L++G AM      +A+  +D+ RLT+PGT +EE ALR  + +     + E+ F Y 
Sbjct: 148 PYLFLILGNAMSQQDPIEAMKHYDWARLTAPGTIIEEAALRRSVSLAAQAGLPEKGFRYA 207

Query: 206 RAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSV 265
             Y  ++  S +   F  V +   +    +  D  +   +SF     QR +YL++A+ + 
Sbjct: 208 LNYARRYLTSPFASQFADVFVELAVAHFDEAADGRVSEILSFMDSARQREVYLRVARRAA 267

Query: 266 ISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLM 325
           I+G + +  LA ++ + +      +       YE +  +P  D+ S   +   IP   L 
Sbjct: 268 IAGNQALARLASRRAEELAGDDSSRSQVLASFYEGLAAVPSADVFSAAEALEAIPDEKLS 327

Query: 326 EQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMG------------ 373
            +DR L++A++ +   + +  +           + ++     + ++              
Sbjct: 328 PRDRALREAAKAVADAVVRPPLGESPAQAP-APIAERPAGEQSELAAEESGSGMSPFGQP 386

Query: 374 ------------------------IESFIKKNRSQIESIDVLL 392
                                   ++ F+   RS+I+ ID LL
Sbjct: 387 VEASPGRPSEMTAEADVAASDDPALDGFLASGRSKIDEIDALL 429


>gi|163758027|ref|ZP_02165115.1| chemotaxis motility protein [Hoeflea phototrophica DFL-43]
 gi|162284316|gb|EDQ34599.1| chemotaxis motility protein [Hoeflea phototrophica DFL-43]
          Length = 566

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 94/360 (26%), Positives = 163/360 (45%), Gaps = 4/360 (1%)

Query: 18  FSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFV 77
           F   +D D    + PY+ +RSLQ   D  + GD S  +    ++     +LRA    VF 
Sbjct: 156 FPMPSDLD---GLEPYKLIRSLQYVQDAVVLGDHSAMEMQRFLLGVIDSRLRAADQSVFD 212

Query: 78  DNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIK 137
           D RN+DA  IY +   +   ++ L  +D  G FD  I   L+ Y +G+  ++   L+++ 
Sbjct: 213 DPRNVDAALIYAMSGGNPETLEILALQDKFGNFDNEITTVLRAYLNGRAAKTQTTLAEVV 272

Query: 138 DKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNE- 196
                  I PYL L+        +   A+  FD+ RLT+PGT +EE ALR  L I   + 
Sbjct: 273 AIYRDSRIGPYLTLIAANVTAALNDPAALELFDWARLTAPGTLVEEAALRRSLFIAAAQN 332

Query: 197 VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAI 256
           + + A  Y + Y  +F +S Y   +  +L+   +    K+ D+ +   ++F     +R +
Sbjct: 333 MVDEALEYAQLYARRFINSPYAGQYADLLVDLVVLNYEKVGDDQLNAILTFMDRPRKREV 392

Query: 257 YLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRST 316
           YL+IA+ +VISG R +   A  + + +    D   LA   LY  +  +P   + ++    
Sbjct: 393 YLRIARKAVISGLRDLAVFASGKAEELASPEDRIPLALADLYAGMAKVPTDGVDAVLEEL 452

Query: 317 CNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIES 376
             +    L  +DR L+ A++I+ +E+ +             +L +   P       GI  
Sbjct: 453 NAVSERQLSPRDRALRTAAQIVAAEVIRKPDPNSLTQAFSPMLNEPNAPEQDADLTGIAE 512


>gi|121602873|ref|YP_989387.1| chemotaxis protein [Bartonella bacilliformis KC583]
 gi|120615050|gb|ABM45651.1| putative flagellar motor protein [Bartonella bacilliformis KC583]
          Length = 456

 Score =  338 bits (868), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 88/383 (22%), Positives = 160/383 (41%), Gaps = 23/383 (6%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           P Q VRSLQ   D+ M G     +K P++++E G +      DV+ D  N+ A+ IY + 
Sbjct: 75  PIQLVRSLQNLQDKIMSGQEGALQKQPELLREIGEKFLTLSPDVWQDEHNLYALLIYLLN 134

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             +  VV  ++    +G     ++     Y S + EE  +  + + D++  + + P L L
Sbjct: 135 GGNPRVVRIILEDHGQGRIAQNLITGALAYTSHRREEFFRAFANLSDQEL-QLLPPALFL 193

Query: 152 LIGRAMMPF----SSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIR 206
            I  + +          A+   + VRL +PGT  EE A+R  L +       E     +R
Sbjct: 194 SIVLSTVTNTSEKDPALALKQLNQVRLLAPGTLFEESAIRRELRVAATLGKAELLMLLVR 253

Query: 207 AYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVI 266
            Y  +F  S Y ++F S         +  L DE     +S+     Q   Y ++++ ++I
Sbjct: 254 NYAHRFEKSPYVNNFWSEFRLAIPRIEKDLSDEQFETLVSYAPTMLQLMTYTEVSRAALI 313

Query: 267 SGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLME 326
             + +   L+ ++   +   L+  D   I+LY        V      +    I    L+E
Sbjct: 314 DARMERVKLSAQKALMLAHELNVSDAP-IRLYYAASLAGSVTAEEAAKMLQTISSNDLLE 372

Query: 327 QDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHT---------------NVS 371
           +DR L  A++ I   +  SL D D + ++   L+  +                    +++
Sbjct: 373 RDRPLLTAAQAIADRVSFSLSD-DSQTVETQALISSQSQETLETQSKRRVGQQSDLPSIA 431

Query: 372 MGIESFIKKNRSQIESIDVLLAE 394
              + FI++ R +I  +D LL E
Sbjct: 432 TETDQFIEQTREKINIVDKLLGE 454


>gi|153011512|ref|YP_001372726.1| chemotaxis protein [Ochrobactrum anthropi ATCC 49188]
 gi|151563400|gb|ABS16897.1| conserved hypothetical MotC chemotaxis protein [Ochrobactrum
           anthropi ATCC 49188]
          Length = 431

 Score =  330 bits (845), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 83/418 (19%), Positives = 157/418 (37%), Gaps = 30/418 (7%)

Query: 7   ICTMMVAMDVFFSFATDQDLVRT-----IVPYQCVRSLQRALDEAMRGDISLQKKIPDIV 61
           +  + +    + +F+  Q L  T     + PY+ VRSL+   D+ + G       +  ++
Sbjct: 13  VAGLSLMGAAYPAFSQMQTLAETRALPVLEPYKLVRSLRMLQDQVVAGKPEAVVMLNKLL 72

Query: 62  KETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKY 121
                 +     DV+ +  N+ A  IY     +   V  ++A          +V     Y
Sbjct: 73  GFVSADMGRASNDVWSNPENVYAAIIYLFNGGNPEAVRKVLADLKTDAVPPELVKGALAY 132

Query: 122 FSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFL 181
            SGQ  E  K  S     D    +   + L+    M  F    A+   D VRL +PGT  
Sbjct: 133 ASGQTIEVVKLFSVPLSPDVPAELKASIVLVTASQMTAFDPATALMRLDQVRLDAPGTLF 192

Query: 182 EEIALRNLLEITQN-EVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDED 240
           EE A+R  + I       ++     R Y+ +F  S Y   F++  +   +    ++ + +
Sbjct: 193 EEAAIRRSMPIAAKLGDADKIRLLSRNYLQRFPRSPYMRDFMAQFVDAAVKLNDRIGNAE 252

Query: 241 IVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYEN 300
           +   I       Q ++YL+IA+ +++ G+ +       + K++ DRL   D     LY  
Sbjct: 253 LAKLIGSADPVMQYSLYLQIARGALVDGQTERARFMSAEAKKLADRLK-ADPTRANLYAA 311

Query: 301 ILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEH------- 353
             ++      S  R    I    L E+DR L KA+E + + + ++   +           
Sbjct: 312 ASDVASDSAGSALRELSQISPDKLQERDRKLLKAAEAVGTVVTRTPDALPPAKPALTERD 371

Query: 354 IQKDLLLDKKEPRH----------------TNVSMGIESFIKKNRSQIESIDVLLAEA 395
           +    + D +E                         ++  ++  R ++  ID LL + 
Sbjct: 372 VPPMAVADSQEHEAVKPEPTPAGVSMKPVKNQPEDDLQKTMEDARRKLAEIDALLGKT 429


>gi|306845423|ref|ZP_07477997.1| chemotaxis protein [Brucella sp. BO1]
 gi|306274166|gb|EFM55982.1| chemotaxis protein [Brucella sp. BO1]
          Length = 430

 Score =  325 bits (833), Expect = 9e-87,   Method: Composition-based stats.
 Identities = 83/390 (21%), Positives = 147/390 (37%), Gaps = 25/390 (6%)

Query: 30  IVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYT 89
           + PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY 
Sbjct: 40  LEPYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYL 99

Query: 90  IISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYL 149
               +   V  ++A          +V     Y SGQ  E  K  S     D    +   +
Sbjct: 100 FNGGNPEAVRKVLANLKSDTVPQELVKGALAYASGQTIEVVKLFSVPLAPDVPAELKASI 159

Query: 150 HLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIRAY 208
            L+    MM F    A+   D VRL +PGT  EE A+R  L I       ++     R Y
Sbjct: 160 VLVTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKLGDADKVRLLSRNY 219

Query: 209 VTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISG 268
           + +F HS Y   F++  +   L    ++ +E++V  I       Q  +YL+IA+ +++ G
Sbjct: 220 LQRFRHSPYMRDFMAQFVDTTLKLSDRIGNEELVKLIGSADPLLQYTLYLQIARGALVDG 279

Query: 269 KRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQD 328
           + +       + +++   L   D     LY    ++      S  R    I    L E D
Sbjct: 280 QTERARFMSAEARKLAGHL-NADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPD 338

Query: 329 RYLKKASEIIMSEIGKSLID-------IDFEHIQKDLLLDKKE----------------P 365
           R L KA+E + + + ++           D   + +  + D  +                 
Sbjct: 339 RKLLKAAETVGAIVTRAPDTTPPAKRSADEREVPRMAVADAPQLPAQQALSAPVEVDFNS 398

Query: 366 RHTNVSMGIESFIKKNRSQIESIDVLLAEA 395
             T     ++  ++  R ++  ID LL + 
Sbjct: 399 ARTRSEADLQKTMENARRKLAEIDALLGKT 428


>gi|17984290|gb|AAL53396.1| chemotaxis motc protein precursor [Brucella melitensis bv. 1 str.
           16M]
          Length = 397

 Score =  324 bits (831), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 84/390 (21%), Positives = 148/390 (37%), Gaps = 25/390 (6%)

Query: 30  IVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYT 89
           + PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY 
Sbjct: 7   LEPYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYL 66

Query: 90  IISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYL 149
               +   V  ++A          +V     Y SGQ  E  K  S     +    +   +
Sbjct: 67  FNGGNPEAVRKVLANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASI 126

Query: 150 HLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQ-NEVGERAFGYIRAY 208
            L+    MM F    A+   D VRL +PGT  EE A+R  L I       ++     R Y
Sbjct: 127 VLVTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKRGAADKVRLLSRNY 186

Query: 209 VTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISG 268
           + +F HS Y   F++  +   L    ++ DE++V  I       Q  +YL+IA+ +++ G
Sbjct: 187 LQRFRHSPYMRDFMAQFVDTTLKLSDRIGDEELVKLIGSADPLLQYTLYLQIARGALVDG 246

Query: 269 KRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQD 328
           + +       + +++   L   D     LY    ++      S  R    I    L E D
Sbjct: 247 QTERARFMSAEARKLAGHL-NADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPD 305

Query: 329 RYLKKASEIIMSEIGKSLID-------IDFEHIQKDLLLDKKE----------------P 365
           R L KA+E + + + ++           D   + +  + D  +                P
Sbjct: 306 RKLLKAAETVGAIVTRAPDTTSRAKRSADEREVPRMAVADAPQLPAQQTLSAPVEVDFNP 365

Query: 366 RHTNVSMGIESFIKKNRSQIESIDVLLAEA 395
             T     ++  ++  R ++  ID LL + 
Sbjct: 366 ARTRSEADLQKTMENARRKLAEIDALLGKT 395


>gi|306841272|ref|ZP_07473983.1| chemotaxis protein [Brucella sp. BO2]
 gi|306288674|gb|EFM60005.1| chemotaxis protein [Brucella sp. BO2]
          Length = 420

 Score =  324 bits (830), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 83/390 (21%), Positives = 147/390 (37%), Gaps = 25/390 (6%)

Query: 30  IVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYT 89
           + PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY 
Sbjct: 30  LEPYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYL 89

Query: 90  IISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYL 149
               +   V  ++A          +V     Y SGQ  E  K  S     D    +   +
Sbjct: 90  FNGGNPEAVRKVLANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPDVPAELKASI 149

Query: 150 HLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIRAY 208
            L+    MM F    A+   D VRL +PGT  EE A+R  L I       ++     R Y
Sbjct: 150 VLVTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKLGDADKVRLLSRNY 209

Query: 209 VTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISG 268
           + +F HS Y   F++  +   L    ++ +E++V  I       Q  +YL+IA+ +++ G
Sbjct: 210 LQRFRHSPYMRDFMAQFVDTTLKLSDRIGNEELVKLIGSADPLLQYTLYLQIARGALVDG 269

Query: 269 KRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQD 328
           + +       + +++   L   D     LY    ++      S  R    I    L E D
Sbjct: 270 QTERARFMSAEARKLAGHL-NADPTRANLYAAASDVVSDSAGSALRELSQISPDHLQEPD 328

Query: 329 RYLKKASEIIMSEIGKSLID-------IDFEHIQKDLLLDKKEP---------------- 365
           R L KA+E + + + ++           D   + +  + D  +                 
Sbjct: 329 RKLLKAAETVGAIVTRAPDTTPPAKRSADEREVPRMAVADAPQQPAQQALSAPVEVDFNS 388

Query: 366 RHTNVSMGIESFIKKNRSQIESIDVLLAEA 395
             T     ++  ++  R ++  ID LL + 
Sbjct: 389 ARTRSEADLQKTMENARRKLAEIDALLGKT 418


>gi|161511179|ref|NP_541132.2| chemotaxis protein [Brucella melitensis bv. 1 str. 16M]
 gi|256042870|ref|ZP_05445816.1| chemotaxis protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|260564107|ref|ZP_05834592.1| chemotaxis motc protein [Brucella melitensis bv. 1 str. 16M]
 gi|265989305|ref|ZP_06101862.1| chemotaxis protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|260151750|gb|EEW86843.1| chemotaxis motc protein [Brucella melitensis bv. 1 str. 16M]
 gi|262999974|gb|EEZ12664.1| chemotaxis protein [Brucella melitensis bv. 1 str. Rev.1]
          Length = 430

 Score =  324 bits (830), Expect = 2e-86,   Method: Composition-based stats.
 Identities = 84/390 (21%), Positives = 148/390 (37%), Gaps = 25/390 (6%)

Query: 30  IVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYT 89
           + PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY 
Sbjct: 40  LEPYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYL 99

Query: 90  IISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYL 149
               +   V  ++A          +V     Y SGQ  E  K  S     +    +   +
Sbjct: 100 FNGGNPEAVRKVLANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASI 159

Query: 150 HLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQ-NEVGERAFGYIRAY 208
            L+    MM F    A+   D VRL +PGT  EE A+R  L I       ++     R Y
Sbjct: 160 VLVTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKRGAADKVRLLSRNY 219

Query: 209 VTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISG 268
           + +F HS Y   F++  +   L    ++ DE++V  I       Q  +YL+IA+ +++ G
Sbjct: 220 LQRFRHSPYMRDFMAQFVDTTLKLSDRIGDEELVKLIGSADPLLQYTLYLQIARGALVDG 279

Query: 269 KRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQD 328
           + +       + +++   L   D     LY    ++      S  R    I    L E D
Sbjct: 280 QTERARFMSAEARKLAGHL-NADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPD 338

Query: 329 RYLKKASEIIMSEIGKSLID-------IDFEHIQKDLLLDKKE----------------P 365
           R L KA+E + + + ++           D   + +  + D  +                P
Sbjct: 339 RKLLKAAETVGAIVTRAPDTTSRAKRSADEREVPRMAVADAPQLPAQQTLSAPVEVDFNP 398

Query: 366 RHTNVSMGIESFIKKNRSQIESIDVLLAEA 395
             T     ++  ++  R ++  ID LL + 
Sbjct: 399 ARTRSEADLQKTMENARRKLAEIDALLGKT 428


>gi|148558481|ref|YP_001258007.1| chemotaxis protein [Brucella ovis ATCC 25840]
 gi|148369766|gb|ABQ62638.1| putative chemotaxis motC protein [Brucella ovis ATCC 25840]
          Length = 397

 Score =  323 bits (827), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 83/390 (21%), Positives = 147/390 (37%), Gaps = 25/390 (6%)

Query: 30  IVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYT 89
           + PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY 
Sbjct: 7   LEPYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYL 66

Query: 90  IISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYL 149
               +   V  ++A          +V     Y SGQ  E  K  S     +    +   +
Sbjct: 67  FNGGNPEAVRKVLANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASI 126

Query: 150 HLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIRAY 208
            L+    MM F    A+   D VRL +PGT  EE A+R  L I       ++     R Y
Sbjct: 127 VLVTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKLGAADKVRLLSRNY 186

Query: 209 VTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISG 268
           + +F HS Y   F++  +   L    ++ DE++V  I       Q  +YL+IA+ +++ G
Sbjct: 187 LQRFRHSPYMRDFMAQFVDTTLKLSDRIGDEELVKLIGSADPLLQYTLYLQIARGALVDG 246

Query: 269 KRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQD 328
           + +       + +++   L   D     LY    ++      S  R    I    L E D
Sbjct: 247 QTERARFMSAEARKLAGHL-NADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPD 305

Query: 329 RYLKKASEIIMSEIGKSLID-------IDFEHIQKDLLLDKKE----------------P 365
           R L KA+E + + + ++           D   + +  + D  +                 
Sbjct: 306 RKLLKAAETVGAIVTRAPDTTSRAKRSADEREVPRMAVADAPQLPAQQTLSAPVEVDFNS 365

Query: 366 RHTNVSMGIESFIKKNRSQIESIDVLLAEA 395
             T     ++  ++  R ++  ID LL + 
Sbjct: 366 ARTRSEADLQKTMENARRKLAEIDALLGKT 395


>gi|256059800|ref|ZP_05449995.1| chemotaxis protein [Brucella neotomae 5K33]
 gi|261323780|ref|ZP_05962977.1| chemotaxis protein [Brucella neotomae 5K33]
 gi|261299760|gb|EEY03257.1| chemotaxis protein [Brucella neotomae 5K33]
          Length = 424

 Score =  323 bits (827), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 82/368 (22%), Positives = 142/368 (38%), Gaps = 6/368 (1%)

Query: 30  IVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYT 89
           + PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY 
Sbjct: 40  LEPYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYL 99

Query: 90  IISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYL 149
               +   V  ++A          +V     Y SGQ  E  K  S     +    +   +
Sbjct: 100 FNGGNPEAVRKVLANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASI 159

Query: 150 HLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIRAY 208
            L+    MM F    A+   D VRL +PGT  EE A+R  L I       ++     R Y
Sbjct: 160 VLVTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKLGAADKVRLLSRNY 219

Query: 209 VTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISG 268
           + +F HS Y   F++  +   L    ++ DE++V  I       Q  +YL+IA+ +++ G
Sbjct: 220 LQRFRHSPYMRDFMAQFVDTTLKLSDRIGDEELVKLIGSADPLLQYTLYLQIARGALVDG 279

Query: 269 KRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQD 328
           + +       + +++   L   D     LY    ++      S  R    I    L E D
Sbjct: 280 QTERARFMSAEARKLAGHL-NADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPD 338

Query: 329 RYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIESI 388
           R L KA+E + + + ++               D++E     V+   +   ++  S    +
Sbjct: 339 RKLLKAAETVGAIVTRAPDTTSRAKR----SADEREVPRMAVADAPQLPAQQTLSAPVEV 394

Query: 389 DVLLAEAR 396
           D   A  R
Sbjct: 395 DFNSARTR 402


>gi|62317961|ref|YP_223814.1| chemotaxis protein [Brucella abortus bv. 1 str. 9-941]
 gi|83269938|ref|YP_419229.1| chemotaxis protein [Brucella melitensis biovar Abortus 2308]
 gi|161621186|ref|YP_001595072.1| chemotaxis protein [Brucella canis ATCC 23365]
 gi|163845461|ref|YP_001623116.1| chemotaxis protein [Brucella suis ATCC 23445]
 gi|189023212|ref|YP_001932953.1| chemotaxis protein [Brucella abortus S19]
 gi|225628432|ref|ZP_03786466.1| chemotaxis protein [Brucella ceti str. Cudo]
 gi|225686889|ref|YP_002734861.1| chemotaxis protein [Brucella melitensis ATCC 23457]
 gi|237817508|ref|ZP_04596498.1| chemotaxis protein [Brucella abortus str. 2308 A]
 gi|254691606|ref|ZP_05154860.1| chemotaxis protein [Brucella abortus bv. 6 str. 870]
 gi|254698193|ref|ZP_05160021.1| chemotaxis protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254699265|ref|ZP_05161093.1| chemotaxis protein [Brucella suis bv. 5 str. 513]
 gi|254702389|ref|ZP_05164217.1| chemotaxis protein [Brucella suis bv. 3 str. 686]
 gi|254706493|ref|ZP_05168321.1| chemotaxis protein [Brucella pinnipedialis M163/99/10]
 gi|254711823|ref|ZP_05173634.1| chemotaxis protein [Brucella ceti M644/93/1]
 gi|254714892|ref|ZP_05176703.1| chemotaxis protein [Brucella ceti M13/05/1]
 gi|254731638|ref|ZP_05190216.1| chemotaxis protein [Brucella abortus bv. 4 str. 292]
 gi|256015902|ref|YP_003105911.1| chemotaxis protein MotC [Brucella microti CCM 4915]
 gi|256158328|ref|ZP_05456232.1| chemotaxis protein [Brucella ceti M490/95/1]
 gi|256252738|ref|ZP_05458274.1| chemotaxis protein [Brucella ceti B1/94]
 gi|256256794|ref|ZP_05462330.1| chemotaxis protein [Brucella abortus bv. 9 str. C68]
 gi|256261974|ref|ZP_05464506.1| chemotaxis motc protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260166799|ref|ZP_05753610.1| chemotaxis protein [Brucella sp. F5/99]
 gi|260544146|ref|ZP_05819967.1| chemotaxis motc protein [Brucella abortus NCTC 8038]
 gi|260568710|ref|ZP_05839179.1| chemotaxis motc protein [Brucella suis bv. 4 str. 40]
 gi|260757238|ref|ZP_05869586.1| chemotaxis protein [Brucella abortus bv. 6 str. 870]
 gi|260759397|ref|ZP_05871745.1| chemotaxis protein [Brucella abortus bv. 4 str. 292]
 gi|260762640|ref|ZP_05874972.1| chemotaxis protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883042|ref|ZP_05894656.1| chemotaxis protein [Brucella abortus bv. 9 str. C68]
 gi|261216581|ref|ZP_05930862.1| chemotaxis protein [Brucella ceti M13/05/1]
 gi|261219817|ref|ZP_05934098.1| chemotaxis protein [Brucella ceti B1/94]
 gi|261313946|ref|ZP_05953143.1| chemotaxis protein [Brucella pinnipedialis M163/99/10]
 gi|261319451|ref|ZP_05958648.1| chemotaxis protein [Brucella ceti M644/93/1]
 gi|261749707|ref|ZP_05993416.1| chemotaxis protein [Brucella suis bv. 5 str. 513]
 gi|261752950|ref|ZP_05996659.1| chemotaxis protein [Brucella suis bv. 3 str. 686]
 gi|261756177|ref|ZP_05999886.1| chemotaxis motc protein [Brucella sp. F5/99]
 gi|265996842|ref|ZP_06109399.1| chemotaxis protein [Brucella ceti M490/95/1]
 gi|297250147|ref|ZP_06933848.1| chemotaxis protein MotC [Brucella abortus bv. 5 str. B3196]
 gi|62198154|gb|AAX76453.1| hypothetical MotC chemotaxis protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82940212|emb|CAJ13268.1| chemotaxis motc protein precursor [Brucella melitensis biovar
           Abortus 2308]
 gi|161337997|gb|ABX64301.1| Hypothetical protein BCAN_B1172 [Brucella canis ATCC 23365]
 gi|163676184|gb|ABY40294.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189021786|gb|ACD74507.1| chemotaxis motc protein precursor [Brucella abortus S19]
 gi|225616278|gb|EEH13326.1| chemotaxis protein [Brucella ceti str. Cudo]
 gi|225642994|gb|ACO02907.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|237787263|gb|EEP61481.1| chemotaxis protein [Brucella abortus str. 2308 A]
 gi|255998562|gb|ACU50249.1| chemotaxis protein MotC [Brucella microti CCM 4915]
 gi|260097417|gb|EEW81291.1| chemotaxis motc protein [Brucella abortus NCTC 8038]
 gi|260155375|gb|EEW90456.1| chemotaxis motc protein [Brucella suis bv. 4 str. 40]
 gi|260669715|gb|EEX56655.1| chemotaxis protein [Brucella abortus bv. 4 str. 292]
 gi|260673061|gb|EEX59882.1| chemotaxis protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260677346|gb|EEX64167.1| chemotaxis protein [Brucella abortus bv. 6 str. 870]
 gi|260872570|gb|EEX79639.1| chemotaxis protein [Brucella abortus bv. 9 str. C68]
 gi|260918401|gb|EEX85054.1| chemotaxis protein [Brucella ceti B1/94]
 gi|260921670|gb|EEX88238.1| chemotaxis protein [Brucella ceti M13/05/1]
 gi|261292141|gb|EEX95637.1| chemotaxis protein [Brucella ceti M644/93/1]
 gi|261302972|gb|EEY06469.1| chemotaxis protein [Brucella pinnipedialis M163/99/10]
 gi|261736161|gb|EEY24157.1| chemotaxis motc protein [Brucella sp. F5/99]
 gi|261739460|gb|EEY27386.1| chemotaxis protein [Brucella suis bv. 5 str. 513]
 gi|261742703|gb|EEY30629.1| chemotaxis protein [Brucella suis bv. 3 str. 686]
 gi|262551139|gb|EEZ07300.1| chemotaxis protein [Brucella ceti M490/95/1]
 gi|263091458|gb|EEZ15994.1| chemotaxis motc protein [Brucella melitensis bv. 2 str. 63/9]
 gi|297174016|gb|EFH33380.1| chemotaxis protein MotC [Brucella abortus bv. 5 str. B3196]
 gi|326411307|gb|ADZ68371.1| chemotaxis protein [Brucella melitensis M28]
 gi|326554596|gb|ADZ89235.1| chemotaxis protein [Brucella melitensis M5-90]
          Length = 430

 Score =  322 bits (826), Expect = 5e-86,   Method: Composition-based stats.
 Identities = 83/390 (21%), Positives = 147/390 (37%), Gaps = 25/390 (6%)

Query: 30  IVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYT 89
           + PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY 
Sbjct: 40  LEPYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYL 99

Query: 90  IISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYL 149
               +   V  ++A          +V     Y SGQ  E  K  S     +    +   +
Sbjct: 100 FNGGNPEAVRKVLANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASI 159

Query: 150 HLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIRAY 208
            L+    MM F    A+   D VRL +PGT  EE A+R  L I       ++     R Y
Sbjct: 160 VLVTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKLGAADKVRLLSRNY 219

Query: 209 VTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISG 268
           + +F HS Y   F++  +   L    ++ DE++V  I       Q  +YL+IA+ +++ G
Sbjct: 220 LQRFRHSPYMRDFMAQFVDTTLKLSDRIGDEELVKLIGSADPLLQYTLYLQIARGALVDG 279

Query: 269 KRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQD 328
           + +       + +++   L   D     LY    ++      S  R    I    L E D
Sbjct: 280 QTERARFMSAEARKLAGHL-NADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPD 338

Query: 329 RYLKKASEIIMSEIGKSLID-------IDFEHIQKDLLLDKKE----------------P 365
           R L KA+E + + + ++           D   + +  + D  +                 
Sbjct: 339 RKLLKAAETVGAIVTRAPDTTSRAKRSADEREVPRMAVADAPQLPAQQTLSAPVEVDFNS 398

Query: 366 RHTNVSMGIESFIKKNRSQIESIDVLLAEA 395
             T     ++  ++  R ++  ID LL + 
Sbjct: 399 ARTRSEADLQKTMENARRKLAEIDALLGKT 428


>gi|254720769|ref|ZP_05182580.1| chemotaxis protein [Brucella sp. 83/13]
 gi|265985827|ref|ZP_06098562.1| chemotaxis protein [Brucella sp. 83/13]
 gi|306840140|ref|ZP_07472925.1| chemotaxis protein [Brucella sp. NF 2653]
 gi|264664419|gb|EEZ34680.1| chemotaxis protein [Brucella sp. 83/13]
 gi|306404785|gb|EFM61079.1| chemotaxis protein [Brucella sp. NF 2653]
          Length = 430

 Score =  321 bits (823), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 82/390 (21%), Positives = 147/390 (37%), Gaps = 25/390 (6%)

Query: 30  IVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYT 89
           + PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY 
Sbjct: 40  LEPYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMGRAQPEVWDKPENIYAAIIYL 99

Query: 90  IISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYL 149
               +   V  ++A          +V     Y SGQ  E  K  S     +    +   +
Sbjct: 100 FNGGNPEAVRKVLANLKSDTVSQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASI 159

Query: 150 HLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIRAY 208
            L+    MM F    A+   D VRL +PGT  EE A+R  L I       ++     R Y
Sbjct: 160 VLVTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKLGDADKVRLLSRNY 219

Query: 209 VTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISG 268
           + +F HS Y   F++  +   L    ++ +E++V  I       Q  +YL+IA+ +++ G
Sbjct: 220 LQRFRHSPYMRDFMAQFVDTTLKLSDRIGNEELVKLIGSADPLLQYTLYLQIARGALVDG 279

Query: 269 KRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQD 328
           + +       + +++   L   D     LY    ++      S  R    I    L E D
Sbjct: 280 QTERARFMSAEARKLAGHL-NADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPD 338

Query: 329 RYLKKASEIIMSEIGKSLID-------IDFEHIQKDLLLDKKE----------------P 365
           R L KA+E + + + ++           D   + +  + D  +                 
Sbjct: 339 RKLLKAAETVGAIVTRAPDTTPPAKRSADEREVPRMAVADAPQLPAQQALSAPVEVDFNS 398

Query: 366 RHTNVSMGIESFIKKNRSQIESIDVLLAEA 395
             T     ++  ++  R ++  ID LL + 
Sbjct: 399 ARTRSEADLQKTMENARRKLAEIDALLGKT 428


>gi|254711222|ref|ZP_05173033.1| chemotaxis protein [Brucella pinnipedialis B2/94]
 gi|256030149|ref|ZP_05443763.1| chemotaxis protein [Brucella pinnipedialis M292/94/1]
 gi|261318814|ref|ZP_05958011.1| chemotaxis protein [Brucella pinnipedialis B2/94]
 gi|265987179|ref|ZP_06099736.1| chemotaxis protein [Brucella pinnipedialis M292/94/1]
 gi|261298037|gb|EEY01534.1| chemotaxis protein [Brucella pinnipedialis B2/94]
 gi|264659376|gb|EEZ29637.1| chemotaxis protein [Brucella pinnipedialis M292/94/1]
          Length = 430

 Score =  321 bits (823), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 83/390 (21%), Positives = 147/390 (37%), Gaps = 25/390 (6%)

Query: 30  IVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYT 89
           + PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY 
Sbjct: 40  LEPYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYL 99

Query: 90  IISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYL 149
               +   V  ++A          +V     Y SGQ  E  K  S     +    +   +
Sbjct: 100 FNGGNPEAVRKVLANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASI 159

Query: 150 HLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIRAY 208
            L+    MM F    A+   D VRL +PGT  EE A+R  L I       ++     R Y
Sbjct: 160 VLVTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKLGAADKVRLLSRNY 219

Query: 209 VTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISG 268
           + +F HS Y   F++  +   L    ++ DE++V  I       Q  +YL+IA+ +++ G
Sbjct: 220 LQRFRHSPYMRDFMAQFVDTTLKLSDRIGDEELVKLIGSADPLLQYTLYLQIARGALVDG 279

Query: 269 KRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQD 328
           + +       + +++   L   D     LY    ++      S  R    I    L E D
Sbjct: 280 QTERARFISAEARKLAGHL-NADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPD 338

Query: 329 RYLKKASEIIMSEIGKSLID-------IDFEHIQKDLLLDKKE----------------P 365
           R L KA+E + + + ++           D   + +  + D  +                 
Sbjct: 339 RKLLKAAETVGAIVTRAPDTTSRAKRSADEREVPRMAVADAPQLPAQQTLSAPVEVDFNS 398

Query: 366 RHTNVSMGIESFIKKNRSQIESIDVLLAEA 395
             T     ++  ++  R ++  ID LL + 
Sbjct: 399 ARTRSEADLQKTMENARRKLAEIDALLGKT 428


>gi|256112173|ref|ZP_05453094.1| chemotaxis protein [Brucella melitensis bv. 3 str. Ether]
 gi|265993599|ref|ZP_06106156.1| chemotaxis protein [Brucella melitensis bv. 3 str. Ether]
 gi|262764469|gb|EEZ10501.1| chemotaxis protein [Brucella melitensis bv. 3 str. Ether]
          Length = 430

 Score =  320 bits (821), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 83/390 (21%), Positives = 146/390 (37%), Gaps = 25/390 (6%)

Query: 30  IVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYT 89
           + PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY 
Sbjct: 40  LEPYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYL 99

Query: 90  IISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYL 149
               +   V   +A          +V     Y SGQ  E  K  S     +    +   +
Sbjct: 100 FNGGNPEAVRKALANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASI 159

Query: 150 HLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIRAY 208
            L+    MM F    A+   D VRL +PGT  EE A+R  L I       ++     R Y
Sbjct: 160 VLVTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKLGAADKVRLLSRNY 219

Query: 209 VTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISG 268
           + +F HS Y   F++  +   L    ++ DE++V  I       Q  +YL+IA+ +++ G
Sbjct: 220 LQRFRHSPYMRDFMAQFVDTTLKLSDRIGDEELVKLIGSADPLLQYTLYLQIARGALVDG 279

Query: 269 KRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQD 328
           + +       + +++   L   D     LY    ++      S  R    I    L E D
Sbjct: 280 QTERARFMSAEARKLAGHL-NADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPD 338

Query: 329 RYLKKASEIIMSEIGKSLID-------IDFEHIQKDLLLDKKE----------------P 365
           R L KA+E + + + ++           D   + +  + D  +                 
Sbjct: 339 RKLLKAAETVGAIVTRAPDTTSRAKRSADEREVPRMAVADAPQLPAQQTLSAPVEVDFNS 398

Query: 366 RHTNVSMGIESFIKKNRSQIESIDVLLAEA 395
             T     ++  ++  R ++  ID LL + 
Sbjct: 399 ARTRSEADLQKTMENARRKLAEIDALLGKT 428


>gi|239834430|ref|ZP_04682758.1| chemotaxis protein [Ochrobactrum intermedium LMG 3301]
 gi|239822493|gb|EEQ94062.1| chemotaxis protein [Ochrobactrum intermedium LMG 3301]
          Length = 437

 Score =  319 bits (818), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 77/394 (19%), Positives = 145/394 (36%), Gaps = 29/394 (7%)

Query: 30  IVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYT 89
           + PY+ VRSL+   D+ + G       +  ++      +     DV+ +  N+ A  IY 
Sbjct: 43  LEPYKLVRSLRMLQDQIVAGKPEAVVMLNKLLGFVSTDMGRASGDVWHNPENVYAAIIYL 102

Query: 90  IISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYL 149
               +   V  ++A          +V     Y SGQ  E  K  S     D    +   +
Sbjct: 103 FNGGNPEAVRKVLADLKTDAVPPELVKGALAYASGQTIEVVKLFSVPLAPDVPSELKASI 162

Query: 150 HLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIRAY 208
            L+    M  F    A+   D VRL +PGT  EE A+R  + I       ++     R Y
Sbjct: 163 VLVTASQMTAFDPATALMRLDQVRLDAPGTLFEEAAIRRSMPIAARLGDADKIRLLARNY 222

Query: 209 VTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISG 268
           + +F  S Y   F++  +   +    ++ + ++   I       Q ++YL+IA+ +++ G
Sbjct: 223 LQRFPRSPYMRDFMAQFVDAAVKLNDRIGNAELARLIGSADPVMQYSLYLQIARGALVDG 282

Query: 269 KRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQD 328
           + +       + K++ D+L   D     LY    ++      S  R    I    L E D
Sbjct: 283 QTERARFMSAEAKKLADKLK-TDPTRANLYAAASDVASDSAGSALRELSQISPDKLQEPD 341

Query: 329 RYLKKASEIIMSEIGK------------------SLIDIDFEHIQKDLLLDKKE------ 364
           R L KA+E + + + +                   +   +    + +  +          
Sbjct: 342 RKLLKAAEAVGTVVTRTPDASPPAKPALTERDVPPMATANPPENRAEKPVANPAAAPMAV 401

Query: 365 ---PRHTNVSMGIESFIKKNRSQIESIDVLLAEA 395
              P        ++  ++  R ++  ID LL + 
Sbjct: 402 SLKPVKNQPEDDLQKTMEDARRKLAEIDALLGKT 435


>gi|294852973|ref|ZP_06793645.1| chemotaxis protein MotC [Brucella sp. NVSL 07-0026]
 gi|294818628|gb|EFG35628.1| chemotaxis protein MotC [Brucella sp. NVSL 07-0026]
          Length = 430

 Score =  317 bits (812), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 82/390 (21%), Positives = 146/390 (37%), Gaps = 25/390 (6%)

Query: 30  IVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYT 89
           + PY+ VRSL+   D+ +         +  ++      +     +V+    NI A  IY 
Sbjct: 40  LEPYKLVRSLRMLQDQVVADKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYL 99

Query: 90  IISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYL 149
               +   V  ++A          +V     Y SGQ  E  K  S     +    +   +
Sbjct: 100 FNGGNPEAVRKVLANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASI 159

Query: 150 HLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIRAY 208
            L+    MM F    A+   D VRL +PGT  EE A+R  L I       ++     R Y
Sbjct: 160 VLVTANQMMAFDPATALLRLDQVRLEAPGTLFEEAAIRRSLPIAAKLGAADKVRLLSRNY 219

Query: 209 VTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISG 268
           + +F HS Y   F++  +   L    ++ DE++V  I       Q  +YL+IA+ +++ G
Sbjct: 220 LQRFRHSPYMRDFMAQFVDTTLKLSDRIGDEELVKLIGSADPLLQYTLYLQIARGALVDG 279

Query: 269 KRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQD 328
           + +       + +++   L   D     LY    ++      S  R    I    L E D
Sbjct: 280 QTERARFMSAEARKLAGHL-NADPTRANLYAAASDVASDSAGSALRELSQISPDHLQEPD 338

Query: 329 RYLKKASEIIMSEIGKSLID-------IDFEHIQKDLLLDKKE----------------P 365
           R L KA+E + + + ++           D   + +  + D  +                 
Sbjct: 339 RKLLKAAETVEAIVTRAPDTTSRAKRSADEREVPRMAVADAPQLPAQQTLSAPVEVDFNS 398

Query: 366 RHTNVSMGIESFIKKNRSQIESIDVLLAEA 395
             T     ++  ++  R ++  ID LL + 
Sbjct: 399 ARTRSEADLQKTMENARRKLAEIDALLGKT 428


>gi|254695097|ref|ZP_05156925.1| chemotaxis protein [Brucella abortus bv. 3 str. Tulya]
 gi|261215448|ref|ZP_05929729.1| chemotaxis protein [Brucella abortus bv. 3 str. Tulya]
 gi|260917055|gb|EEX83916.1| chemotaxis protein [Brucella abortus bv. 3 str. Tulya]
          Length = 435

 Score =  316 bits (810), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 83/395 (21%), Positives = 147/395 (37%), Gaps = 30/395 (7%)

Query: 30  IVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYT 89
           + PY+ VRSL+   D+ + G       +  ++      +     +V+    NI A  IY 
Sbjct: 40  LEPYKLVRSLRMLQDQVVAGKPEAVVMLNKLLGFVSTDMSRAQPEVWDKPENIYAAIIYL 99

Query: 90  IISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYL 149
               +   V  ++A          +V     Y SGQ  E  K  S     +    +   +
Sbjct: 100 FNGGNPEAVRKVLANLKTDTVPQELVKGALAYASGQTIEVVKLFSVPLAPEVPAELKASI 159

Query: 150 HLLIGRAMMPFSSQQAVH-----FFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFG 203
            L+    MM F    A+        D VRL +PGT  EE A+R  L I       ++   
Sbjct: 160 VLVTANQMMAFDPATALLRLDQVRLDQVRLEAPGTLFEEAAIRRSLPIAAKLGAADKVRL 219

Query: 204 YIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQN 263
             R Y+ +F HS Y   F++  +   L    ++ DE++V  I       Q  +YL+IA+ 
Sbjct: 220 LSRNYLQRFRHSPYMRDFMAQFVDTTLKLSDRIGDEELVKLIGSADPLLQYTLYLQIARG 279

Query: 264 SVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYS 323
           +++ G+ +       + +++   L   D     LY    ++      S  R    I    
Sbjct: 280 ALVDGQTERARFMSAEARKLAGHL-NADPTRANLYAAASDVASDSAGSALRELSQISPDH 338

Query: 324 LMEQDRYLKKASEIIMSEIGKSLID-------IDFEHIQKDLLLDKKE------------ 364
           L E DR L KA+E + + + ++           D   + +  + D  +            
Sbjct: 339 LQEPDRKLLKAAETVGAIVTRAPDTTSRAKRSADEREVPRMAVADAPQLPAQQTLSAPVE 398

Query: 365 ----PRHTNVSMGIESFIKKNRSQIESIDVLLAEA 395
                  T     ++  ++  R ++  ID LL + 
Sbjct: 399 VDFNSARTRSEADLQKTMENARRKLAEIDALLGKT 433


>gi|260466607|ref|ZP_05812795.1| hypothetical protein MesopDRAFT_5442 [Mesorhizobium opportunistum
           WSM2075]
 gi|259029613|gb|EEW30901.1| hypothetical protein MesopDRAFT_5442 [Mesorhizobium opportunistum
           WSM2075]
          Length = 455

 Score =  314 bits (804), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 72/330 (21%), Positives = 133/330 (40%), Gaps = 1/330 (0%)

Query: 21  ATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNR 80
            +       + PYQ VRSLQ   D    GD +       +++ T  +LR      F D +
Sbjct: 21  PSSGFAQDALQPYQLVRSLQLIQDRIAAGDHAAMPMQAKLLEMTDARLREADAQDFEDPK 80

Query: 81  NIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKD 140
           N  A+ +Y +   +   V+  +++      D+AI   +  Y +G+  ++   L  I    
Sbjct: 81  NFRALLVYGMSGGNPVTVEAAVSRAAADPGDLAIAKGVIDYLNGRPGDAITALGPIDPMA 140

Query: 141 NTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGER 200
               +  +L L+ G  +       A+   D  +L SPGT +EE ALR  + I   +    
Sbjct: 141 LPGDLGAFLALVKGSLLAGDDPAAALKLLDEAKLLSPGTLVEEAALRRSVGIAVAQGDAA 200

Query: 201 AFGYIR-AYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLK 259
            F      YV ++ +S Y   F    +   +   + +  + +    S    E ++ IYL+
Sbjct: 201 RFALASTQYVERYLYSPYASQFADSFVSGVIALHMSISQDKLADITSMMDPEREKVIYLR 260

Query: 260 IAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNI 319
           IA+ + I G  ++   A  + ++  D    +D     LY ++  +    I  ++     I
Sbjct: 261 IARRAAIDGLNELSAFASTRAEQGRDGNTNQDDPRALLYSSLSTVTSDTIEDVRTKLGKI 320

Query: 320 PYYSLMEQDRYLKKASEIIMSEIGKSLIDI 349
               L + DR L  A++ I  E+      +
Sbjct: 321 DRSKLSDGDRDLLDAAQAIAGEVVAPPASL 350


>gi|319781669|ref|YP_004141145.1| hypothetical protein Mesci_1942 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167557|gb|ADV11095.1| hypothetical protein Mesci_1942 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 460

 Score =  313 bits (803), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 77/368 (20%), Positives = 142/368 (38%), Gaps = 1/368 (0%)

Query: 21  ATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNR 80
            +       + PYQ VRSLQ   D    GD +       +++ T  +LRA + + + D +
Sbjct: 21  PSTGFAQEALQPYQLVRSLQLIQDRIAAGDHAALPMQAKLLEMTDARLRAANAEDYKDPK 80

Query: 81  NIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKD 140
           N  A+ +Y +   +   V+   ++ T     +AI   + +Y +G+  ++ + L  I    
Sbjct: 81  NFRALLVYGMSGGNPVTVEAATSRATADPQSLAIAKGVIEYLNGRPGKAIEALRPIDPMA 140

Query: 141 NTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGER 200
               +  +L L+ G  +       A+   D  RL SPGT +EE ALR  + +   +    
Sbjct: 141 LPPDLGAFLALVKGSLLAGDQPATALGLLDEARLLSPGTLVEEAALRRSVGLAVAQGDAA 200

Query: 201 AFGYIR-AYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLK 259
            F      YV ++ +S Y   F    +   +   + +  + +    S    E ++ IYL+
Sbjct: 201 RFALASTQYVERYLYSPYASQFADSFVSGVIALHMSISQDKLGDITSMMDPEREKVIYLR 260

Query: 260 IAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNI 319
           IA+ + I G   +   A  + ++  D    +D     LY ++  +    I  ++     I
Sbjct: 261 IARRAAIDGLNDLSAFASARAEQGRDGNTNQDDPRALLYASLSTVTSGTIEDIRAKLGKI 320

Query: 320 PYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIK 379
               L E DR L  A++ I  E+      +  E            P         +S + 
Sbjct: 321 DRSRLSEGDRALLDAAQAIAGEVVAPPTALPAEKPAPVAAEQPPAPEIATPQNADDSSLP 380

Query: 380 KNRSQIES 387
                I  
Sbjct: 381 PVEGAISE 388


>gi|110632644|ref|YP_672852.1| chemotaxis protein [Mesorhizobium sp. BNC1]
 gi|110283628|gb|ABG61687.1| chemotaxis precursor (motility protein C) transmembrane
           [Chelativorans sp. BNC1]
          Length = 391

 Score =  304 bits (778), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 88/395 (22%), Positives = 154/395 (38%), Gaps = 17/395 (4%)

Query: 10  MMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLR 69
              AM       T       + PYQ +RSLQ   D    GD +       ++     +L 
Sbjct: 5   FGAAMLAACVSLTASANAEGLEPYQMIRSLQLVQDRIADGDHAALPIQRRLLAIIDERLH 64

Query: 70  ATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEES 129
                 F +  N  A+ IY+    + + +D +I++         +   L +Y  G L  +
Sbjct: 65  TAD---FENPHNFRALLIYSASGGNPATLDAVISRLKLDEDQSRLSNGLTQYARGDLRAA 121

Query: 130 SKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNL 189
            + LS  +       +   L L+IG  +   +  +A+ FFD  RL SPGT +EE ALR  
Sbjct: 122 REMLSATELSTLDPELAAPLALVIGSLLAQQAPTEALRFFDQARLISPGTLIEEAALRRS 181

Query: 190 LEITQNEVGERAFGYI-RAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFF 248
           L ++        F    R Y  +F  S Y   F    +   +  + ++    +   ++  
Sbjct: 182 LTLSAELRDPERFALASRQYAWRFLRSPYASQFAEAFVSGVVALRGEIDLALVEEIVANM 241

Query: 249 SLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVD 308
             ++   IYL+IA+ S I G   +   A +   +  D     D     LY N+  +   D
Sbjct: 242 RRDQAHVIYLRIARQSAIEGYDNLLTFASRNADKYADSGGGLDP-RSVLYGNMALVASED 300

Query: 309 IMSLQRSTCNIPYYSLMEQDRYLKKASEIIM-SEIGKSLIDIDFEHIQ------KDLLLD 361
           +  +  +  +I    L   DR L  A+  +  + + +     +    Q      + ++  
Sbjct: 301 VKDVLHTLEHIDAKRLSPNDRKLLNAAREVARNILSRPAAGSEASARQGSFPQGEAVVAQ 360

Query: 362 KKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR 396
           + E    N      +F+      ++SIDVL+AEAR
Sbjct: 361 EGEDEQLNG-----AFVADTLKTLQSIDVLIAEAR 390


>gi|218675466|ref|ZP_03525135.1| chemotaxis protein [Rhizobium etli GR56]
          Length = 239

 Score =  293 bits (749), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 66/239 (27%), Positives = 119/239 (49%), Gaps = 1/239 (0%)

Query: 56  KIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIV 115
               ++     +LR     ++ D+RN+DA  IY +   +   ++ LIA D  GYFD  + 
Sbjct: 1   MQRFMLGTIDERLRTADTSIYDDDRNVDAALIYAMSGGNPQTLEYLIAHDVNGYFDNRVT 60

Query: 116 YALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLT 175
             L+KY +G+    +K L +   +   + I PYL L+ G  ++      A+  +D  RL 
Sbjct: 61  DVLRKYLTGKGLLVAKTLEETAREYRDKKIGPYLALIGGNVLIATKPTDALDLYDQARLA 120

Query: 176 SPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQL 234
           +PGT LEE ALR  + I  ++ + ++   Y + Y  +F HS Y   F  + ++  +    
Sbjct: 121 APGTILEEAALRRSVAICVDKGMLDKGLAYSQRYARRFLHSPYASQFADLFVKLVVAHDR 180

Query: 235 KLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLA 293
            +  +D+V  +SF     QR +YL+IA+ + ISGK ++  +A+ +++ +    D     
Sbjct: 181 DVKPQDVVDILSFMDAPRQREVYLRIARAAAISGKPELARMAVDRVQALGAGTDNAFGP 239


>gi|115523190|ref|YP_780101.1| chemotaxis protein [Rhodopseudomonas palustris BisA53]
 gi|115517137|gb|ABJ05121.1| putative chemotaxis protein precursor [Rhodopseudomonas palustris
           BisA53]
          Length = 395

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 78/354 (22%), Positives = 133/354 (37%), Gaps = 10/354 (2%)

Query: 5   YLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKET 64
           +L    +  + +  S   D+       PYQ VRSLQ   D+  RG++      P ++K  
Sbjct: 3   HLAKVAIALLALLGSARADEAATSAREPYQLVRSLQSLQDQIARGNLEAHNAQPALLKRL 62

Query: 65  GVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSG 124
           G Q R    +++ D RN  A  ++ +   D  VV  L ++      D AI+     Y  G
Sbjct: 63  GEQFRNADPNLWNDPRNSRAAVVFLLSGGDPQVVAALRSRKLLS-VDEAILDGAIAYVEG 121

Query: 125 QLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEI 184
           + EE+   L  +K       +   + L     +     +  V   D VRL  PGT +EE 
Sbjct: 122 RSEEAKARLGGVKSGALPATLGAEITLAQSALLAQSDLKATVARLDEVRLLMPGTLIEEA 181

Query: 185 ALRNLLEIT-QNEVGERAFGYIRAYVTQFHHSIYKDHFISVL-----LRFFLHGQLKLPD 238
           ALR  + +  Q +  ++       Y  ++ HSIY  +F            F+    + P 
Sbjct: 182 ALRREIFLVGQIDDFDKFERLATQYFRRYRHSIYAGNFRQRFALSVARFSFVQQADRFP- 240

Query: 239 EDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLY 298
             +V  +       QRA+Y  I + +++ GK ++  LA ++   + D     +      Y
Sbjct: 241 -RLVGVLDHLDRGSQRALYFLITRTALVRGKTEMANLAAERAISLTDE-GTAERTRAYFY 298

Query: 299 ENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFE 352
                +              +    L   D  L  A+  +   + K L     E
Sbjct: 299 RAAARLVSDGHEQALEDLQQLDTGRLSTPDANLLAAALALGRTVRKPLPAASTE 352


>gi|328545494|ref|YP_004305603.1| chemotaxis protein [polymorphum gilvum SL003B-26A1]
 gi|326415235|gb|ADZ72298.1| Probable chemotaxis protein [Polymorphum gilvum SL003B-26A1]
          Length = 400

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 64/340 (18%), Positives = 126/340 (37%), Gaps = 5/340 (1%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PY+ VR+LQ    E  +G+         ++ +          + + D RN  A  I+ + 
Sbjct: 32  PYRMVRTLQALQGEVAQGNSHAHTAQRALLLQMDEVFATAPAETWSDPRNARAAVIHLLS 91

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
                V+  L+  D +   D A++     Y  G+ EE+   L+ I   D    +   + L
Sbjct: 92  GGHPRVMRQLLDLDPQPDLDPALMRGALAYVEGRQEEARDLLTAIDPMDLPPNLGGQVAL 151

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIRAYVT 210
           +     +    + A+      RL  PGT +EE ALR  + +       ER       Y+ 
Sbjct: 152 VRAALAVGDDPEAAMKMLGVARLLMPGTLVEEAALRREVFVAGKIGDIERFQSLSIRYLR 211

Query: 211 QFHHSIYKDHFISVLLRFFLHGQLKLPDED---IVFTISFFSLEEQRAIYLKIAQNSVIS 267
           +F  SIY+  F                D     +   ++ F  + +R +YL++A+ +++ 
Sbjct: 212 RFRGSIYEGDFRRRFALALETLGFGENDAKFALLESLLAEFDSDSRRMLYLRLARQALVG 271

Query: 268 GKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQ 327
           G  +I   A ++   +       +   +++Y     +   DI   +    +I    L  +
Sbjct: 272 GHLEIVRKATERALPLA-MAGTSEHRLLRIYRAGALLDPRDIGEARDLLWSIDRGELTPE 330

Query: 328 DRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRH 367
           +R L  A   +++ +            +     D   P+ 
Sbjct: 331 ERELMDAVYAVLNRVRHWPEPPPGTIGEFGAFADIGAPKA 370


>gi|170748096|ref|YP_001754356.1| chemotaxis protein [Methylobacterium radiotolerans JCM 2831]
 gi|170654618|gb|ACB23673.1| putative chemotaxis protein precursor [Methylobacterium
           radiotolerans JCM 2831]
          Length = 415

 Score =  286 bits (732), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 78/369 (21%), Positives = 146/369 (39%), Gaps = 8/369 (2%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           P Q VR+LQ   D    G ++  +  P ++      L A   +++    N+ +   + + 
Sbjct: 48  PVQWVRTLQLLQDRVAAGSLAAHESQPLLIARINADLLAAPPEIWGRRNNLRSAITFALS 107

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
               +V+  L A+D  G  +  +      Y  G+  E+ + L  +   D    +   + L
Sbjct: 108 GGGPAVLRRLTARDGLGEPEATLARGALAYLEGREAEARRLLQDVDTTDLPPTLAGAVGL 167

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLE-ITQNEVGERAFGYIRAYVT 210
                 +     +A+   D VR+  PGT  EE ALR  +  + Q    +        Y+ 
Sbjct: 168 TQASLAVTDQPARAIGLLDRVRVLLPGTLAEEGALRREIFTLGQIGDLKTFEALAIQYLR 227

Query: 211 QFHHSIYKDHFISVL---LRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVIS 267
           +F HS+Y  +F   L   L  F  G  +     +   +S    E +R +YL +AQ ++ +
Sbjct: 228 RFPHSVYAGNFRQRLAYQLTQFDIGHDEGRFGTLNRILSELRPESRRDLYLLVAQTAIQA 287

Query: 268 GKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILN-IPFVDIMSLQRSTCNIPYYSLME 326
           GK      A ++   +       +    QLY      +      S  R+  ++    L  
Sbjct: 288 GKTAAALRASEKALALCAP-GSAEATQGQLYRAAAEIVNLATFQSGLRTLRSLDRAKLTA 346

Query: 327 QDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIE 386
           +D+ L + +      IG+ L       + +   L K      + + G  S I K ++ I+
Sbjct: 347 RDQLLLETALSTAGAIGRGL--AGRSGLPEADSLSKPARAARDPADGPASLIPKAQATID 404

Query: 387 SIDVLLAEA 395
            ID++L++A
Sbjct: 405 RIDLMLSKA 413


>gi|217976236|ref|YP_002360383.1| chemotaxis protein [Methylocella silvestris BL2]
 gi|217501612|gb|ACK49021.1| chemotaxis protein [Methylocella silvestris BL2]
          Length = 403

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 83/397 (20%), Positives = 148/397 (37%), Gaps = 21/397 (5%)

Query: 5   YLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKET 64
           +L     VA D   +     D    + P++ VR++    D  + GD + + K+P ++ + 
Sbjct: 14  WLFQGFAVAQDGHSAAPQGGD----VRPFELVRTVAALQDRIVMGDAAAKAKLPLLISQI 69

Query: 65  GVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSG 124
             +L A    V+ + RN  A+  YT+      V+  ++      + +  ++     Y  G
Sbjct: 70  SDRLFACGAAVWAEARNDHAIVAYTLSGGQPRVIRKVLQTGAVPHAEADLMAGALAYAEG 129

Query: 125 QLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEI 184
           Q  ++ + L  I+       +   + L     +     ++A    D  R+ +PGT +EE 
Sbjct: 130 QEAKAKQILLPIEATKLPPSVGGLVALAQAALLSKIDPRRAARLLDEARILAPGTLVEEA 189

Query: 185 ALRNLLEITQN-EVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKL---PDED 240
           ALR    +       +R       Y  ++  S+Y + F        +   LK    P   
Sbjct: 190 ALRRSALLADEVADFDRFINASSQYFRRYSKSLYANDFRRRFAESIVRFGLKDEPGPSAR 249

Query: 241 IVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYEN 300
           +   +S      Q  +YL IAQ  V +GK      A ++   +         +  QLY  
Sbjct: 250 LTGLLSELDRPYQAELYLIIAQAGVRNGKIGPAKAAAEKALSL-SEQGGAARSRAQLYAA 308

Query: 301 ILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLL 360
           I  +  V           I    L   DR LK A   + ++I +S    D    Q    +
Sbjct: 309 IAKVLIVSPAEGLTELAQIDDAVLPRGDRDLKSAVAQLATQIQRS---ADGGQAQDASSI 365

Query: 361 DK-----KEPRHTNVSMGIESFIKKNRSQIESIDVLL 392
           D+      E    N SM     I+  ++ ++  D LL
Sbjct: 366 DRAPGSGGESHDANGSM----LIQSAQAALQQTDALL 398


>gi|90418367|ref|ZP_01226279.1| putative chemotaxis protein motC [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90338039|gb|EAS51690.1| putative chemotaxis protein motC [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 420

 Score =  283 bits (723), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 67/345 (19%), Positives = 142/345 (41%), Gaps = 5/345 (1%)

Query: 27  VRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
            R  +PY+ VRS+Q   D+  RG+ +  +    +++  G        +V+ D RN+ A  
Sbjct: 56  ERAPMPYEIVRSVQFLQDQVARGNGAAIRVQAQLLRRYGPTFLEQPPEVWTDPRNLRAAA 115

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIV 146
           ++ +     +V+  +++  T    + A++     Y   +  ++   L  I   +    + 
Sbjct: 116 LFVLSGGPPAVLRGILSTATIDGDERALLDGALAYVENRARDARAALVPIDVSEMDTALA 175

Query: 147 PYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYI 205
             L+L + + +   +   A+H  + V L +PGT LEE ALR  + + ++      A  Y 
Sbjct: 176 AQLNLAVAQLLQKDAPADALHRLEQVMLAAPGTLLEEAALRMGVLLAEDIGSHAAADRYA 235

Query: 206 RAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFT---ISFFSLEEQRAIYLKIAQ 262
           R Y  +F  S Y  +F +     +     +  DE +       +    +++ AI+L +A+
Sbjct: 236 RQYFDRFADSAYAGNFRARFSAVYAARPAETKDETVATIDNATARIPDDQRLAIFLAVAR 295

Query: 263 NSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYY 322
            +++ G   +      +           D     LY+    +   D +  + +   I   
Sbjct: 296 RALVGGNLPLAAAMATEALE-SGNAVPADSQRALLYKTAATLTTGDPVEARVALEAIDVA 354

Query: 323 SLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRH 367
           +L   DR L +A+  ++SE+ K L+  + +  ++       E   
Sbjct: 355 TLHPADRKLHEAAYEVLSEMRKPLMAANIDPAERYGPQPPAEQSA 399


>gi|158422248|ref|YP_001523540.1| chemotaxis protein MotC [Azorhizobium caulinodans ORS 571]
 gi|158329137|dbj|BAF86622.1| hypothetical MotC chemotaxis protein [Azorhizobium caulinodans ORS
           571]
          Length = 872

 Score =  282 bits (721), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 63/353 (17%), Positives = 133/353 (37%), Gaps = 6/353 (1%)

Query: 25  DLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDA 84
           +     +PY+ VR LQR  D    GD +  +    ++ E           V+ D RN  A
Sbjct: 388 ERSTGPLPYEQVRRLQRLQDRIATGDTAALQAQRALIAEIEDAFHKADPKVWQDPRNARA 447

Query: 85  VWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRG 144
             ++ +       + +L++       D  ++     Y  G+ E++ + L+ I        
Sbjct: 448 AVVFFLSGGSPKELRNLLSLKPAPAIDERLLQGALAYVEGRPEDAERYLANINPLQLPDA 507

Query: 145 IVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAFG- 203
           +   + ++     +    ++A+   D  RL  PGT +EE ALR  + +         F  
Sbjct: 508 LGGQIAMVQAAVTVGKDPRKAMAQLDIARLVMPGTLVEEAALRREILVAAQLGELNKFEH 567

Query: 204 YIRAYVTQFHHSIYKDHFISVLLRFFLHGQ---LKLPDEDIVFTISFFSLEEQRAIYLKI 260
             + Y+ +F HS+Y  +F                +   + +V  +     + +  IYL +
Sbjct: 568 LSKQYLYRFRHSVYAGNFRQRFAAALTRMAFVNDRDQFQRLVSLLQPLDRDSRVDIYLMV 627

Query: 261 AQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILN-IPFVDIMSLQRSTCNI 319
           A+ ++  GK     LA +++    D +   D    ++Y+  +N     ++ +      +I
Sbjct: 628 ARGALNQGKFTAASLASERVLVDADPV-STDAERARVYKAAVNAASSKEVDAAVVELKSI 686

Query: 320 PYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSM 372
               L   D  L  A+      +  +   +    ++  + +D  +  HT  + 
Sbjct: 687 IRSRLPPDDVMLLNAALTTAELVRSAGETVKQAAVKPQVKVDPMQVTHTAGTA 739


>gi|218509334|ref|ZP_03507212.1| chemotaxis protein [Rhizobium etli Brasil 5]
          Length = 217

 Score =  276 bits (705), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 64/217 (29%), Positives = 110/217 (50%), Gaps = 1/217 (0%)

Query: 56  KIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIV 115
               ++     +LR     ++ D+RN+DA  IY +   +   ++ LIA D  GYFD  + 
Sbjct: 1   MQRFMLGTIDERLRTADTSIYDDDRNVDAALIYAMSGGNPQTLEYLIAHDVNGYFDNRVT 60

Query: 116 YALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLT 175
             L+KY SG+    +K L +   +   + I PYL L+ G  ++      A+  +D  RL 
Sbjct: 61  DVLRKYLSGKGLLVAKTLEETAREYRDKKIGPYLALIGGNVLIATKPTDALDLYDQARLA 120

Query: 176 SPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQL 234
           +PGT +EE ALR  + I  ++ + ++   Y + Y  +F HS Y   F  + ++  +    
Sbjct: 121 APGTIVEEAALRRSVAICVDKGLLDKGLAYSQRYARRFLHSPYASQFADLFVKLVVAHDR 180

Query: 235 KLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRK 271
            +  +D+V  +SF     QR +YL+IA+ + ISGK +
Sbjct: 181 DVRPQDVVDILSFMDAPRQREVYLRIARAAAISGKPE 217


>gi|118589970|ref|ZP_01547374.1| probable chemotaxis protein precursor [Stappia aggregata IAM 12614]
 gi|118437467|gb|EAV44104.1| probable chemotaxis protein precursor [Stappia aggregata IAM 12614]
          Length = 411

 Score =  275 bits (704), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 58/370 (15%), Positives = 135/370 (36%), Gaps = 9/370 (2%)

Query: 6   LICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETG 65
           +     VA                  PY+ +RSLQ   ++  +G+    +    ++ +  
Sbjct: 16  IALVAAVASVSAGWAQQVGKETSVPQPYEMIRSLQSLQEQISQGNTHALQAQRALLTKMD 75

Query: 66  VQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQ 125
                   +V+ + RN  A  ++ +      V+  L++ D     D  ++ A   Y  G+
Sbjct: 76  AHFVVLQAEVWQEPRNARAAVVHLLSGGHPDVMRYLLSLDPAPAVDRKLMEASLAYVEGR 135

Query: 126 LEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIA 185
            EE    L+ I   +    +  ++ L+     +    ++A+       L  PGT +EE A
Sbjct: 136 EEEMQVLLADIDPLELPASLGGHVALVKAAPYIRTDPEKAMELLQVASLLMPGTLVEEAA 195

Query: 186 LRNLLEIT-QNEVGERAFGYIRAYVTQFHHSIYKDHFISVL-----LRFFLHGQLKLPDE 239
           LR  + +       +R       Y+ +F  S+Y   F            F+  + K    
Sbjct: 196 LRREVFLAGMTANVDRFRVLSIRYLRRFRASVYSGDFRRRFALSLDTLGFVKSEDKFAL- 254

Query: 240 DIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYE 299
            +   +  F  + +R +YL++A++++++G   +   A  +   +      K+   +++Y 
Sbjct: 255 -LDDVLHEFDADSRRGLYLRLARSALLAGHLNVARKATGEALTLTVE-GTKENEILKIYL 312

Query: 300 NILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLL 359
               +    I + +    +I    L  QD  +     ++++ +            + ++ 
Sbjct: 313 AATRLDPEFITANRDLLWSIDKSILTAQDLAMLDGVYVVLNSVRHFPEPPPNVIGEFNVA 372

Query: 360 LDKKEPRHTN 369
            +   P   +
Sbjct: 373 SNMDAPEDQS 382


>gi|90422621|ref|YP_530991.1| chemotaxis protein [Rhodopseudomonas palustris BisB18]
 gi|90104635|gb|ABD86672.1| putative chemotaxis protein precursor [Rhodopseudomonas palustris
           BisB18]
          Length = 396

 Score =  275 bits (703), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 75/324 (23%), Positives = 135/324 (41%), Gaps = 5/324 (1%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           PYQ VRSLQ   D+  RG++        ++K+ G Q +    +++ D+RN  A   + + 
Sbjct: 30  PYQLVRSLQSLQDDIARGNLDAHNAQRGLLKQLGEQFQQADPNLWKDSRNARAAVTFLLS 89

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
             D  VV  L ++D     D AI+     Y  G+ +E+ + L  ++ +     +   + L
Sbjct: 90  GGDPQVVHALRSRDLLS-LDAAILDGAMAYIEGRPDEARERLGGVRARSLPAALGAEIAL 148

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEIT-QNEVGERAFGYIRAYVT 210
           +    +     + ++   D VRL  PGT +EE ALR  + +  Q +  ++       Y  
Sbjct: 149 VQSALLAKSDVKASIDRLDEVRLLMPGTLVEEAALRREIFLVGQADDFDKFEFLATRYFR 208

Query: 211 QFHHSIYKDHFISVLLRFFLH---GQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVIS 267
           ++ HSIY  +F              Q       +V  +       QRA+YL IA+ +++ 
Sbjct: 209 RYRHSIYAGNFRQRFALSVARFSFAQQTARFPRLVGVLDHLDGASQRALYLLIARTALVR 268

Query: 268 GKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQ 327
           GK ++  LA +++  + +  D       +LY     +              I    L EQ
Sbjct: 269 GKTEMTVLAAERVLALTEDEDSPARGRAELYRAAARLVTSGHAQALEDLQQIDAGRLPEQ 328

Query: 328 DRYLKKASEIIMSEIGKSLIDIDF 351
           D  L  A+  +   + K+L  +  
Sbjct: 329 DAELLAAALKLGRTVRKALPTVSA 352


>gi|161511088|ref|NP_773501.2| chemotaxis protein [Bradyrhizobium japonicum USDA 110]
          Length = 397

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 70/370 (18%), Positives = 140/370 (37%), Gaps = 12/370 (3%)

Query: 31  VPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTI 90
            PY+ VR+LQ   D    GD +       ++++ G +  A    V+ + +N  AV IY +
Sbjct: 35  EPYELVRALQAVQDGIANGDTAAHGSHIALIRQIGEKFLAADASVWSNAQNGQAVVIYLL 94

Query: 91  ISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLH 150
                 +V  L  +D K   D  +      Y  G+ +E+ + L  +K +    G+   + 
Sbjct: 95  SGGAPQLVRKL-PRD-KMNVDARLFDGALAYVEGRQDEARELLKDVKPRTIPSGLGGQVA 152

Query: 151 LLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEIT-QNEVGERAFGYIRAYV 209
           L+ G       +  A+   D  RL  PGT +EE ALR  + +  Q E  ++      AY+
Sbjct: 153 LVQGALFARTEASLAIERLDDARLLLPGTLVEEAALRREILLVGQAEDFDKFEFLTLAYI 212

Query: 210 TQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFF---SLEEQRAIYLKIAQNSVI 266
             + +SIY   F            L L +      ++         +  +YL IA+++++
Sbjct: 213 RHYRNSIYAGDFWQRFSTGLTQSSLALDERRFARIVTMLEQIDRGSRLKLYLVIARSAMV 272

Query: 267 SGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLME 326
            G+  +  LA ++   +       +      +     +   +          +    L E
Sbjct: 273 RGRMAVTRLAGERALTLSADA-SAERERAHFFRGASRVLTDEYDGGLAELKALDRSKLPE 331

Query: 327 QDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIE 386
           +D  L  A+  +  ++ K           K        P   +++    +   + R ++ 
Sbjct: 332 RDLPLLNATVQLALDVRKPFASGSAATADK----PPATPARLDLASSTATL-ARARKELG 386

Query: 387 SIDVLLAEAR 396
            +++L  + R
Sbjct: 387 ELELLTRDRR 396


>gi|27355142|dbj|BAC52126.1| motC [Bradyrhizobium japonicum USDA 110]
          Length = 386

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 70/370 (18%), Positives = 140/370 (37%), Gaps = 12/370 (3%)

Query: 31  VPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTI 90
            PY+ VR+LQ   D    GD +       ++++ G +  A    V+ + +N  AV IY +
Sbjct: 24  EPYELVRALQAVQDGIANGDTAAHGSHIALIRQIGEKFLAADASVWSNAQNGQAVVIYLL 83

Query: 91  ISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLH 150
                 +V  L  +D K   D  +      Y  G+ +E+ + L  +K +    G+   + 
Sbjct: 84  SGGAPQLVRKL-PRD-KMNVDARLFDGALAYVEGRQDEARELLKDVKPRTIPSGLGGQVA 141

Query: 151 LLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEIT-QNEVGERAFGYIRAYV 209
           L+ G       +  A+   D  RL  PGT +EE ALR  + +  Q E  ++      AY+
Sbjct: 142 LVQGALFARTEASLAIERLDDARLLLPGTLVEEAALRREILLVGQAEDFDKFEFLTLAYI 201

Query: 210 TQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFF---SLEEQRAIYLKIAQNSVI 266
             + +SIY   F            L L +      ++         +  +YL IA+++++
Sbjct: 202 RHYRNSIYAGDFWQRFSTGLTQSSLALDERRFARIVTMLEQIDRGSRLKLYLVIARSAMV 261

Query: 267 SGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLME 326
            G+  +  LA ++   +       +      +     +   +          +    L E
Sbjct: 262 RGRMAVTRLAGERALTLSADA-SAERERAHFFRGASRVLTDEYDGGLAELKALDRSKLPE 320

Query: 327 QDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIE 386
           +D  L  A+  +  ++ K           K        P   +++    +   + R ++ 
Sbjct: 321 RDLPLLNATVQLALDVRKPFASGSAATADK----PPATPARLDLASSTATL-ARARKELG 375

Query: 387 SIDVLLAEAR 396
            +++L  + R
Sbjct: 376 ELELLTRDRR 385


>gi|182679601|ref|YP_001833747.1| putative chemotaxis protein precursor [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182635484|gb|ACB96258.1| putative chemotaxis protein precursor [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 420

 Score =  269 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 73/362 (20%), Positives = 140/362 (38%), Gaps = 10/362 (2%)

Query: 29  TIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIY 88
              P + VRS+    D+ + G   ++  +P I+ +    L A + DV+ D +NI+A+  Y
Sbjct: 54  ERSPVEIVRSIMTLQDQVVSGKKPVETAMPKIMSQMADHLLAQNPDVWKDPKNIEALITY 113

Query: 89  TIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPY 148
            +      V   ++  DT       ++ A+  Y +G    +   L+ +  +  +  +  +
Sbjct: 114 LLSGGQSRVAKKILEIDTLPSEQRNLLEAVYAYITGHKTRAENLLATVDPQTLSALLGAH 173

Query: 149 LHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEIT--QNEVGERAFGYIR 206
           + L+    +      +A+ + D  R+ +PGT +EE ALR  + +    N++ +  F   R
Sbjct: 174 VALIKALLVAESDPAKAISYLDTARILAPGTLIEEAALRREIFLADSANKLSKFVF-LSR 232

Query: 207 AYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIV---FTISFFSLEEQRAIYLKIAQN 263
            Y+ +FH+S+Y D+F        +H  L    E +      I+     EQ  IYL IA  
Sbjct: 233 QYIRRFHNSVYFDNFYKHFSAAIIHLGLADNVEQVAKLDDLIAEMKPGEQARIYLAIAYK 292

Query: 264 SVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYS 323
           S+I+G+  +    + +   +            +LY+  ++           +   +   +
Sbjct: 293 SLINGRLPVASFVLAKASALTRETSSTPD-QYKLYQASVDFLAGHAEKGLNTISQLDESN 351

Query: 324 LMEQDRYLKKASEIIMSEIGK---SLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKK 380
           L   D  L      I   I             H Q D  L   +       +   S    
Sbjct: 352 LTALDISLAHTILEIGGAIQSLDHESHSAQHAHAQPDASLVDHDDIQDLGELATRSIEAT 411

Query: 381 NR 382
           +R
Sbjct: 412 DR 413


>gi|254502667|ref|ZP_05114818.1| hypothetical protein SADFL11_2706 [Labrenzia alexandrii DFL-11]
 gi|222438738|gb|EEE45417.1| hypothetical protein SADFL11_2706 [Labrenzia alexandrii DFL-11]
          Length = 399

 Score =  266 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 60/339 (17%), Positives = 130/339 (38%), Gaps = 11/339 (3%)

Query: 20  FATDQDLVR--TIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFV 77
           F  DQ +    T  P++ VR+LQ A ++   G+ S       ++ +         ++ + 
Sbjct: 17  FFADQAMANQATKEPFEMVRALQSAQEQVASGNDSAAAMQRALLAKMDEIFLQLPLEAWQ 76

Query: 78  DNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIK 137
           D RN  A  I+ +   +  VV  L+        D+ ++ A   Y  G+ E+    L+ + 
Sbjct: 77  DPRNARASVIHLLSGGNPEVVRHLLTLTPAPVIDLNLMEASLAYVEGREEDMLTRLADVD 136

Query: 138 DKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEIT-QNE 196
                  +  ++ L+     +     +A+       L  PGT +EE ALR  + +     
Sbjct: 137 PLTLPPSLGGHIALVKAVPYIQTDPVRAMELLQIASLLMPGTLVEEAALRREVLVAGLVG 196

Query: 197 VGERAFGYIRAYVTQFHHSIYKDHFISVL-----LRFFLHGQLKLPDEDIVFTISFFSLE 251
             ER       Y+ ++  S+Y   F            F+  Q K     +   +  F  +
Sbjct: 197 DIERFRTLSIRYLRRYRASVYSGDFRRRFAIALDTLGFVEDQDKFDL--LYGVLEEFEDD 254

Query: 252 EQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMS 311
            +R +Y+++A+++++ G  +I   A  Q + +       +   +++Y+    +    +  
Sbjct: 255 SRRGLYMRLARSALLGGNLQIASKATDQAQMLA-VAGTAEYELLKIYQVATRLNREAVKP 313

Query: 312 LQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDID 350
            +    ++   +L  +D     A   +++ I       D
Sbjct: 314 NRDLLWSVNKAALTPEDLDFLYAVNTVLNSIRHFPDPPD 352


>gi|114705810|ref|ZP_01438713.1| probable chemotaxis protein precursor [Fulvimarina pelagi HTCC2506]
 gi|114538656|gb|EAU41777.1| probable chemotaxis protein precursor [Fulvimarina pelagi HTCC2506]
          Length = 458

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 72/341 (21%), Positives = 146/341 (42%), Gaps = 6/341 (1%)

Query: 27  VRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVW 86
            R  +P++ +RSLQ   D+A RG+ +  +    +++  G  L A   DV+ D RN+ AV 
Sbjct: 99  EREPMPFEVIRSLQYLQDQAARGNKAALQVQRRLLRRFGPSLSARSSDVWTDKRNVRAVV 158

Query: 87  IYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIV 146
           ++ +     + + +L            ++  +  Y   +++E+  +LS I          
Sbjct: 159 LFVLSGGPSAPLSELYRAGVFEEKHRPLIEGVLAYADNRMDEAEAKLSTIDLSREETIFA 218

Query: 147 PYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYI 205
             + L + +         ++   + V L +PGT L+E ALR  + + +N    E+A  Y 
Sbjct: 219 AQVRLALAQLREAEDPAGSLMLLEQVMLAAPGTLLDEAALRLGVLLAENAGETEKADRYA 278

Query: 206 RAYVTQFHHSIYKDHFISVLLRFF---LHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQ 262
           R Y  ++  S+Y  +F +     +     G  +   + +  T+     +++ A+YL +A+
Sbjct: 279 RQYFDRYAASVYAGNFRTRFSAVYSDRPKGSEEATLDTLAGTLRLLPDDQKLAMYLSVAR 338

Query: 263 NSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYY 322
            +++ G  ++   A ++   I +  D  D     LYE    +  +D   +  +   I   
Sbjct: 339 RALVGGNLELAAEASREALTI-EAADPADRQRALLYEVASTLSALDEGEILATLGAIEDE 397

Query: 323 SLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKK 363
            L   D  LK+A+  ++  I +   +I       D  LD +
Sbjct: 398 QLHPSDLALKEAALDVVDAI-REPAEISASAGNTDPALDNQ 437


>gi|188579879|ref|YP_001923324.1| chemotaxis protein [Methylobacterium populi BJ001]
 gi|179343377|gb|ACB78789.1| putative chemotaxis protein precursor [Methylobacterium populi
           BJ001]
          Length = 429

 Score =  226 bits (577), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 56/317 (17%), Positives = 111/317 (35%), Gaps = 6/317 (1%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           P +  R+LQ   D   RG          ++     +L     + + +  N+ A   + + 
Sbjct: 67  PVELTRTLQLLQDRIARGSTQAHLAQRQLLGHIEQRLIELDPEAWAEAENVRAAVTFALA 126

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
               + +  L+        +  +      Y  G+  E+  +L+ I  +    G+   L L
Sbjct: 127 GGGPAALRVLLKSGKAPEAEQPLALGALAYLEGREREARAKLAGIDPRTMPAGLAGQLAL 186

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLE-ITQNEVGERAFGYIRAYVT 210
                M+  +  +++   D  RL +PGT +EE ALR  +  + Q     R       Y+ 
Sbjct: 187 TQSALMVREAPAKSLELLDLARLLAPGTLVEEGALRRQIFVVAQGGDARRFEALAIQYLR 246

Query: 211 QFHHSIYKDHFISVLLRFFLHGQ---LKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVIS 267
           +F  S+Y  +F                +     +   +     E +R +YL +A+  +  
Sbjct: 247 RFRRSVYAGNFRQRFAGALTRLDFDSDRTRIASLERMLDEIEPESRRDLYLLVARAGLEQ 306

Query: 268 GKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVD-IMSLQRSTCNIPYYSLME 326
           G+R+    A ++   +    D +  A  +LY     I           +  ++    L  
Sbjct: 307 GRRETALFAAERAMGLAAP-DSRPAAQARLYRGAALIVADGRFEEGTETLRSLDRADLAA 365

Query: 327 QDRYLKKASEIIMSEIG 343
            D  L  A+     +I 
Sbjct: 366 PDAELLDAALSTARQIR 382


>gi|218528677|ref|YP_002419493.1| chemotaxis protein [Methylobacterium chloromethanicum CM4]
 gi|218520980|gb|ACK81565.1| chemotaxis protein [Methylobacterium chloromethanicum CM4]
          Length = 460

 Score =  225 bits (573), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 54/325 (16%), Positives = 111/325 (34%), Gaps = 6/325 (1%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           P +  R+LQ   D   RG          ++     +L A   + + +  N+ A   + + 
Sbjct: 98  PVELTRTLQLLQDRIARGSTQAHLAQRQLLGHIEQRLIALDPESWAEAENVRAAVTFALA 157

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
                 +  ++        +  +      Y  G+  E+  +L+ I  +    G+   L L
Sbjct: 158 GGGPGALRVILRSGKVPETEQPLALGALAYLEGREREARAKLAGIDPRTMPAGLAGQLAL 217

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLE-ITQNEVGERAFGYIRAYVT 210
                M+  +  +++   D  RL +PGT +EE ALR  +  + Q     R       Y+ 
Sbjct: 218 TQSALMVRDAPVKSLELLDLARLLAPGTLVEEGALRRQIFVVAQGGDARRFEALAIQYLR 277

Query: 211 QFHHSIYKDHFISVLLRFFLHGQ---LKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVIS 267
           +F  S+Y  +F                +     +   +     E +R +YL +A+  +  
Sbjct: 278 RFRRSVYAGNFRQRFAGALTRLDFDSDRTRIASLERMLDEIEPEGRRDLYLLVARAGLEQ 337

Query: 268 GKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVD-IMSLQRSTCNIPYYSLME 326
           G+R+    + ++   +    D +  A  +LY     I           +   +     + 
Sbjct: 338 GRRETALFSAERAMGLAAP-DSQPAAQARLYRGAALIVADGRFEEGYEALRGLERADFVP 396

Query: 327 QDRYLKKASEIIMSEIGKSLIDIDF 351
            D  L  A+     +I       + 
Sbjct: 397 TDAELLDAALSTARQIRTPSAVAEA 421


>gi|240137208|ref|YP_002961677.1| chemotaxis protein MotC [Methylobacterium extorquens AM1]
 gi|240007174|gb|ACS38400.1| chemotaxis protein MotC [Methylobacterium extorquens AM1]
          Length = 459

 Score =  222 bits (566), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 54/328 (16%), Positives = 111/328 (33%), Gaps = 6/328 (1%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           P +  R+LQ   D   RG          ++     +L A   + + +  N+ A   + + 
Sbjct: 97  PVELTRTLQLLQDRIARGSTQAHLAQRQLLGHIEQRLIALDPESWAEAENVRAAVTFALA 156

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
                 +  ++        +  +      Y  G+  E+  +L+ I  +    G+   L L
Sbjct: 157 GGGPGALRVILRSGKVPEAEQPLALGALAYLEGREREARAKLAGIDPRTMPAGLAGQLAL 216

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLE-ITQNEVGERAFGYIRAYVT 210
                M+  +  +++   D  RL +PGT +EE ALR  +  + Q     R       Y+ 
Sbjct: 217 TQSALMVRDAPVKSLELLDLARLLAPGTLVEEGALRRQIFVVAQGGDARRFEALAIQYLR 276

Query: 211 QFHHSIYKDHFISVLLRFFLHGQ---LKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVIS 267
           +F  S+Y  +F                +     +   +     E +R +YL +A+  +  
Sbjct: 277 RFRRSVYAGNFRQRFAGALTRLDFDSDRTRIASLERMLDEIEPEGRRDLYLLVARAGLEQ 336

Query: 268 GKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVD-IMSLQRSTCNIPYYSLME 326
           G+R+    + ++   +    D +  A  +LY     I           +   +     + 
Sbjct: 337 GRRETALFSAERAMGLAAP-DSQPAAQARLYRGAALIVADGRFEEGYEALRGLDRTDFIP 395

Query: 327 QDRYLKKASEIIMSEIGKSLIDIDFEHI 354
            D  L  A+     +I       +    
Sbjct: 396 TDAELLDAALSTARQIRTPSAVAEAAAT 423


>gi|163850074|ref|YP_001638117.1| chemotaxis protein [Methylobacterium extorquens PA1]
 gi|163661679|gb|ABY29046.1| putative chemotaxis protein precursor [Methylobacterium extorquens
           PA1]
          Length = 460

 Score =  220 bits (561), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 54/328 (16%), Positives = 111/328 (33%), Gaps = 6/328 (1%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           P +  R+LQ   D   RG          ++     +L A   + + +  N+ A   + + 
Sbjct: 98  PVELTRTLQLLQDRIARGSTQAHLAQRQLLGHIEQRLIALDPESWAEAENVRAAVTFALA 157

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
                 +  ++        +  +      Y  G+  E+  +L+ I  +    G+   L L
Sbjct: 158 GGGPGALRVILRSGKVPEAEQPLALGALAYLEGREREARAKLAGIDPRTMPAGLAGQLAL 217

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLE-ITQNEVGERAFGYIRAYVT 210
                M+  +  +++   D  RL +PGT +EE ALR  +  + Q     R       Y+ 
Sbjct: 218 TQSALMVRDAPVKSLELLDLARLLAPGTLVEEGALRRQIFVVAQGGDARRFEALAIQYLR 277

Query: 211 QFHHSIYKDHFISVLLRFFLHGQ---LKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVIS 267
           +F  S+Y  +F                +     +   +     E +R +YL +A+  +  
Sbjct: 278 RFRRSVYAGNFRQRFAGALTRLDFDSDRTRIASLERMLDEIEPEGRRDLYLLVARAGLEQ 337

Query: 268 GKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVD-IMSLQRSTCNIPYYSLME 326
           G+R+    + ++   +    D +  A  +LY     I           +   +     + 
Sbjct: 338 GRRETALFSAERAMGLAAP-DSQPAAQARLYRGAALIVADGRFEEGYEALRGLDRTDFVP 396

Query: 327 QDRYLKKASEIIMSEIGKSLIDIDFEHI 354
            D  L  A+     +I       +    
Sbjct: 397 TDAELLDAALSTARQIRTPSAVAEAAAT 424


>gi|254559219|ref|YP_003066314.1| chemotaxis protein MotC [Methylobacterium extorquens DM4]
 gi|254266497|emb|CAX22261.1| chemotaxis protein MotC [Methylobacterium extorquens DM4]
          Length = 459

 Score =  220 bits (561), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 54/328 (16%), Positives = 111/328 (33%), Gaps = 6/328 (1%)

Query: 32  PYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTII 91
           P +  R+LQ   D   RG          ++     +L A   + + +  N+ A   + + 
Sbjct: 97  PVELTRTLQLLQDRIARGSTQAHLAQRQLLGHIEQRLIALDPETWAEAENVRAAVTFALA 156

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
                 +  ++        +  +      Y  G+  E+  +L+ I  +    G+   L L
Sbjct: 157 GGGPGALRVILRSGKVPEAEQPLALGALAYLEGREREARAKLAGIDPRTMPAGLAGQLAL 216

Query: 152 LIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLE-ITQNEVGERAFGYIRAYVT 210
                M+  +  +++   D  RL +PGT +EE ALR  +  + Q     R       Y+ 
Sbjct: 217 TQSALMVRDAPVKSLELLDLARLLAPGTLVEEGALRRQIFVVAQGGDARRFEALAIQYLR 276

Query: 211 QFHHSIYKDHFISVLLRFFLHGQ---LKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVIS 267
           +F  S+Y  +F                +     +   +     E +R +YL +A+  +  
Sbjct: 277 RFRRSVYAGNFRQRFAGALTRLDFDSDRTRIASLERMLDEIEPEGRRDLYLLVARAGLEQ 336

Query: 268 GKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVD-IMSLQRSTCNIPYYSLME 326
           G+R+    + ++   +    D +  A  +LY     I           +   +     + 
Sbjct: 337 GRRETALFSAERAMGLAAP-DSQPSAQARLYRGAALIVADGRFEEGYEALRGLDRTDFVP 395

Query: 327 QDRYLKKASEIIMSEIGKSLIDIDFEHI 354
            D  L  A+     +I       +    
Sbjct: 396 TDAELLDAALSTARQIRTPSAIAEAAAT 423


>gi|170741407|ref|YP_001770062.1| chemotaxis protein [Methylobacterium sp. 4-46]
 gi|168195681|gb|ACA17628.1| putative chemotaxis protein precursor [Methylobacterium sp. 4-46]
          Length = 445

 Score =  217 bits (552), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 63/369 (17%), Positives = 133/369 (36%), Gaps = 14/369 (3%)

Query: 33  YQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIIS 92
            + VR+LQ   D   RG          ++     +L     + +    N+ A   + +  
Sbjct: 85  VELVRTLQLLQDRIARGGTQAHLAQRQLIAHIEQRLIGLEPETWGKPANVQAAVTFALAG 144

Query: 93  QDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLL 152
               V+  +I   +    +  ++     +  G+  ++   L+K+  +     +   + L 
Sbjct: 145 GGPGVLRRVIEAGSLPDSEAPLLQGALAFLEGRERDARTVLTKLDAQTLPASLGGQVALA 204

Query: 153 IGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLE-ITQNEVGERAFGYIRAYVTQ 211
               ++  +  QA+   D  RL +PGT +EE ALR  +  + Q     R       Y+ +
Sbjct: 205 QSALVVRENPDQALRLLDLARLLAPGTLVEEGALRREVFVLAQAGNIPRFEALSIQYLRR 264

Query: 212 FHHSIYKDHFISVLLRFFLH---GQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISG 268
           F HS+Y  +F             G   +    +   ++    E +  +YL +A+ +V  G
Sbjct: 265 FRHSVYAGNFRQRFAAALTRLKYGDDPVRIGRLEAMLAEIEPEGRGDLYLLVARAAVEQG 324

Query: 269 KRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRS-TCNIPYYSLMEQ 327
           + +    A  +   +++    +  A  +LY     I   D      +   ++   +L   
Sbjct: 325 EMRAAVFAANRAAALVEAGSVR-AAQARLYRAAAAIATPDGFDGAYAVLRSLDRAALPSA 383

Query: 328 DRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIES 387
           D  L  A+    ++I + L        ++     +  P+           I + +  IE 
Sbjct: 384 DAGLLDAALSTAAQIRRDLPPAPATPPEEAADGKRPVPQAKT--------IARAQEAIEQ 435

Query: 388 IDVLLAEAR 396
           ID ++   R
Sbjct: 436 IDDMMRRTR 444


>gi|323139664|ref|ZP_08074706.1| chemotaxis protein [Methylocystis sp. ATCC 49242]
 gi|322395096|gb|EFX97655.1| chemotaxis protein [Methylocystis sp. ATCC 49242]
          Length = 386

 Score =  180 bits (456), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 57/362 (15%), Positives = 134/362 (37%), Gaps = 14/362 (3%)

Query: 35  CVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQD 94
            VR L    +  + GD   ++ +          +     + + + +N+ A  IY +    
Sbjct: 29  MVRDLNGMQNRMVMGDEKARENVARQFDLIERTIMTLEPETWTEEKNVRAAAIYLLCGGA 88

Query: 95  LSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIG 154
            + + ++            ++ A  +Y  GQ +E++ +L     +     +  +L L+ G
Sbjct: 89  PTNLREIFDAKFVSDELSPLLEAALRYAEGQ-DEAAAKLMDFDARHFPPILGGHLALVQG 147

Query: 155 RAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLL-EITQNEVGERAFGYIRAYVTQFH 213
            +++   + +A+   D  RL  P + +EE ALR  +  +      ++    +  YV ++ 
Sbjct: 148 GSVIGSDNARAIALLDLARLLMPASLVEEAALRREIRAVDPETDADKVSALVNRYVAKYT 207

Query: 214 HSIYKDHFISVLLRFFLHGQLKLPDE---DIVFTISFFSLEEQRAIYLKIAQNSVISGKR 270
            S Y  +F + L        +    E        I   S +++  IYL +++ ++++G+ 
Sbjct: 208 ASPYAQNFWTELRSIVFSPSINADAELLAKFEGAIEKASTDQRLDIYLLLSRRAILNGRL 267

Query: 271 KIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRY 330
                 + + ++  D  + +    I  Y NI+        S   +  +    +L  +D  
Sbjct: 268 GEAASKLDKAEQAAD--NPQAHKRIVTYRNIVKSLSKGDASSASNLQDTDLSALTREDSE 325

Query: 331 LKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIESIDV 390
           + K +  +++ + K           +  +           +      I   R  +E  D 
Sbjct: 326 MLKIASGVLARLEKPA------ETDRHAIGASAAAPEVTANDEP-PIIASARVALEKSDE 378

Query: 391 LL 392
           LL
Sbjct: 379 LL 380


>gi|296447980|ref|ZP_06889886.1| chemotaxis protein [Methylosinus trichosporium OB3b]
 gi|296254490|gb|EFH01611.1| chemotaxis protein [Methylosinus trichosporium OB3b]
          Length = 377

 Score =  180 bits (456), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 61/357 (17%), Positives = 132/357 (36%), Gaps = 10/357 (2%)

Query: 33  YQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIIS 92
              VR L    D   RG  + +  IP  V+     +     D + +  N  A   Y +  
Sbjct: 26  VDLVRKLTGLQDGMARGAATARAAIPAQVERIQTAIATAEADSWKERANGRAAATYLLGG 85

Query: 93  QDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLL 152
                +  +   +     D  ++ A   Y  G+  ++    ++I  K+    +  +L L+
Sbjct: 86  GSPRAIRKIFDANLFSDADRPLIDASLAYAEGRSRDAMPMFAQIDPKEQPATLGGHLALV 145

Query: 153 IGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQN-EVGERAFGYIRAYVTQ 211
            G  ++   + +A    D  RL  P + +EE ALR  + +    +   +     R YV Q
Sbjct: 146 RGGLLIGSDNARARELLDLARLLMPSSLVEEAALRREVAVVDPLQDAAKFLLLARRYVAQ 205

Query: 212 FHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFS---LEEQRAIYLKIAQNSVISG 268
           +  S +  +F        +   L +P+  +   ++ F       +  +++ IAQN+++ G
Sbjct: 206 YSRSPFARNFWGEARAATIRVALDIPERQLGEFLALFDATPAATRFDLHMTIAQNAILHG 265

Query: 269 KRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQD 328
           +  +  L   +   + D   ++  A + L    L     D  +       +   SL   D
Sbjct: 266 RPALAALETDRAATLAD--THQAKARVALNRAALTALGGDFEAAASEFAALDVSSLERGD 323

Query: 329 RYLKKASEIIMSEIGKSLIDIDFE-HIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQ 384
           + L+      +  +  S    +     + +L +++   +  + S   E  ++K   +
Sbjct: 324 KELRAVVAGAIDHLRLSPEAAEKTMSARDELPVERAARQALDDS---EILLQKTVQK 377


>gi|300024595|ref|YP_003757206.1| hypothetical protein Hden_3090 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526416|gb|ADJ24885.1| hypothetical protein Hden_3090 [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 424

 Score =  173 bits (439), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 58/367 (15%), Positives = 129/367 (35%), Gaps = 9/367 (2%)

Query: 34  QCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQ 93
           + +  L    D  ++GD         ++ E    +RA     + +   +   ++Y +   
Sbjct: 62  RLLARLGTVQDIVVQGDEGALADQGRLLSEISAVVRAFEKSDWDNYAQVRDAFVYVLSGG 121

Query: 94  DLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLI 153
           D  V+  L   DT+   D  +   + KY  GQ   + K  + +  +     +V    L  
Sbjct: 122 DYGVLKPLANDDTRHEADRTLAQGIIKYAQGQTSAARKLWADVDPRSVDVSLVGPFALAR 181

Query: 154 GRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVG-ERAFGYIRAYVTQF 212
               +     +A+   D  RL  P T +EE A+R  + +  ++   +RA   +  Y+ ++
Sbjct: 182 ASLYIGNDDAKAIALLDEARLACPHTAIEEAAVRREIPVLVSKGETQRAMLLLTDYLRRY 241

Query: 213 HHSIYKDHFISVLLRFFLHGQL---KLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGK 269
             SIY                    +   E +    S    + +  + L +A   + +G+
Sbjct: 242 GRSIYAWKLFRDFSAAAAKRDEFDGRDMVEKLTEATSTADRQSRIDLLLAMAAAGLPAGR 301

Query: 270 RKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDR 329
             +   A  +   +      +DL    LY+   N P         +   I    L   D 
Sbjct: 302 ISLAQAAANEALSLKPD-SAEDLDRAMLYQAAANAPSTRAAEALSALRQITADRLTGNDV 360

Query: 330 YLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIESID 389
            +++ +  I   + ++      +    +  + +     + VS      +K   + IE  +
Sbjct: 361 EIREVAGYIAQTVTQNKFAPASDARNAETEVSRAATELSRVSTA----VKSADAAIEEAN 416

Query: 390 VLLAEAR 396
           ++++  +
Sbjct: 417 MIMSGTK 423


>gi|304392496|ref|ZP_07374436.1| putative chemotaxis protein [Ahrensia sp. R2A130]
 gi|303295126|gb|EFL89486.1| putative chemotaxis protein [Ahrensia sp. R2A130]
          Length = 389

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 52/326 (15%), Positives = 118/326 (36%), Gaps = 8/326 (2%)

Query: 35  CVRSLQRALDEAMRGDISLQKKIPDIVKETGVQL----RATHMDVFVDNRNIDAVWIYTI 90
            +R+L    D    GD +       +++     +    +    D  ++ RN  A  +Y +
Sbjct: 36  MLRTLHAVQDRIATGDAASLPLQKHLLELIAPSIAGLAKVKTPDALLEERNT-AFILYAL 94

Query: 91  ISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLH 150
                      +A         A+ +A+     G+   + +   KI+       +VPY+ 
Sbjct: 95  SGGAADTARGALAVIDHDEPLRALAHAVADNIGGRRVRALRRFLKIEMTSLPVSLVPYVA 154

Query: 151 LLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQ-NEVGERAFGYIRAYV 209
           L  G+ +        +     V   +PGT LEE ALR  L++    ++  R +   R Y 
Sbjct: 155 LAKGQLLAQSEPDAGIVLLSIVGQLAPGTLLEEAALRRKLQLALRGKMAARFYAAARQYT 214

Query: 210 TQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGK 269
            +F  S Y+  F   L +  +        +D+   ++      +  + ++IA+ ++++G+
Sbjct: 215 YRFIGSPYRASFAQALQKAAVEFPE--HGDDLDAVLALMPENLRSPMQVRIARMALLAGQ 272

Query: 270 RKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDR 329
             +    ++++       +          E +  +   D+   ++   ++    L  +D+
Sbjct: 273 DGLARKMVQRVDIEGQVGEVARRTQSLFVEAVSRLAGKDVKEQRKILVSLDRRFLNAEDK 332

Query: 330 YLKKASEIIMSEIGKSLIDIDFEHIQ 355
            L   +  I   I   +        Q
Sbjct: 333 KLVDVAVAIADTIVSPVSRAAGTQKQ 358


>gi|218515864|ref|ZP_03512704.1| chemotaxis protein [Rhizobium etli 8C-3]
          Length = 202

 Score =  145 bits (365), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 38/199 (19%), Positives = 83/199 (41%), Gaps = 33/199 (16%)

Query: 227 RFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDR 286
           +  +     +  +D+V  +SF     QR +YL+IA+ + ISGK ++  +A+++++ +   
Sbjct: 1   KLVVAHDRDVKPQDVVDILSFMDAPRQREVYLRIARAAAISGKPELARMAVERVQSLGAG 60

Query: 287 LDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSL 346
            D         Y  +  +P  DI    ++   I   +L  +D+ L+ A+  +  +I ++ 
Sbjct: 61  TDNAFGPLADFYGGMAGLPTQDIDRAAKNVSGIDGNALSPRDQALQAAARSVAEQILRAP 120

Query: 347 --------IDIDFEHIQ-----------------------KDLLLDKKEPRHTNVSMGIE 375
                    D +  H +                          +    + + T+ S    
Sbjct: 121 DPASLTQASDPNTSHQEITSEKAAAIAMQPGAPGAPPEPVPGGVASTGQSQDTDPSFN-- 178

Query: 376 SFIKKNRSQIESIDVLLAE 394
           +F+  +RS+++ ID LLA+
Sbjct: 179 AFVTTSRSKLDEIDGLLAQ 197


>gi|312115286|ref|YP_004012882.1| hypothetical protein Rvan_2568 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220415|gb|ADP71783.1| hypothetical protein Rvan_2568 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 386

 Score =  112 bits (280), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 62/394 (15%), Positives = 137/394 (34%), Gaps = 14/394 (3%)

Query: 7   ICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGV 66
              ++  + +  S A+ Q   R       +R   R  D   R   S  + + +  +    
Sbjct: 3   AAVVLGFVALVTSVASTQAAEREQALIMDLRDDARRFDAVARTQASSME-MAEARERFAA 61

Query: 67  QLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQL 126
            LR        ++  +    I+ +    +  +      D  G  +  ++  +  + SG  
Sbjct: 62  HLRDAAHLKLKNDEFLKFAEIFVLSGGGVEHIKP-WKDDQPGEMERNLIRGIVAHGSGDT 120

Query: 127 EESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIAL 186
             +   L  I  +        +L L+         +Q+A  ++   RL  PGT +EE AL
Sbjct: 121 TRAEAILLAIDARSLDAVRGGHLALVQALLAARTDAQRAFSYYGLARLLLPGTLVEEAAL 180

Query: 187 RNLLEITQNEV-GERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTI 245
           R  + +   ++  +       AY+ +F  S +     + ++ +    +       +   +
Sbjct: 181 RQSIVLAGEKLRAQEFAEAALAYIRRFDTSTFAGDAETRIVSYLPRFEDADGAAILERML 240

Query: 246 SFFSLEEQR--AIYL-KIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENIL 302
               +   R    +L ++AQ  V+SG+R +  LA  +   ++   D      + LY+  +
Sbjct: 241 EARPMGFGRCPVCFLTEVAQRGVLSGRRSLVLLATGKGLALV-ENDAPQKQRLLLYQAAV 299

Query: 303 NIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDK 362
            I          +  ++   S    D  L  AS  +  ++ ++              +  
Sbjct: 300 EIVTDKYEGASDTLKSLNPESFDADDAALLSASLQLARKLRETP-------KPLSDEVAL 352

Query: 363 KEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR 396
              R  N     E  + + R+ + + D++L   R
Sbjct: 353 AGNRGGNRVFLGEKRVMEARAAVANADLVLQRER 386


>gi|13472588|ref|NP_104155.1| chemotaxis MOTC protein [Mesorhizobium loti MAFF303099]
 gi|14023334|dbj|BAB49941.1| chemotaxis motc protein [Mesorhizobium loti MAFF303099]
          Length = 222

 Score =  105 bits (263), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 51/131 (38%)

Query: 236 LPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATI 295
           +  + +    S    E ++ IYL+IA+ + I G  ++   A  + ++  D    +     
Sbjct: 3   ISQDKLADITSMMDPEREKVIYLRIARRAAIDGLSELSAFASARAEQGRDGNTNQGDPRA 62

Query: 296 QLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQ 355
           +LY ++  +    I  ++     I    L + DR L  A++ I  E+      +      
Sbjct: 63  ELYSSLSTVTSGTIEDVRTKLGKIDRSKLSDGDRALLDAAQAIAGEVVAPPASLPGATPA 122

Query: 356 KDLLLDKKEPR 366
              L  + +P 
Sbjct: 123 SAALAPQPKPE 133


>gi|159036016|ref|YP_001535269.1| LuxR family transcriptional regulator [Salinispora arenicola
           CNS-205]
 gi|157914851|gb|ABV96278.1| transcriptional regulator, LuxR family [Salinispora arenicola
           CNS-205]
          Length = 975

 Score = 47.0 bits (110), Expect = 0.005,   Method: Composition-based stats.
 Identities = 30/251 (11%), Positives = 70/251 (27%), Gaps = 35/251 (13%)

Query: 101 LIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPF 160
           L+  D  G        A   Y           L+++   ++       L   +  A+   
Sbjct: 326 LLQNDVAGRLVAPDEQAADWYAFHHQLSREAVLAQLDRDEH-----ARLAGALATAVEAI 380

Query: 161 SS--------QQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQF 212
                       A    D     + GT   E   R  L +               Y+   
Sbjct: 381 HPGLPREWCEAAARLRVDAGDRATAGTLFTEAG-RRALALGAANSAVAVLDRALEYL--- 436

Query: 213 HHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFS------LEEQRAIYLKIAQNSVI 266
            H          L             E  + ++S            + A++ ++A  + I
Sbjct: 437 PHDDVATR-AGTLELLLQALAEAGLVERALASVSELDQAGGLGPRRRAALHTRLAWAATI 495

Query: 267 SGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLME 326
           +G+ + G   ++  + ++      +           ++  +D+++            L  
Sbjct: 496 AGRTEDGLAQVETARALLGSEGSAE-----------DLAPIDVVAAHLLLDAAGPDQLAA 544

Query: 327 QDRYLKKASEI 337
            +R  ++A+E+
Sbjct: 545 AERLARQAAEV 555


>gi|85715162|ref|ZP_01046146.1| hypothetical protein NB311A_01220 [Nitrobacter sp. Nb-311A]
 gi|85698077|gb|EAQ35950.1| hypothetical protein NB311A_01220 [Nitrobacter sp. Nb-311A]
          Length = 554

 Score = 46.2 bits (108), Expect = 0.010,   Method: Composition-based stats.
 Identities = 33/290 (11%), Positives = 86/290 (29%), Gaps = 34/290 (11%)

Query: 52  SLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFD 111
           + +  +   + +    +R    +VF  + N  A  +  +     SV   ++        D
Sbjct: 41  AAEGALLMQLDDPSPLVRQAMANVFARSVNAPAAIVRALSVDQPSVAVPVLEYSPL-LID 99

Query: 112 IAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDY 171
             +V  +    +G  E       ++    +    +  +        +  +   ++    +
Sbjct: 100 ADLVDIV---ATGSREVQCAVARRVHVPVSVCAAIAEVGFATAALELMKNPGASIAPMSW 156

Query: 172 VRLTSPGTFLEE----IALRNLLEITQNEVGERAFGYI---RAYVTQFHHS------IYK 218
            R       +E      A+R  +    +         I      + +F  S         
Sbjct: 157 DR------IVERHGHLAAIRESMLALDDLPAATRLALIGKLSDTLARFVVSRNWLNVDCA 210

Query: 219 DHFISVLL-RFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKR------- 270
           D  IS    R  +H   +  D+D+   ++      Q    L +   +++SG         
Sbjct: 211 DRTISEARDRSIVHIAARARDDDMHSLVAHLRATGQLTAGLIL--RALLSGNTELFDHAL 268

Query: 271 -KIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNI 319
            ++  L + ++  ++       L  +     +  + F    +   +   I
Sbjct: 269 AELSGLPLSRVVALVHDRGGASLPALLTRAGLPEVTFPAFRAALEARDEI 318


>gi|168700460|ref|ZP_02732737.1| hypothetical protein GobsU_13092 [Gemmata obscuriglobus UQM 2246]
          Length = 343

 Score = 43.1 bits (100), Expect = 0.079,   Method: Composition-based stats.
 Identities = 17/158 (10%), Positives = 51/158 (32%), Gaps = 18/158 (11%)

Query: 92  SQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHL 151
           S + +    L  +      +  ++ A++ +  G+ E++ + + +++       +     L
Sbjct: 108 SGEPAAFPPLTQQLVPP--EPPLMSAVRAHCEGRPEQAIEIIRRMEPNQQEFVLGVLPIL 165

Query: 152 LIGRAM-MPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAF-----GYI 205
             G +  +      A    D +R           A   L  +   ++ + AF        
Sbjct: 166 ARGASADLANDPATAAALTDQLR----------AAASRLEPLAALKIEKVAFCTNEPAGF 215

Query: 206 RAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVF 243
             +V +   + Y+ +          +   +L  +  + 
Sbjct: 216 GRFVQRPTANHYRPNERVHFYLELRNLGHQLTPDGFLT 253


>gi|297733786|emb|CBI15033.3| unnamed protein product [Vitis vinifera]
          Length = 3085

 Score = 42.7 bits (99), Expect = 0.090,   Method: Composition-based stats.
 Identities = 28/132 (21%), Positives = 52/132 (39%), Gaps = 16/132 (12%)

Query: 14   MDVFFSFATDQDLVRTIVPYQ-CVRSLQ-----RALDEAMRGDISLQKKIPDIVKETGVQ 67
            + V  SF+  +D++R   PY+  +RSLQ       LD   +G  S   +    ++ T +Q
Sbjct: 2075 LTVHPSFSKSEDVIRQREPYKGLIRSLQKIGCTHVLDLYCQGLTSQNGQFQHDLEFTELQ 2134

Query: 68   LRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLE 127
              A     +    N D   +Y + +   S    +       +F+  +   L+ +  G   
Sbjct: 2135 YEAA----WR-AGNWDFSLLY-MGANSPSSSQHIRC----DHFNENLHSCLRAFQEGDFN 2184

Query: 128  ESSKELSKIKDK 139
            E   +L   K +
Sbjct: 2185 EFHSKLKDSKQE 2196


>gi|147846076|emb|CAN79887.1| hypothetical protein VITISV_019497 [Vitis vinifera]
          Length = 433

 Score = 42.7 bits (99), Expect = 0.093,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 50/128 (39%), Gaps = 16/128 (12%)

Query: 14  MDVFFSFATDQDLVRTIVPYQ-CVRSLQ-----RALDEAMRGDISLQKKIPDIVKETGVQ 67
           + V  SF+  +D++R   PY+  +RSLQ       LD   +G  S   +    ++ T +Q
Sbjct: 15  LTVHPSFSKSEDVIRQREPYKGLIRSLQKIGCTHVLDLYCQGLTSXNGQFQHDLEFTELQ 74

Query: 68  LRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLE 127
             A     +    N D   +Y + +   S    +       +F+  +   L+ +  G   
Sbjct: 75  YEAA----WR-AGNWDFSLLY-MGANSPSSSQHIRC----DHFNENLHSCLRAFQEGDFN 124

Query: 128 ESSKELSK 135
           E   +L  
Sbjct: 125 EFHSKLKD 132


>gi|291542494|emb|CBL15604.1| DNA primase, catalytic core [Ruminococcus bromii L2-63]
          Length = 588

 Score = 42.7 bits (99), Expect = 0.10,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 56/126 (44%), Gaps = 7/126 (5%)

Query: 48  RGDISLQKKI-PDIVKETGVQLRATHMDVFVDNRNI---DAVWIYTIISQDLSVVDDLIA 103
           RG+ + +KK    I  E   +    + + F   R+    +A+ +Y +   +    +++ A
Sbjct: 430 RGERAEEKKQARQIQLELSRRNDKINPEHFQKPRSSSAEEALLVYLLN--NPDAYEEISA 487

Query: 104 KDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQ 163
           +     F   ++    +YFS ++E     L+     D T+     L+ L+ +A+   S+ 
Sbjct: 488 RVKPEQFQNTLMRRFFEYFSARIERGEDPLTNTAA-DFTQDENSKLYQLMSQAIPGASTA 546

Query: 164 QAVHFF 169
           +A++ +
Sbjct: 547 EAMNEY 552


>gi|225457040|ref|XP_002279402.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 1431

 Score = 42.7 bits (99), Expect = 0.11,   Method: Composition-based stats.
 Identities = 28/132 (21%), Positives = 52/132 (39%), Gaps = 16/132 (12%)

Query: 14  MDVFFSFATDQDLVRTIVPYQ-CVRSLQ-----RALDEAMRGDISLQKKIPDIVKETGVQ 67
           + V  SF+  +D++R   PY+  +RSLQ       LD   +G  S   +    ++ T +Q
Sbjct: 580 LTVHPSFSKSEDVIRQREPYKGLIRSLQKIGCTHVLDLYCQGLTSQNGQFQHDLEFTELQ 639

Query: 68  LRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLE 127
             A     +    N D   +Y + +   S    +       +F+  +   L+ +  G   
Sbjct: 640 YEAA----WR-AGNWDFSLLY-MGANSPSSSQHIRC----DHFNENLHSCLRAFQEGDFN 689

Query: 128 ESSKELSKIKDK 139
           E   +L   K +
Sbjct: 690 EFHSKLKDSKQE 701


>gi|92117208|ref|YP_576937.1| hypothetical protein Nham_1660 [Nitrobacter hamburgensis X14]
 gi|91800102|gb|ABE62477.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 486

 Score = 42.0 bits (97), Expect = 0.15,   Method: Composition-based stats.
 Identities = 25/290 (8%), Positives = 80/290 (27%), Gaps = 34/290 (11%)

Query: 52  SLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFD 111
           + +  +   + +    +R    +VF  +    A  +  +     SV   ++        D
Sbjct: 41  AAEGGLLMQLDDPSPLVRQAMAEVFARSATAPAAIVQALSVDQPSVAISVLEHSPL-LID 99

Query: 112 IAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDY 171
             +V  +    +G  E       + +   +    +  +        +  +    +    +
Sbjct: 100 ADLVDIV---ATGSCEVQCAVARRARVPVSVCAAIAEVGSAAAALELIENPGADLAPLSW 156

Query: 172 VRLTSPGTFLEE----IALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFI----- 222
            R       +E      A+R  +    +         +          +   +++     
Sbjct: 157 AR------IVERHGHLAAIRESMLALDDLPAATRLALVAKLSDTLAQFVVARNWLGADRA 210

Query: 223 -----SVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKR------- 270
                    R  ++   +  D+D+   ++      Q    L +   +++SG         
Sbjct: 211 SRAASDARDRSIVNIAARARDDDMRGLVAHLRATGQLTAGLIL--RALLSGNLDLFDHAL 268

Query: 271 -KIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNI 319
            ++  L + ++  ++       L  +     +    F    +   +   I
Sbjct: 269 VELSGLPLSRVAALVHDRGGASLPALLTRAGLPESTFPAFRAALEARDEI 318


>gi|157273492|gb|ABV27391.1| aspartate aminotransferase [Candidatus Chloracidobacterium
           thermophilum]
          Length = 405

 Score = 42.0 bits (97), Expect = 0.19,   Method: Composition-based stats.
 Identities = 15/106 (14%), Positives = 36/106 (33%), Gaps = 5/106 (4%)

Query: 110 FDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFF 169
              +     +  +  + +     L+++           +       ++   SS+ A+   
Sbjct: 298 IPESFFEECRAAYRQRRDRLIAGLAELGLPVKPVPNGAFYVFPDVSSLGGTSSEIAMRLL 357

Query: 170 DYVRLTS-PGTFL---EEIALRNLLEITQNEVGERAFGYIRAYVTQ 211
           D  R+ + PGT      E  LR    ++   + ER    +  Y+ +
Sbjct: 358 DEARVATVPGTAFGCAGEGHLRLSYSLSLEAI-ERGLAALGEYLRR 402


>gi|26541504|gb|AAN85491.1|AF484556_13 putative transcriptional regulator [Streptomyces atroolivaceus]
          Length = 774

 Score = 41.6 bits (96), Expect = 0.21,   Method: Composition-based stats.
 Identities = 38/382 (9%), Positives = 108/382 (28%), Gaps = 72/382 (18%)

Query: 10  MMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLR 69
                 +F + + D     ++  Y+  R                 + + +++   G  L 
Sbjct: 113 AAQLAALFPALSPDAPRDTSVDTYRICR---------------AMRALLEMLAADGPLLL 157

Query: 70  ATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEES 129
           A     ++D    D++ +   + +       +IA   +G     ++  L    + +    
Sbjct: 158 ALDDVHWMD---ADSLELLGQLLEQPVAGPVVIAVAHRGRPGDRVLNGLLARCASRGGCL 214

Query: 130 SKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNL 189
               + + +++    +   L  +    ++  S              SPG       LR +
Sbjct: 215 RVRPAPLTEQEAIALLPDDLSRVHCETLLVESGG------------SPGLLRAFATLRQV 262

Query: 190 LEITQNEVGERAFGYIRAYVTQFH----------------HSIYKDH------------F 221
             +T           +   +  F                 H  Y                
Sbjct: 263 PGLTGAWTPPLPADLLADVLRDFRALSAEGWQVVRAAAVLHEPYAADDLKEIAHVDDAAL 322

Query: 222 ISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFL------ 275
              L       +  L  +++ + + F +   + A Y    +  ++    +   +      
Sbjct: 323 WRALDELI--HEELLRPDELPWQLRFANPLLRVAAYQSAGRGWLLGAHAQAARILARPGY 380

Query: 276 -AIKQLKRIIDRLDYKDLATIQ-LYENILNI----PFVDIMSLQRSTCNIPYYSLMEQDR 329
            +    + +      +D +  + L++    +    P   +  ++ +  +     L  +DR
Sbjct: 381 PSAHMARHLERGAALRDESGARVLWDAAARLLWQDPSQSVSWIRAALASRAGGDLEPRDR 440

Query: 330 YLKKASEIIMSEIGKSLIDIDF 351
            L   +  +   + +SL  +  
Sbjct: 441 LLFGKALALAGRLTESLATLGP 462


>gi|256390298|ref|YP_003111862.1| LuxR family transcriptional regulator [Catenulispora acidiphila DSM
           44928]
 gi|256356524|gb|ACU70021.1| transcriptional regulator, LuxR family [Catenulispora acidiphila
           DSM 44928]
          Length = 919

 Score = 41.6 bits (96), Expect = 0.22,   Method: Composition-based stats.
 Identities = 17/101 (16%), Positives = 37/101 (36%), Gaps = 9/101 (8%)

Query: 81  NIDAVWIYTIISQDLSVVDDLIAKDTKGYFD-IAIVYALKKYFSGQLEESSKELSKIKDK 139
           N+DA  ++     +   +  +++ D   + D    V         +   + + L+ +++ 
Sbjct: 204 NLDA--VHGASGGNPQYLR-ILSADGDPHADAARAVVGELADLDPRTLTTLQTLAVLREP 260

Query: 140 DNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTF 180
            + + I     L    A+    S   +   D VR T  GT 
Sbjct: 261 SHPQLIAAVAELSAAEALDALDS---LTRLDIVRTT--GTI 296


>gi|158520052|ref|YP_001527922.1| SpoIID/LytB domain-containing protein [Desulfococcus oleovorans
           Hxd3]
 gi|158508878|gb|ABW65845.1| SpoIID/LytB domain [Desulfococcus oleovorans Hxd3]
          Length = 508

 Score = 41.2 bits (95), Expect = 0.26,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 49/133 (36%), Gaps = 15/133 (11%)

Query: 85  VWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRG 144
           V ++       +  D L A+                  +G+  E+      + D     G
Sbjct: 4   VLLHAANGGLPAESDFLFAQAETQV------------AAGRYLEAIGLYQTVADTTPDAG 51

Query: 145 IVPYLHLLIGRAMMPFSSQ--QAVHFFDYVRLTSPGTFL-EEIALRNLLEITQNEVGERA 201
                 LL+G A   +  Q  +A+ +FDY+    PG+   EE   R  + + + E   +A
Sbjct: 52  EKARALLLVGYAHAQYLDQHDKALLYFDYILTNWPGSAAAEEALYRKGMVLYETERYAKA 111

Query: 202 FGYIRAYVTQFHH 214
           +    AY  ++ H
Sbjct: 112 YQAFTAYQERYPH 124


>gi|115524364|ref|YP_781275.1| hypothetical protein RPE_2355 [Rhodopseudomonas palustris BisA53]
 gi|115518311|gb|ABJ06295.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 391

 Score = 41.2 bits (95), Expect = 0.31,   Method: Composition-based stats.
 Identities = 29/291 (9%), Positives = 82/291 (28%), Gaps = 34/291 (11%)

Query: 51  ISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYF 110
            + +  +  ++ +    +R    +VF  +    A  I  + +   SV   ++        
Sbjct: 40  EAAEGALLMLLDDRSPLVRQAMAEVFSRSTEAPAAIIRALSTDQPSVALPVLEFSPL-LI 98

Query: 111 DIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFD 170
           D  +V  +    +G  E       ++K        +  +        +  +    +  F 
Sbjct: 99  DADLVDIV---ATGNSETQCAIARRVKLPAPVCAAIAEVGSAAAALELIENPHAELAPFS 155

Query: 171 YVRLTSPGTFLEE----IALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLL 226
           + R       +E      A+R  + + ++         +          +   +++S   
Sbjct: 156 WDR------IVERHGHLAAIRESMLVLEDLPAATRMALVAKLSDTLAQFVVARNWLSAER 209

Query: 227 ----------RFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGK------- 269
                     R  +    +  D+D+   +    L       L +   S++SG        
Sbjct: 210 AERAVGEAMDRSIVVVATRSRDDDMQGLMRHLRLTGHLTTGLIL--RSLLSGNSELFHHA 267

Query: 270 -RKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNI 319
             ++  L   ++  ++       L  +     +         +   +   I
Sbjct: 268 LVELTELPSARVAALLHDGAGASLNALLKRAGLPEATHPAFRAALEAIREI 318


>gi|301154697|emb|CBW14160.1| GTPase [Haemophilus parainfluenzae T3T1]
          Length = 452

 Score = 40.8 bits (94), Expect = 0.35,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 80/241 (33%), Gaps = 40/241 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D VRL  PG F E+  L + L++ Q E + +               S         
Sbjct: 95  ILQLDGVRLARPGEFSEQAFLNDKLDLAQAEAIADLIDATSEQAARSALKSLQGEFSNKV 154

Query: 216 -------IYKD-------HFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++    +I+  +     E ++   L+  
Sbjct: 155 NQLVDSVIYLRTYVEASIDFPDEEIDFLADGKIEAKLREIINQLDLVRSEAKQGSILREG 214

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 215 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 261

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQK-DLLLDKKEPRHTNVSMGIESFIK 379
             L   D   L++A++ +   IG S    + E   +  L+LD  +P   N+      F+ 
Sbjct: 262 MPLHIIDTAGLREATDEV-ERIGISRAWTEIEQADRIILMLDSSDPDSQNIEKVRSEFLS 320

Query: 380 K 380
           K
Sbjct: 321 K 321


>gi|325577780|ref|ZP_08148055.1| tRNA modification GTPase TrmE [Haemophilus parainfluenzae ATCC
           33392]
 gi|325160525|gb|EGC72651.1| tRNA modification GTPase TrmE [Haemophilus parainfluenzae ATCC
           33392]
          Length = 452

 Score = 40.8 bits (94), Expect = 0.41,   Method: Composition-based stats.
 Identities = 43/241 (17%), Positives = 80/241 (33%), Gaps = 40/241 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D VRL  PG F E+  L + L++ Q E + +               S         
Sbjct: 95  ILQLDGVRLARPGEFSEQAFLNDKLDLAQAEAIADLIDATSEQAARSALKSLQGEFSNKV 154

Query: 216 -------IYKD-------HFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++    +I+  +     E ++   L+  
Sbjct: 155 NQLVDSVIYLRTYVEASIDFPDEEIDFLADGKIEAKLREIINQLDLVRSEAKQGSILREG 214

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 215 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 261

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQK-DLLLDKKEPRHTNVSMGIESFIK 379
             L   D   L++A++ +   IG S    + E   +  L+LD  +P   ++      F+ 
Sbjct: 262 MPLHIIDTAGLREATDEV-ERIGISRAWTEIEQADRIILMLDSSDPDSQHIEKVRSEFLS 320

Query: 380 K 380
           K
Sbjct: 321 K 321


>gi|218196737|gb|EEC79164.1| hypothetical protein OsI_19839 [Oryza sativa Indica Group]
          Length = 1661

 Score = 40.4 bits (93), Expect = 0.46,   Method: Composition-based stats.
 Identities = 20/129 (15%), Positives = 43/129 (33%), Gaps = 11/129 (8%)

Query: 34  QCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQ 93
           + +RSL  A +    G  +L         E    + A   +V + ++N +   I+ + + 
Sbjct: 504 RLIRSLLEAQN--ADGYTALHLACRRGSAEIVEAIVAYQENVDLLDKNENPPIIFAMAAG 561

Query: 94  DLSVVDDLIAKDTKGYFDIAIVYAL---KKYF---SGQLEESSKEL-SKIKDKDNTRGIV 146
               V  L+ +      +  +   L     +     GQ E   + L +            
Sbjct: 562 SPQCVRALVRR--SSDVNSRLREGLGPTLAHVCAHHGQPECMRELLMAGADPNAVDGEGE 619

Query: 147 PYLHLLIGR 155
             LH+ + +
Sbjct: 620 SILHIAVAK 628


>gi|222631480|gb|EEE63612.1| hypothetical protein OsJ_18429 [Oryza sativa Japonica Group]
          Length = 1635

 Score = 40.4 bits (93), Expect = 0.46,   Method: Composition-based stats.
 Identities = 20/129 (15%), Positives = 43/129 (33%), Gaps = 11/129 (8%)

Query: 34  QCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQ 93
           + +RSL  A +    G  +L         E    + A   +V + ++N +   I+ + + 
Sbjct: 478 RLIRSLLEAQN--ADGYTALHLACRRGSAEIVEAIVAYQENVDLLDKNENPPIIFAMAAG 535

Query: 94  DLSVVDDLIAKDTKGYFDIAIVYAL---KKYF---SGQLEESSKEL-SKIKDKDNTRGIV 146
               V  L+ +      +  +   L     +     GQ E   + L +            
Sbjct: 536 SPQCVRALVRR--SSDVNSRLREGLGPTLAHVCAHHGQPECMRELLMAGADPNAIDGEGE 593

Query: 147 PYLHLLIGR 155
             LH+ + +
Sbjct: 594 SILHIAVAK 602


>gi|315225431|ref|ZP_07867245.1| sensor histidine kinase [Capnocytophaga ochracea F0287]
 gi|314944704|gb|EFS96739.1| sensor histidine kinase [Capnocytophaga ochracea F0287]
          Length = 484

 Score = 40.4 bits (93), Expect = 0.48,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 45/128 (35%), Gaps = 21/128 (16%)

Query: 266 ISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLM 325
           I G+ +   L  +  K ++     +    +  Y  +      +I + +            
Sbjct: 214 IEGRLEKTRLLSQNEKILLKSAPTEITELVNAYNGM----IDEIENSKALLAQ------S 263

Query: 326 EQDRYLKKASEIIMSEIGKSL--IDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRS 383
           E+++  +  ++ +  EI   L  + +  +  Q+  L + +    TN             S
Sbjct: 264 EREQAWRDMAKQVAHEIKNPLTPMRLSVQSYQRKALREPQTAEQTNEFCE---------S 314

Query: 384 QIESIDVL 391
            I+ ID+L
Sbjct: 315 LIQQIDIL 322


>gi|256820023|ref|YP_003141302.1| histidine kinase [Capnocytophaga ochracea DSM 7271]
 gi|256581606|gb|ACU92741.1| histidine kinase [Capnocytophaga ochracea DSM 7271]
          Length = 484

 Score = 40.4 bits (93), Expect = 0.50,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 45/128 (35%), Gaps = 21/128 (16%)

Query: 266 ISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLM 325
           I G+ +   L  +  K ++     +    +  Y  +      +I + +            
Sbjct: 214 IEGRLEKTRLLSQNEKILLKSAPTEITELVNAYNGM----IDEIENSKALLAQ------S 263

Query: 326 EQDRYLKKASEIIMSEIGKSL--IDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRS 383
           E+++  +  ++ +  EI   L  + +  +  Q+  L + +    TN             S
Sbjct: 264 EREQAWRDMAKQVAHEIKNPLTPMRLSVQSYQRKALREPQTAEQTNEFCE---------S 314

Query: 384 QIESIDVL 391
            I+ ID+L
Sbjct: 315 LIQQIDIL 322


>gi|325473858|gb|EGC77046.1| TldD/PmbA family protein [Treponema denticola F0402]
          Length = 435

 Score = 40.4 bits (93), Expect = 0.54,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 45/119 (37%), Gaps = 4/119 (3%)

Query: 269 KRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQD 328
           K++    A  ++ + +      D   + LY +  +I       ++    +I    L E+ 
Sbjct: 18  KKEGADKATTRVSKSVKSEMNIDAGRLSLYRSTTDISVAMTSLVETKKGHISGNDLSEKT 77

Query: 329 RYLKKASEIIM-SEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSM--GIESFIKKNRSQ 384
              ++A++++  S   +     D   +QK   L   +    N  M   ++ F+   +S 
Sbjct: 78  LK-EEAAKVVALSRSSEKDDGNDIAPMQKGETLSYGDTEPNNEKMYERLKEFLDYTKSA 135


>gi|42526801|ref|NP_971899.1| TldD/PmbA family protein [Treponema denticola ATCC 35405]
 gi|41817116|gb|AAS11810.1| TldD/PmbA family protein [Treponema denticola ATCC 35405]
          Length = 435

 Score = 40.4 bits (93), Expect = 0.54,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 45/119 (37%), Gaps = 4/119 (3%)

Query: 269 KRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQD 328
           K++    A  ++ + +      D   + LY +  +I       ++    +I    L E+ 
Sbjct: 18  KKEGADKATTRVSKSVKSEMNIDAGRLSLYRSTTDISVAMTSLVETKKGHISGNDLSEKT 77

Query: 329 RYLKKASEIIM-SEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSM--GIESFIKKNRSQ 384
              ++A++++  S   +     D   +QK   L   +    N  M   ++ F+   +S 
Sbjct: 78  LK-EEAAKVVALSRSSEKDDGNDIAPMQKGETLSYGDTEPNNEKMYERLKEFLDYTKSA 135


>gi|253997260|ref|YP_003049324.1| peptidase U62 modulator of DNA gyrase [Methylotenera mobilis JLW8]
 gi|253983939|gb|ACT48797.1| peptidase U62 modulator of DNA gyrase [Methylotenera mobilis JLW8]
          Length = 446

 Score = 40.4 bits (93), Expect = 0.56,   Method: Composition-based stats.
 Identities = 29/204 (14%), Positives = 60/204 (29%), Gaps = 20/204 (9%)

Query: 181 LEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDH--FISVLLRFFLHGQLKLPD 238
           ++E AL         +  E A       +     S+      F       F  G      
Sbjct: 130 VDEAAL------LAQQCEEAALAVDARIINSEGASVSTGTGFFAYSNSHGFTGGYPSSRH 183

Query: 239 EDIVFTISFFSLEEQRAIYLKIAQNSV-ISGKRKIGFLAIKQ-LKRIIDRLDYKDLATIQ 296
                 I+      QR  +   A+ +  +    +IG +A ++ +KR+  R        + 
Sbjct: 184 GISCSVIAESDDSMQRDYWYATARTAADLQSPAEIGRIAGERTVKRLNSRKIKTCQVPVL 243

Query: 297 LYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQK 356
              ++ +     +         I   +L  +  +L      +  +I   L++I  +   K
Sbjct: 244 FEASLASGLISTL------ISAISGGNLYRKSSFLLD---SLGQQIASPLLNIYEDPFVK 294

Query: 357 DLLLDKKEPRHTNVSMGIESFIKK 380
             L          V+      +K 
Sbjct: 295 KGLASSPFDNE-GVATNARQLVKD 317


>gi|195023816|ref|XP_001985752.1| GH20976 [Drosophila grimshawi]
 gi|193901752|gb|EDW00619.1| GH20976 [Drosophila grimshawi]
          Length = 2381

 Score = 40.0 bits (92), Expect = 0.57,   Method: Composition-based stats.
 Identities = 16/123 (13%), Positives = 35/123 (28%), Gaps = 6/123 (4%)

Query: 261  AQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTC--- 317
            A  +      ++   A  Q  ++            Q       IP     + Q       
Sbjct: 2115 AAPATQQANNQLPAAAAAQSSKMTGGGAQPSKIQSQTGAAQSKIPSATAAATQSKIQSPA 2174

Query: 318  NIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESF 377
              P  +   + + L  A++   S+   S   +    IQ       +    ++ +   +S 
Sbjct: 2175 AAPGAAQSPKTQSLAAAAQ---SKTQSSAAGVAQSKIQSQAAAGAQSKTQSSAAGVAQSK 2231

Query: 378  IKK 380
            I+ 
Sbjct: 2232 IQS 2234


>gi|320161155|ref|YP_004174379.1| beta-ketoacyl synthase family protein [Anaerolinea thermophila UNI-1]
 gi|319995008|dbj|BAJ63779.1| beta-ketoacyl synthase family protein [Anaerolinea thermophila UNI-1]
          Length = 2805

 Score = 39.6 bits (91), Expect = 0.95,   Method: Composition-based stats.
 Identities = 22/148 (14%), Positives = 42/148 (28%), Gaps = 17/148 (11%)

Query: 33   YQCVRSLQRALDEAMRGDISLQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIIS 92
             Q +RSLQR     +  D  + ++I     E   ++RA       D R         +  
Sbjct: 1282 IQQLRSLQRL----ISPDTEVYREIQRRADEIDEKIRALDYHF--DRR----FVFRVLSM 1331

Query: 93   QDLSVVDDLIAKDTKGYFDIAIVYA--LKKYFS-----GQLEESSKELSKIKDKDNTRGI 145
                  + + A+    + + A                 G+                    
Sbjct: 1332 GHSQFAEYIGARGPNTHVNAACATTTHAIAIAEDWIRAGRARRVVIIAGDDVTSGALSEW 1391

Query: 146  VPYLHLLIGRAMMPFSSQQAVHFFDYVR 173
            +    +  G A +    ++A+  FD  R
Sbjct: 1392 IGTSLMASGAATVEGDPRKAILPFDRRR 1419


>gi|255264223|ref|ZP_05343565.1| excinuclease ABC, A subunit [Thalassiobium sp. R2A62]
 gi|255106558|gb|EET49232.1| excinuclease ABC, A subunit [Thalassiobium sp. R2A62]
          Length = 952

 Score = 39.6 bits (91), Expect = 0.95,   Method: Composition-based stats.
 Identities = 34/231 (14%), Positives = 72/231 (31%), Gaps = 29/231 (12%)

Query: 79  NRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKD 138
            RN + V I  +     S +           FD       ++Y       + + L  ++ 
Sbjct: 25  PRN-ELVVITGLSGSGKSSL----------AFDTIYAEGQRRYVESLSAYARQFLDMMEK 73

Query: 139 KDNTRGIVPYLHLLIGRAMMPFSSQQAV----HFFDYVRLT--------SPGT-FLEEIA 185
            D          + I +     + +  V      +DY+RL         SP T    E  
Sbjct: 74  PDVDHITGLSPAISIEQKTTSKNPRSTVGTVTEIYDYMRLLFARVGTPFSPATGLPIEAQ 133

Query: 186 LRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFF--LHGQLKLPDEDIVF 243
               +      + E   GY+ A + +     Y+  F  +  + F  +    +  D D   
Sbjct: 134 QVQDMVDRTMAMEEGTRGYLLAPIIRDRKGEYRKEFAELKKQGFQRVKVDGEFYDLDEPP 193

Query: 244 TISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLAT 294
           T+     + +  I + + +  +  G       + +    + D + + + A 
Sbjct: 194 TL---DKKYRHDIDVVVDRIVIREGLETRLADSFRTALDLADGIAHIETAP 241


>gi|323142230|ref|ZP_08077064.1| excinuclease ABC, A subunit [Phascolarctobacterium sp. YIT 12067]
 gi|322413293|gb|EFY04178.1| excinuclease ABC, A subunit [Phascolarctobacterium sp. YIT 12067]
          Length = 949

 Score = 39.3 bits (90), Expect = 1.2,   Method: Composition-based stats.
 Identities = 34/226 (15%), Positives = 81/226 (35%), Gaps = 35/226 (15%)

Query: 79  NRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKD 138
            RN   V I  +     S +           FD       ++Y       + + L ++  
Sbjct: 23  PRN-KMVVITGLSGSGKSSL----------AFDTIYAEGQRRYVESLSAYARQFLGQMDK 71

Query: 139 KDNTRGIVPYLHLLIGRAMMPFSSQQAV----HFFDYVRLT--------SP--GTFLEEI 184
            D          + I +     + +  V      +DY+RL          P  G  +E+ 
Sbjct: 72  PDVDYIEGLSPAISIDQKTTSRNPRSTVGTVTEIYDYLRLLFARAGEPHCPKCGKLIEQQ 131

Query: 185 ALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHF----ISVLLRFFLHGQLKLPDED 240
           +++ +++    E+ + A   + A + +     +         +  +R F+ G+++  DED
Sbjct: 132 SVQQIVDKVL-ELPQGARFMVMAPLVRERKGEHMRVLDDMRRAGYVRMFIDGEVRTLDED 190

Query: 241 IVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDR 286
           I          ++ ++ + I + +V  G R+    +++   ++ D 
Sbjct: 191 IR-----LEKNKKHSLSVVIDRLAVREGIRQRLTDSVETALKLADG 231


>gi|312076495|ref|XP_003140887.1| hypothetical protein LOAG_05302 [Loa loa]
 gi|307763952|gb|EFO23186.1| hypothetical protein LOAG_05302 [Loa loa]
          Length = 702

 Score = 38.9 bits (89), Expect = 1.3,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 38/89 (42%), Gaps = 2/89 (2%)

Query: 308 DIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRH 367
               L   T  +    L E DR  K A+E + +  G  L +ID + I+++      + + 
Sbjct: 326 ATEKLLNQTRKLAEEQLAEADRAYKIAAESLTTVDGLRLPNIDPQQIEEEAKRVADDAKA 385

Query: 368 TNVSMGIESFIKKNRSQIESIDVLLAEAR 396
           T  +   +     N+  I+    L+AEA+
Sbjct: 386 T--ADNAKEQATANKELIDEAIQLIAEAK 412


>gi|170584498|ref|XP_001897036.1| Laminin-like protein C54D1.5 precursor [Brugia malayi]
 gi|158595571|gb|EDP34114.1| Laminin-like protein C54D1.5 precursor, putative [Brugia malayi]
          Length = 1634

 Score = 38.9 bits (89), Expect = 1.3,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 38/89 (42%), Gaps = 2/89 (2%)

Query: 308  DIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRH 367
                L   T  +    L E DR  K A+E +    G  L +ID + I+++     ++ + 
Sbjct: 1258 ATEKLLNQTRKLAEEQLTEADRAYKAAAESLTVVEGLRLPNIDPQQIEEEAKRVAEDAKA 1317

Query: 368  TNVSMGIESFIKKNRSQIESIDVLLAEAR 396
            T  +   +     N+  I+    L+AEA+
Sbjct: 1318 T--ADNAKEQAAANKELIDEAVRLIAEAK 1344


>gi|325278805|ref|YP_004251347.1| double-transmembrane region domain-containing protein [Odoribacter
           splanchnicus DSM 20712]
 gi|324310614|gb|ADY31167.1| double-transmembrane region domain protein [Odoribacter
           splanchnicus DSM 20712]
          Length = 679

 Score = 38.5 bits (88), Expect = 1.8,   Method: Composition-based stats.
 Identities = 10/89 (11%), Positives = 22/89 (24%), Gaps = 18/89 (20%)

Query: 74  DVFVDNRNIDAVWIYTIISQD---------LSVVDDLIAKDTKGYFDIAIVYALKKYFSG 124
            ++ D         Y +   +           V +  + K     +D      +  +   
Sbjct: 385 SMWED---------YLMNGGNLLVLPASSSPEVQNKFLQKIQAPRYDKRDTNTVIAHIET 435

Query: 125 QLEESSKELSKIKDKDNTRGIVPYLHLLI 153
           Q         +   K     I  Y  L++
Sbjct: 436 QAALFRDAFEQPDIKTILPQIRQYYRLIL 464


>gi|182416132|ref|YP_001821198.1| TPR repeat-containing protein [Opitutus terrae PB90-1]
 gi|177843346|gb|ACB77598.1| Tetratricopeptide TPR_2 repeat protein [Opitutus terrae PB90-1]
          Length = 790

 Score = 38.5 bits (88), Expect = 1.9,   Method: Composition-based stats.
 Identities = 24/188 (12%), Positives = 52/188 (27%), Gaps = 8/188 (4%)

Query: 112 IAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDY 171
              +        G+  E+  E     + D        ++L    A  P    +A+   + 
Sbjct: 603 RNRLGVALANVPGREAEALAEFRTAVELD-PNSAEARMNLARALASQPEHGAEAIEQLEA 661

Query: 172 VRLTSPGTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLH 231
               +P T  E   L   + +T  E    A  +++  V     S              L 
Sbjct: 662 ALRIAP-TLGEAHGLLGRILLTIPERLREATEHLQQAVAVQPES---AELRQAFGVALLR 717

Query: 232 GQLKLPD--EDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDY 289
              + PD   ++   +       +    L +A +     ++       ++   +      
Sbjct: 718 DPARTPDAIRELEAAVRLAPDMMEAHYALGVALSGA-PARQADARRHFRRTLELQPDFGP 776

Query: 290 KDLATIQL 297
              A  +L
Sbjct: 777 ARQALAEL 784


>gi|146303616|ref|YP_001190932.1| protein kinase [Metallosphaera sedula DSM 5348]
 gi|145701866|gb|ABP95008.1| protein kinase [Metallosphaera sedula DSM 5348]
          Length = 650

 Score = 38.5 bits (88), Expect = 1.9,   Method: Composition-based stats.
 Identities = 17/100 (17%), Positives = 39/100 (39%), Gaps = 10/100 (10%)

Query: 82  IDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFS-GQLEESSKELSKIKDKD 140
            DA+        +  ++  + A +    +DI  V     Y +  ++EE+     +   ++
Sbjct: 205 ADALITEFEKQGNPKLL--IEALNVLPTYDIPAVKLGLHYLNKNKVEEAVNMFEEALRRN 262

Query: 141 NTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYV---RLTSP 177
                     +L+G A++    ++A+   D     R T+P
Sbjct: 263 RNF----QNLVLLGSALLRKDPKRALEVLDEAQKIRRTAP 298


>gi|218665177|ref|YP_002427136.1| TPR domain protein [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|218517390|gb|ACK77976.1| TPR domain protein [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 603

 Score = 38.5 bits (88), Expect = 2.0,   Method: Composition-based stats.
 Identities = 32/168 (19%), Positives = 58/168 (34%), Gaps = 16/168 (9%)

Query: 138 DKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLL-EITQNE 196
             D   G   Y  L+   A +    Q A+  +      +P    E   LR     I +  
Sbjct: 76  PSDGMTGEQLYYLLVAEFATVQRQPQLAIPAWQKAAKLAP----EPNVLRRATQAIARFG 131

Query: 197 VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAI 256
             + A    R +      S   D F + L      GQ +   + +  T++ F  + +  +
Sbjct: 132 DFQDALQLARRWRQAAPGSAEADQFEAAL--LLTTGQDEQALQLLQATLARFPDDPK--V 187

Query: 257 YLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNI 304
            L+ A+  V  G+         + +R++  L  KD  +   Y  +  I
Sbjct: 188 TLQFAELLVTHGR-------SGEARRLLSALADKDPKSAAAYYALGRI 228


>gi|242039377|ref|XP_002467083.1| hypothetical protein SORBIDRAFT_01g019330 [Sorghum bicolor]
 gi|241920937|gb|EER94081.1| hypothetical protein SORBIDRAFT_01g019330 [Sorghum bicolor]
          Length = 1165

 Score = 38.1 bits (87), Expect = 2.2,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 44/125 (35%), Gaps = 7/125 (5%)

Query: 218 KDHFISVLLRFFLHGQLKLPDEDIVFT----ISFFSLEEQRAIYLKIAQNSVISGKRKIG 273
                 +++   L        ED   T    +S    +EQ A+Y  IA+ +  +    + 
Sbjct: 467 ASSLFKIIVESHLKAAADSAFEDTDDTEYFHVSVSKRDEQLALYALIARAAADTTIPFLA 526

Query: 274 FLAIKQLKRIIDRLDYKDLATIQ--LYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYL 331
            L  ++  R+  R    D       LY  +L    V   S +  T  IP   L      +
Sbjct: 527 QLFSERFARLNQRNGESDPTQTLEELYWLLLVTSHVLTDSGEGETLLIPEA-LQAGFPNV 585

Query: 332 KKASE 336
            +A++
Sbjct: 586 IEAAQ 590


>gi|238927538|ref|ZP_04659298.1| lipid-A-disaccharide synthase [Selenomonas flueggei ATCC 43531]
 gi|238884820|gb|EEQ48458.1| lipid-A-disaccharide synthase [Selenomonas flueggei ATCC 43531]
          Length = 374

 Score = 38.1 bits (87), Expect = 2.2,   Method: Composition-based stats.
 Identities = 19/163 (11%), Positives = 52/163 (31%), Gaps = 4/163 (2%)

Query: 124 GQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEE 183
           G  + + +    +    +   I  +L        +   ++ A+       + + GT + E
Sbjct: 211 GVADPARRFFLPVAGGVDEESIRAHLAASPAEVTLTHDARYALMGLSRAAMATSGTVVME 270

Query: 184 IALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVF 243
            AL  L  +    +   ++   R  V     S+             L G   +    I  
Sbjct: 271 AALMGLPAVVLYRLSALSYLIGRLLVDVPRFSLPNILLGETFETELLQG--AVQPVRIAE 328

Query: 244 TISFFSLEEQRAIYL--KIAQNSVISGKRKIGFLAIKQLKRII 284
            +     +    +Y+  ++++ + + G       A +++  + 
Sbjct: 329 EMEKIIADGADRLYVTERLSRAAAMLGAPHAARRAAEKILALG 371


>gi|319897487|ref|YP_004135684.1| tRNA modification gtpase mnme [Haemophilus influenzae F3031]
 gi|317432993|emb|CBY81364.1| tRNA modification GTPase mnmE [Haemophilus influenzae F3031]
          Length = 452

 Score = 38.1 bits (87), Expect = 2.4,   Method: Composition-based stats.
 Identities = 45/246 (18%), Positives = 82/246 (33%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D +RL  PG F E+  L + L++ Q E + +         V     S         
Sbjct: 95  ILQIDGIRLARPGEFSEQAFLNDKLDLAQAEAIADLIDATSEQAVRSALKSLQGEFSKKV 154

Query: 216 -------IYKD-------HFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F + G+++     I+  +     E ++   L+  
Sbjct: 155 NELVDSVIYLRTYVEASIDFPDEEIDFLVDGKIEANLRGIINQLEDVRSEAKQGSILREG 214

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 215 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 261

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQK-DLLLDKKEPRHTNVSMGIESFIK 379
             L   D   L+ A + +   IG S    + E   +  L+LD  +P   ++S     F+ 
Sbjct: 262 MPLHIIDTAGLRDAIDEV-ERIGISRAWTEIEQADRIILMLDSSDPESADLSKVRSEFLA 320

Query: 380 KNRSQI 385
           K  S +
Sbjct: 321 KLPSTL 326


>gi|219854396|ref|YP_002471518.1| hypothetical protein CKR_1053 [Clostridium kluyveri NBRC 12016]
 gi|219568120|dbj|BAH06104.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 260

 Score = 38.1 bits (87), Expect = 2.5,   Method: Composition-based stats.
 Identities = 28/139 (20%), Positives = 54/139 (38%), Gaps = 3/139 (2%)

Query: 249 SLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQL---YENILNIP 305
             + +R   L  A       + +    A ++  +      Y+D +       Y   +   
Sbjct: 59  DAQRKREEILSKAYEEAGKIEEEAYKKANEKGYKEGYEKGYEDGSKKAYEEGYAKNIEKA 118

Query: 306 FVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEP 365
            V+   +     +I   S+ E++RYLK+  E I   I  S+  I  + I+ +  L+    
Sbjct: 119 RVEGEEIISKADSILKASVEEKNRYLKEKEEEIKRFIVDSIESILRQEIKDEDSLNTMVF 178

Query: 366 RHTNVSMGIESFIKKNRSQ 384
              +    IE+FI K+R +
Sbjct: 179 NELSQVRNIETFIIKSRKK 197


>gi|153953780|ref|YP_001394545.1| hypothetical protein CKL_1155 [Clostridium kluyveri DSM 555]
 gi|146346661|gb|EDK33197.1| FliH [Clostridium kluyveri DSM 555]
          Length = 254

 Score = 38.1 bits (87), Expect = 2.5,   Method: Composition-based stats.
 Identities = 28/139 (20%), Positives = 54/139 (38%), Gaps = 3/139 (2%)

Query: 249 SLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQL---YENILNIP 305
             + +R   L  A       + +    A ++  +      Y+D +       Y   +   
Sbjct: 53  DAQRKREEILSKAYEEAGKIEEEAYKKANEKGYKEGYEKGYEDGSKKAYEEGYAKNIEKA 112

Query: 306 FVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEP 365
            V+   +     +I   S+ E++RYLK+  E I   I  S+  I  + I+ +  L+    
Sbjct: 113 RVEGEEIISKADSILKASVEEKNRYLKEKEEEIKRFIVDSIESILRQEIKDEDSLNTMVF 172

Query: 366 RHTNVSMGIESFIKKNRSQ 384
              +    IE+FI K+R +
Sbjct: 173 NELSQVRNIETFIIKSRKK 191


>gi|162453139|ref|YP_001615506.1| hypothetical protein sce4863 [Sorangium cellulosum 'So ce 56']
 gi|161163721|emb|CAN95026.1| putative membrane protein [Sorangium cellulosum 'So ce 56']
          Length = 406

 Score = 38.1 bits (87), Expect = 2.6,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 25/58 (43%)

Query: 161 SSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYK 218
            S  A+ +FD     +PG  L E AL   LE+ Q    E A      Y+ ++ H  Y 
Sbjct: 339 DSADALAWFDTYLREAPGGALREQALGRSLELQQRRDREVARRAALRYLAEYPHGAYA 396


>gi|148826352|ref|YP_001291105.1| tRNA modification GTPase TrmE [Haemophilus influenzae PittEE]
 gi|166200480|sp|A5UD71|MNME_HAEIE RecName: Full=tRNA modification GTPase mnmE
 gi|148716512|gb|ABQ98722.1| tRNA modification GTPase TrmE [Haemophilus influenzae PittEE]
          Length = 452

 Score = 38.1 bits (87), Expect = 2.6,   Method: Composition-based stats.
 Identities = 44/246 (17%), Positives = 81/246 (32%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D +RL  PG F E+  L + L++ Q E + +               S         
Sbjct: 95  ILQIDGIRLARPGEFSEQAFLNDKLDLAQAEAIADLIDATSEQAARSALKSLQGEFSKKV 154

Query: 216 -------IYKD-------HFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++     I+  +     E ++   L+  
Sbjct: 155 NELVDSVIYLRTYVEASIDFPDEEIDFLADGKIEANLRGIINQLENVRSEAKQGSILREG 214

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 215 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 261

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQK-DLLLDKKEPRHTNVSMGIESFIK 379
             L   D   L+ A++ +   IG S    + E   +  L+LD  +P   ++S     F+ 
Sbjct: 262 MPLHIIDTAGLRDATDEV-ERIGISRAWTEIEQADRIILMLDSSDPESADLSKVRSEFLA 320

Query: 380 KNRSQI 385
           K  S +
Sbjct: 321 KLPSTL 326


>gi|119637782|ref|YP_919018.1| Internal virion protein D [Yersinia phage Berlin]
 gi|119391813|emb|CAJ70686.1| hypothetical protein [Yersinia phage Berlin]
          Length = 1315

 Score = 38.1 bits (87), Expect = 2.7,   Method: Composition-based stats.
 Identities = 8/55 (14%), Positives = 19/55 (34%), Gaps = 2/55 (3%)

Query: 41   RALDEAMRGDIS--LQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQ 93
               D    G  +  + +    ++K    +   +  + F ++R +D    Y I   
Sbjct: 1089 SLQDSHAFGATAKLVLQFKSFVIKSMNSKFIRSGNEAFKNHRAMDMALTYAISGG 1143


>gi|312436382|gb|ADQ83191.1| internal virion protein D [Yersinia phage Yep-phi]
          Length = 1315

 Score = 38.1 bits (87), Expect = 2.7,   Method: Composition-based stats.
 Identities = 8/55 (14%), Positives = 19/55 (34%), Gaps = 2/55 (3%)

Query: 41   RALDEAMRGDIS--LQKKIPDIVKETGVQLRATHMDVFVDNRNIDAVWIYTIISQ 93
               D    G  +  + +    ++K    +   +  + F ++R +D    Y I   
Sbjct: 1089 SLQDSHAFGATAKLVLQFKSFVIKSMNSKFIRSGNEAFKNHRAMDMALTYAISGG 1143


>gi|68249586|ref|YP_248698.1| tRNA modification GTPase TrmE [Haemophilus influenzae 86-028NP]
 gi|81335985|sp|Q4QLQ9|MNME_HAEI8 RecName: Full=tRNA modification GTPase mnmE
 gi|68057785|gb|AAX88038.1| probable tRNA modification GTPase TrmE [Haemophilus influenzae
           86-028NP]
          Length = 452

 Score = 38.1 bits (87), Expect = 2.7,   Method: Composition-based stats.
 Identities = 44/246 (17%), Positives = 81/246 (32%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D +RL  PG F E+  L + L++ Q E + +               S         
Sbjct: 95  ILQIDGIRLARPGEFSEQAFLNDKLDLAQAEAIADLIDATSEQAARSALKSLQGEFSKKV 154

Query: 216 -------IYKD-------HFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++     I+  +     E ++   L+  
Sbjct: 155 NELVDSVIYLRTYVEASIDFPDEEIDFLADGKIEANLRGIINQLENVRSEAKQGSILREG 214

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 215 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 261

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQK-DLLLDKKEPRHTNVSMGIESFIK 379
             L   D   L+ A++ +   IG S    + E   +  L+LD  +P   ++S     F+ 
Sbjct: 262 MPLHIIDTAGLRDATDEV-ERIGISRAWTEIEQADRIILMLDSSDPESADLSKVRSEFLA 320

Query: 380 KNRSQI 385
           K  S +
Sbjct: 321 KLPSTL 326


>gi|145634177|ref|ZP_01789888.1| tRNA modification GTPase [Haemophilus influenzae PittAA]
 gi|145268621|gb|EDK08614.1| tRNA modification GTPase [Haemophilus influenzae PittAA]
          Length = 452

 Score = 38.1 bits (87), Expect = 2.7,   Method: Composition-based stats.
 Identities = 44/246 (17%), Positives = 81/246 (32%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D +RL  PG F E+  L + L++ Q E + +               S         
Sbjct: 95  ILQIDGIRLARPGEFSEQAFLNDKLDLAQAEAIADLIDATSEQAARSALKSLQGEFSKKV 154

Query: 216 -------IYKD-------HFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++     I+  +     E ++   L+  
Sbjct: 155 NELVDSVIYLRTYVEASIDFPDEEIDFLADGKIEANLRGIINQLENVRSEAKQGSILREG 214

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 215 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 261

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQK-DLLLDKKEPRHTNVSMGIESFIK 379
             L   D   L+ A++ +   IG S    + E   +  L+LD  +P   ++S     F+ 
Sbjct: 262 MPLHIIDTAGLRDATDEV-ERIGISRAWTEIEQADRIILMLDSSDPESADLSKVRSEFLA 320

Query: 380 KNRSQI 385
           K  S +
Sbjct: 321 KLPSTL 326


>gi|87121473|ref|ZP_01077362.1| Response regulator receiver domain protein (CheY) [Marinomonas sp.
           MED121]
 gi|86163316|gb|EAQ64592.1| Response regulator receiver domain protein (CheY) [Marinomonas sp.
           MED121]
          Length = 538

 Score = 38.1 bits (87), Expect = 2.7,   Method: Composition-based stats.
 Identities = 31/229 (13%), Positives = 69/229 (30%), Gaps = 41/229 (17%)

Query: 169 FDYVRLTSPGTFLEEIALRNLLE-----ITQNEVGERAFGYIRAYVTQFHHSIYKDHFIS 223
            D+  +       EE +L + +      I Q     +AF  +  Y+ +   S     F+ 
Sbjct: 193 LDWAMVLEARVMREEASLSDAISHLNQVIAQFPNCIKAFDLLAQYLEEEGDSEQAQDFLE 252

Query: 224 VLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRI 283
             +        +                +Q  + L +A     +G   +   + +   ++
Sbjct: 253 SAVELSPRVMSR----------------QQSLVNLSLA-----NGNLDVALKSSQHALKL 291

Query: 284 IDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIG 343
                        LY +         +   +            + R   + +  I++++ 
Sbjct: 292 SAN---------SLYASA-----DQFLQAAQVLSESVIGDTSPEGRKKAQEAFTILNQMT 337

Query: 344 KSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIESIDVLL 392
           K   D    H+ K L+  +        +    +F K+ +S IE    LL
Sbjct: 338 KKYPDDTSTHLNKILIESQLLSGQGKTNQANLAF-KEAQSIIEDQKELL 385


>gi|302543430|ref|ZP_07295772.1| putative oxidoreductase [Streptomyces hygroscopicus ATCC 53653]
 gi|302461048|gb|EFL24141.1| putative oxidoreductase [Streptomyces himastatinicus ATCC 53653]
          Length = 914

 Score = 38.1 bits (87), Expect = 2.8,   Method: Composition-based stats.
 Identities = 24/200 (12%), Positives = 53/200 (26%), Gaps = 16/200 (8%)

Query: 95  LSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIG 154
             +++ L   + +         AL+ Y +       +       +    G  P L   + 
Sbjct: 627 PRILELLALAEEQPELP-----ALRPYLADTDPAVRRAAVATLTESAPPGTGPALAEALA 681

Query: 155 RAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQFH- 213
                  +  A    + V +  P     + ALR  L                  +     
Sbjct: 682 DPDAGVRAGAAASLRELVEVLPP-----DAALRESLLHALEVTDPAVRAAALDVLRALGL 736

Query: 214 --HSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRK 271
               ++        +   L     L   D +  +   + +  R +  ++A    + G   
Sbjct: 737 GDAELFARALKDAAIEVRLQAVRGLVSVDALTALEPGAADASREV--RVATAGAL-GTLA 793

Query: 272 IGFLAIKQLKRIIDRLDYKD 291
            G  A +  + +   L   D
Sbjct: 794 PGGPAAEARRLLTPLLGDAD 813


>gi|225076118|ref|ZP_03719317.1| hypothetical protein NEIFLAOT_01150 [Neisseria flavescens
           NRL30031/H210]
 gi|224952537|gb|EEG33746.1| hypothetical protein NEIFLAOT_01150 [Neisseria flavescens
           NRL30031/H210]
          Length = 486

 Score = 37.7 bits (86), Expect = 2.9,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 26/82 (31%), Gaps = 10/82 (12%)

Query: 64  TGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKD-TKGYFDIAIV---YALK 119
            G    A +  +  D        I  +      +V  L+A    +   +  ++    AL 
Sbjct: 71  VGDDFLAANPRILED------ALIQALNGNSADLVSSLVALYRKQPNHNPKLIARADALL 124

Query: 120 KYFSGQLEESSKELSKIKDKDN 141
               G+  E+ +    + + D 
Sbjct: 125 AKLKGRTSEAVERYRTLYESDV 146


>gi|254473317|ref|ZP_05086714.1| hypothetical protein PJE062_4139 [Pseudovibrio sp. JE062]
 gi|211957433|gb|EEA92636.1| hypothetical protein PJE062_4139 [Pseudovibrio sp. JE062]
          Length = 129

 Score = 37.7 bits (86), Expect = 3.2,   Method: Composition-based stats.
 Identities = 8/91 (8%), Positives = 29/91 (31%), Gaps = 1/91 (1%)

Query: 265 VISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSL 324
           ++SG         +         + + +   +LY +       D         ++    L
Sbjct: 1   MVSGNTAFAVKGSEAFLEHGSE-NAEQINEAKLYLSAAKASGEDWEEAITGLVDVKSTDL 59

Query: 325 MEQDRYLKKASEIIMSEIGKSLIDIDFEHIQ 355
             +++ L+ ++  + + I +       +  +
Sbjct: 60  SPENQLLQISAIAMANTIREWPQPETPDASE 90


>gi|86607067|ref|YP_475830.1| ribosomal subunit interface protein [Synechococcus sp. JA-3-3Ab]
 gi|86555609|gb|ABD00567.1| ribosomal subunit interface protein [Synechococcus sp. JA-3-3Ab]
          Length = 191

 Score = 37.7 bits (86), Expect = 3.4,   Method: Composition-based stats.
 Identities = 17/109 (15%), Positives = 42/109 (38%), Gaps = 17/109 (15%)

Query: 113 AIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYV 172
            I  A++ Y   ++E + K  ++I  +            +     +  + + + +    V
Sbjct: 12  EITDAIRSYVQEKIERAVKHFAQITSE------------VDVNLSVARNPRISANQSAEV 59

Query: 173 RLTSPGTFL--EEIA--LRNLLEITQNEVGERAFGYI-RAYVTQFHHSI 216
            + + GT +  EE +  L   ++   +++  +   Y  R  V +  HS 
Sbjct: 60  TVYANGTVIRAEESSENLYASIDRVADKLARKLRKYKERNGVHRIRHSP 108


>gi|145630099|ref|ZP_01785881.1| tRNA modification GTPase [Haemophilus influenzae R3021]
 gi|144984380|gb|EDJ91803.1| tRNA modification GTPase [Haemophilus influenzae R3021]
          Length = 452

 Score = 37.3 bits (85), Expect = 4.1,   Method: Composition-based stats.
 Identities = 43/246 (17%), Positives = 81/246 (32%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D +RL  PG F E+  L + L++ Q E + +               S         
Sbjct: 95  ILQIDGIRLARPGEFSEQAFLNDKLDLAQAEAIADLIDATSEQAARSALKSLQGEFSKKV 154

Query: 216 -------IYKD-------HFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++     I+  +     E ++   L+  
Sbjct: 155 NTLVDSVIYLRTYVEASIDFPDEEIDFLADGKIEANLRGIINQLENVRSEAKQGSILREG 214

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 215 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 261

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQK-DLLLDKKEPRHTNVSMGIESFIK 379
             L   D   L+ A++ +   IG S    + E   +  L+LD  +P   +++     F+ 
Sbjct: 262 MPLHIIDTAGLRDATDEV-ERIGISRAWTEIEQADRIILMLDSSDPESVDLTKVRSEFLA 320

Query: 380 KNRSQI 385
           K  S +
Sbjct: 321 KLPSTL 326


>gi|329297851|ref|ZP_08255187.1| LppC family lipoprotein [Plautia stali symbiont]
          Length = 664

 Score = 37.3 bits (85), Expect = 4.2,   Method: Composition-based stats.
 Identities = 22/127 (17%), Positives = 49/127 (38%), Gaps = 5/127 (3%)

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
           +  +  GK         QL ++  +L       + L    L I   D    Q+    I  
Sbjct: 55  RALLKEGKYPQAQ---NQLGQLPQQLSDVQQQELLLLRAQLQIAQQDFNGAQQLLGQIKA 111

Query: 322 YSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKN 381
             L  QD+ ++  + +I +   +  + +   +I ++ LL K     +N+    ++  +  
Sbjct: 112 ADLS-QDQQVRYYALLIAAAQNRPSLALLRAYIAQEPLL-KGADHQSNIDATWQALTQLT 169

Query: 382 RSQIESI 388
           + Q+ S+
Sbjct: 170 QDQLNSV 176


>gi|198284469|ref|YP_002220790.1| tetratricopeptide repeat-containing protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|198248990|gb|ACH84583.1| Tetratricopeptide TPR_2 repeat protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
          Length = 553

 Score = 37.3 bits (85), Expect = 4.4,   Method: Composition-based stats.
 Identities = 32/168 (19%), Positives = 58/168 (34%), Gaps = 16/168 (9%)

Query: 138 DKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIALRNLL-EITQNE 196
             D   G   Y  L+   A +    Q A+  +      +P    E   LR     I +  
Sbjct: 26  PSDGMTGEQLYYLLVAEFATVQRQPQLAIPAWQKAAKLAP----EPNVLRRATQAIARFG 81

Query: 197 VGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAI 256
             + A    R +      S   D F + L      GQ +   + +  T++ F  + +  +
Sbjct: 82  DFQDALQLARRWRQAAPGSAEADQFEAAL--LLTTGQDEQALQLLQATLARFPDDPK--V 137

Query: 257 YLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNI 304
            L+ A+  V  G+         + +R++  L  KD  +   Y  +  I
Sbjct: 138 TLQFAELLVTHGR-------SGEARRLLSALADKDPKSAAAYYALGRI 178


>gi|288576394|ref|ZP_06394362.1| hypothetical periplasmic protein [Neisseria mucosa ATCC 25996]
 gi|288565633|gb|EFC87193.1| hypothetical periplasmic protein [Neisseria mucosa ATCC 25996]
          Length = 513

 Score = 37.3 bits (85), Expect = 4.7,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 25/82 (30%), Gaps = 10/82 (12%)

Query: 64  TGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKD-TKGYFDIAIV---YALK 119
            G    A +  +  D        I  +      +V  L A    +   +  ++    AL 
Sbjct: 71  VGDDFLAANPRILED------ALIQALNGNSADLVSSLAALYRKQPNHNPKLIARADALL 124

Query: 120 KYFSGQLEESSKELSKIKDKDN 141
               G+  E+ +    + + D 
Sbjct: 125 AKLKGRTSEAVERYRTLYESDV 146


>gi|162455350|ref|YP_001617717.1| hypothetical protein sce7068 [Sorangium cellulosum 'So ce 56']
 gi|161165932|emb|CAN97237.1| hypothetical protein sce7068 [Sorangium cellulosum 'So ce 56']
          Length = 527

 Score = 37.3 bits (85), Expect = 4.7,   Method: Composition-based stats.
 Identities = 21/118 (17%), Positives = 44/118 (37%), Gaps = 4/118 (3%)

Query: 98  VDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAM 157
           +D  IA         A+  A +  ++G+ + + + L   + +            L+GR  
Sbjct: 399 IDATIAASPLPEI-AALADAAR--YTGRNDLARRALLAERARFPGSPEARSAAFLLGRMA 455

Query: 158 MPFSSQQAVHFFDYVRLTSP-GTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQFHH 214
              S   A+ ++D     SP G+   E   R ++ +  ++    A      Y+ +  H
Sbjct: 456 EAGSPAAAIDWYDRYLAESPAGSLAAEALGRKMVVLRASQGDGAARPIAAQYLARHPH 513


>gi|260581920|ref|ZP_05849716.1| tRNA modification GTPase TrmE [Haemophilus influenzae NT127]
 gi|260095113|gb|EEW79005.1| tRNA modification GTPase TrmE [Haemophilus influenzae NT127]
          Length = 452

 Score = 37.3 bits (85), Expect = 4.8,   Method: Composition-based stats.
 Identities = 44/246 (17%), Positives = 80/246 (32%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D +RL  PG F E+  L +  ++ Q E + +               S         
Sbjct: 95  ILQIDGIRLARPGEFSEQAFLNDKFDLAQAEAIADLIDATSEQAARSALKSLQGEFSKKV 154

Query: 216 -------IYKD-------HFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++     I+  +     E ++   L+  
Sbjct: 155 NELVDSVIYLRTYVEASIDFPDEEIDFLADGKIEANLRGIINQLEDVRAEAKQGSILREG 214

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 215 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 261

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQK-DLLLDKKEPRHTNVSMGIESFIK 379
             L   D   L+ A++ +   IG S    + E   +  L+LD  +P   N+S     F+ 
Sbjct: 262 MPLHIIDTAGLRDATDEV-ERIGISRAWTEIEQADRIILMLDSSDPESVNLSKVRSEFLA 320

Query: 380 KNRSQI 385
           K  S +
Sbjct: 321 KLPSTL 326


>gi|329123024|ref|ZP_08251595.1| tRNA modification GTPase TrmE [Haemophilus aegyptius ATCC 11116]
 gi|327471955|gb|EGF17395.1| tRNA modification GTPase TrmE [Haemophilus aegyptius ATCC 11116]
          Length = 461

 Score = 36.9 bits (84), Expect = 4.8,   Method: Composition-based stats.
 Identities = 45/246 (18%), Positives = 82/246 (33%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D +RL  PG F E+  L + L++ Q E + +  +      V     S         
Sbjct: 104 ILQIDGIRLARPGEFSEQAFLNDKLDLAQAEAIADLIYATSEQAVRSALKSLQGEFSKKV 163

Query: 216 -------IYKD-------HFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++     I+  +     E ++   L+  
Sbjct: 164 NELVDSVIYLRTYVEASIDFPDEEIDFLADGKIEANLRGIINQLEDVRSEAKQGSILREG 223

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 224 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 270

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQK-DLLLDKKEPRHTNVSMGIESFIK 379
             L   D   L+ A + +   IG S    + E   +  L+LD  +P   ++S     F+ 
Sbjct: 271 MPLHIIDTAGLRDAIDEV-ERIGISRAWTEIEQADRIILMLDSSDPESADLSKVRSEFLA 329

Query: 380 KNRSQI 385
           K  S +
Sbjct: 330 KLPSTL 335


>gi|332703856|ref|ZP_08423944.1| Glycyl-tRNA synthetase beta subunit [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332554005|gb|EGJ51049.1| Glycyl-tRNA synthetase beta subunit [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 696

 Score = 36.9 bits (84), Expect = 5.1,   Method: Composition-based stats.
 Identities = 39/253 (15%), Positives = 75/253 (29%), Gaps = 31/253 (12%)

Query: 102 IAKDTKGYFD--IAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMP 159
           +  D  G FD    I+  +     G+ E  ++ +++           P        AM  
Sbjct: 396 LVTDMVGEFDTLQGIMGGIYARKKGKGETVAQAIAEQYLPTGPDSPTPQSLAGALLAMAD 455

Query: 160 FSSQQAVHF-FDYVRLTSPGTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYK 218
            +   A  F  D V    P    +  ALR         V +         + +  H +Y 
Sbjct: 456 KADTLAGTFGLDMV----PTGAADPYALRRQALGICRIVIDHGLRLSLTDLLRTAHGVYG 511

Query: 219 DHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYL-------KIAQNSVISGKRK 271
           D    +            PDE +   + FF   ++   Y         + +  + +G   
Sbjct: 512 DVQWKLA-----------PDESLRKLLDFF--GQRIKAYFTAKGHETLVVEACLGAGIDD 558

Query: 272 IGFLAIKQLKRIID-RLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSL--MEQD 328
           I     ++L+ + +          +  ++   NI          +        L   E +
Sbjct: 559 IWAF-SRRLEALSEFSRGEGFEQAVLTFKRAANIIRKQGSEAGVALDGAYEKRLLESEHE 617

Query: 329 RYLKKASEIIMSE 341
           R L +A E +   
Sbjct: 618 RELAQAIEAVSPR 630


>gi|309973499|gb|ADO96700.1| tRNA modification GTPase mnmE [Haemophilus influenzae R2846]
          Length = 461

 Score = 36.9 bits (84), Expect = 5.1,   Method: Composition-based stats.
 Identities = 44/246 (17%), Positives = 81/246 (32%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D +RL  PG F E+  L + L++ Q E + +               S         
Sbjct: 104 ILQIDGIRLARPGEFSEQAFLNDKLDLAQAEAIADLIDATSEQAARSALKSLQGEFSKKV 163

Query: 216 -------IYKD-------HFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++     I+  +     E ++   L+  
Sbjct: 164 NTLVDSVIYLRTYVEASIDFPDEEIDFLADGKIEANLRGIINQLEDVRSEAKQGSILREG 223

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 224 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 270

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQK-DLLLDKKEPRHTNVSMGIESFIK 379
             L   D   L+ A++ +   IG S    + E   +  L+LD  +P   ++S     F+ 
Sbjct: 271 MPLHIIDTAGLRDATDEV-ERIGISRAWTEIEQADRIILMLDSSDPESADLSKVRSEFLA 329

Query: 380 KNRSQI 385
           K  S +
Sbjct: 330 KLPSTL 335


>gi|229846059|ref|ZP_04466171.1| tRNA modification GTPase TrmE [Haemophilus influenzae 7P49H1]
 gi|229811063|gb|EEP46780.1| tRNA modification GTPase TrmE [Haemophilus influenzae 7P49H1]
          Length = 452

 Score = 36.9 bits (84), Expect = 5.3,   Method: Composition-based stats.
 Identities = 45/246 (18%), Positives = 82/246 (33%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D +RL  PG F E+  L + L++ Q E + +         V     S         
Sbjct: 95  ILQIDGIRLARPGEFSEQAFLNDKLDLAQAEAIADLIDATSEQAVRSALKSLQGEFSKKV 154

Query: 216 -------IYKD-------HFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++     I+  +     E ++   L+  
Sbjct: 155 NALVDSVIYLRTYVEASIDFPDEEIDFLADGKIEANLRGIINQLEDVRSEAKQGSILREG 214

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 215 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 261

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQK-DLLLDKKEPRHTNVSMGIESFIK 379
             L   D   L+ A++ +   IG S    + E   +  L+LD  +P   ++S     F+ 
Sbjct: 262 MPLHIIDTAGLRDATDEV-ERIGISRAWTEIEQADRIILMLDSSDPESVDLSKVRSEFLA 320

Query: 380 KNRSQI 385
           K  S +
Sbjct: 321 KLPSTL 326


>gi|307151519|ref|YP_003886903.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7822]
 gi|306981747|gb|ADN13628.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7822]
          Length = 1426

 Score = 36.9 bits (84), Expect = 5.4,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 20/53 (37%), Gaps = 4/53 (7%)

Query: 7    ICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPD 59
            I    +A  +  S     D        + V+SLQ   D    GD+ L K++  
Sbjct: 1285 INIFALAEALQNSQPITVDTTSK----EMVKSLQYLQDSLCAGDLELMKEMIQ 1333


>gi|94496583|ref|ZP_01303159.1| DNA mismatch repair protein MutS [Sphingomonas sp. SKA58]
 gi|94423943|gb|EAT08968.1| DNA mismatch repair protein MutS [Sphingomonas sp. SKA58]
          Length = 914

 Score = 36.9 bits (84), Expect = 5.5,   Method: Composition-based stats.
 Identities = 14/95 (14%), Positives = 29/95 (30%), Gaps = 9/95 (9%)

Query: 240 DIVFTISFFSLEEQRAIYLKIAQNS------VISGKRKIGFLAIKQLKRIIDRLDYKDLA 293
           D+V           R+  L +A+ +      +   K  +  L   + K         DL 
Sbjct: 805 DLVLLHELAQGPADRSYGLAVARLAGLPPAVLKRAKDVLARLEAGKAKTGGIAAGLDDLP 864

Query: 294 TIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQD 328
              L+          +  L+ +   I   +L  ++
Sbjct: 865 ---LFAAAAAQEDEPVDPLREAIEAIDADALSPRE 896


>gi|326333253|ref|ZP_08199500.1| acetyl-CoA C-acyltransferase [Nocardioidaceae bacterium Broad-1]
 gi|325948897|gb|EGD40990.1| acetyl-CoA C-acyltransferase [Nocardioidaceae bacterium Broad-1]
          Length = 408

 Score = 36.9 bits (84), Expect = 5.5,   Method: Composition-based stats.
 Identities = 27/164 (16%), Positives = 48/164 (29%), Gaps = 22/164 (13%)

Query: 91  ISQDLSVVDDLIAKDTKGY------FDIAIVYALKK--YFSGQLEESSKELSKIKDKDNT 142
             ++ ++          G        D      L+   Y +G +   +  L      ++ 
Sbjct: 63  NGENPAIGRIAALDAGLGTGVPGLQIDRRCGSGLQAILYAAGSVATGAANLVIAGGAESM 122

Query: 143 RGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTS-------PGTFLEEIA-LRNLLEITQ 194
             +  Y   L G         + +   D  R T+       PG  +E    LR    I++
Sbjct: 123 SNVEHYALGLRGGV--KQGGIELLDRLDRARETAGGKDHPIPGGMIETAENLRREYGISR 180

Query: 195 NEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPD 238
            E  E A    +  V           F   L+   + G  + PD
Sbjct: 181 EEQDEFALRSNQRAVAAHE----AGKFADELVPVTVPGGRRKPD 220


>gi|301169727|emb|CBW29328.1| GTPase [Haemophilus influenzae 10810]
          Length = 452

 Score = 36.9 bits (84), Expect = 5.5,   Method: Composition-based stats.
 Identities = 45/246 (18%), Positives = 82/246 (33%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D +RL  PG F E+  L + L++ Q E + +         V     S         
Sbjct: 95  ILQIDGIRLARPGEFSEQAFLNDKLDLAQAEAIADLIDATSEQAVRSALKSLQGEFSKKV 154

Query: 216 -------IYKD-------HFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++     I+  +     E ++   L+  
Sbjct: 155 NELVDSVIYLRTYVEASIDFPDEEIDFLADGKIEANLRGIINQLEDVRSEAKQGSILREG 214

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 215 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 261

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQK-DLLLDKKEPRHTNVSMGIESFIK 379
             L   D   L+ A++ +   IG S    + E   +  L+LD  +P   ++S     F+ 
Sbjct: 262 MPLHIIDTAGLRDATDEV-ERIGISRAWTEIEQADRIILMLDSSDPESADLSKVRSEFLA 320

Query: 380 KNRSQI 385
           K  S +
Sbjct: 321 KLPSTL 326


>gi|254720432|ref|ZP_05182243.1| ATP-dependent DNA helicase RecG [Brucella sp. 83/13]
 gi|265985452|ref|ZP_06098187.1| ATP-dependent DNA helicase RecG [Brucella sp. 83/13]
 gi|306838991|ref|ZP_07471812.1| ATP-dependent DNA helicase RecG [Brucella sp. NF 2653]
 gi|264664044|gb|EEZ34305.1| ATP-dependent DNA helicase RecG [Brucella sp. 83/13]
 gi|306405897|gb|EFM62155.1| ATP-dependent DNA helicase RecG [Brucella sp. NF 2653]
          Length = 706

 Score = 36.9 bits (84), Expect = 5.7,   Method: Composition-based stats.
 Identities = 22/141 (15%), Positives = 51/141 (36%), Gaps = 5/141 (3%)

Query: 177 PGTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYK--DHFISVLLRFFLHGQL 234
           PG    E   R  L   +   G+ A   +RA   +      +   + ++ ++R   +   
Sbjct: 221 PGDIALESITRRRLAYDEFLAGQLALALVRAKTRRLSGRPLEGTGNIVAEIMRQLPYRLT 280

Query: 235 KLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLAT 294
           K  ++ +   I+     ++    L++ Q  V SGK  +G LA+        +        
Sbjct: 281 KAQEQAVREIITDLKSPQRM---LRLLQGDVGSGKTVVGLLAMAHAAESGGQSALMAPTE 337

Query: 295 IQLYENILNIPFVDIMSLQRS 315
           +   ++   I  +   +  ++
Sbjct: 338 VLARQHFATIAPLAEKAGLKA 358


>gi|145640677|ref|ZP_01796260.1| tRNA modification GTPase [Haemophilus influenzae R3021]
 gi|145274603|gb|EDK14466.1| tRNA modification GTPase [Haemophilus influenzae 22.4-21]
          Length = 452

 Score = 36.9 bits (84), Expect = 5.9,   Method: Composition-based stats.
 Identities = 45/246 (18%), Positives = 82/246 (33%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D +RL  PG F E+  L + L++ Q E + +         V     S         
Sbjct: 95  ILQIDGIRLARPGEFSEQAFLNDKLDLAQAEAIADLIDATSEQAVRSALKSLQGEFSKKV 154

Query: 216 -------IYKD-------HFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++     I+  +     E ++   L+  
Sbjct: 155 NELVDSVIYLRTYVEASIDFPDEEIDFLADGKIEANLRGIINQLEDVRSEAKQGSILREG 214

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 215 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 261

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQK-DLLLDKKEPRHTNVSMGIESFIK 379
             L   D   L+ A++ +   IG S    + E   +  L+LD  +P   ++S     F+ 
Sbjct: 262 MPLHIIDTAGLRDATDEV-ERIGISRAWTEIEQADRIILMLDSSDPESADLSKVRSEFLA 320

Query: 380 KNRSQI 385
           K  S +
Sbjct: 321 KLPSTL 326


>gi|115482520|ref|NP_001064853.1| Os10g0477000 [Oryza sativa Japonica Group]
 gi|78708814|gb|ABB47789.1| expressed protein [Oryza sativa Japonica Group]
 gi|113639462|dbj|BAF26767.1| Os10g0477000 [Oryza sativa Japonica Group]
          Length = 1166

 Score = 36.9 bits (84), Expect = 5.9,   Method: Composition-based stats.
 Identities = 22/111 (19%), Positives = 39/111 (35%), Gaps = 6/111 (5%)

Query: 218 KDHFISVLLRFFLHGQLKLPDEDIVFT----ISFFSLEEQRAIYLKIAQNSVISGKRKIG 273
                 +++   L        ED        +S    +EQ A+Y +IA+++  +    + 
Sbjct: 467 ASSLFKIIVESHLKAAADSAFEDTDDAEYFHVSVSKRDEQLALYAQIARSAADTTIPFLA 526

Query: 274 FLAIKQLKRIIDRLDYKDLATIQ--LYENILNIPFVDIMSLQRSTCNIPYY 322
            L  ++  R+  R    D       LY  +L    V   S +  T  IP  
Sbjct: 527 QLFSERFARLSQRNGENDPTQTLEELYWLLLITSHVLTDSGEGETLLIPEA 577


>gi|313668665|ref|YP_004048949.1| periplasmic protein [Neisseria lactamica ST-640]
 gi|313006127|emb|CBN87588.1| putative periplasmic protein [Neisseria lactamica 020-06]
          Length = 614

 Score = 36.9 bits (84), Expect = 6.3,   Method: Composition-based stats.
 Identities = 20/171 (11%), Positives = 49/171 (28%), Gaps = 3/171 (1%)

Query: 188 NLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISF 247
             LE+  +         I     Q      K    +  LR  L  +     + +   ++ 
Sbjct: 106 RALEMAVSLNAFEQAEMIYQKWRQIEPIPGKAQKRAGWLRNVLRERGNQHLDGLEEVLAQ 165

Query: 248 FSLEEQRAIYLKIAQNSVI-SGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPF 306
               + R ++L +AQ +V   G  +    A+++       L     A   +  ++     
Sbjct: 166 ADEGQNRRVFLLLAQAAVQQDGLAQKASKAVRRASLEYGHLPEA--AVADVVFSLQAREK 223

Query: 307 VDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKD 357
              ++  +    +    L      L+  +      +       D  ++   
Sbjct: 224 EKAIAALQRLSKLDAEILPPTFIALRLTARQYPEILDGFFQQTDTRNLSSA 274


>gi|145628055|ref|ZP_01783856.1| tRNA modification GTPase TrmE [Haemophilus influenzae 22.1-21]
 gi|144979830|gb|EDJ89489.1| tRNA modification GTPase TrmE [Haemophilus influenzae 22.1-21]
          Length = 452

 Score = 36.9 bits (84), Expect = 6.3,   Method: Composition-based stats.
 Identities = 45/246 (18%), Positives = 82/246 (33%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D +RL  PG F E+  L + L++ Q E + +         V     S         
Sbjct: 95  ILQIDGIRLARPGEFSEQAFLNDKLDLAQAEAIADLIDATSEQAVRSALKSLQGEFSKKV 154

Query: 216 -------IYKD-------HFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++     I+  +     E ++   L+  
Sbjct: 155 NALVDSVIYLRTYVEASIDFPDEEIDFLADGKIEANLRGIINQLEDVRSEAKQGSILREG 214

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 215 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 261

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQK-DLLLDKKEPRHTNVSMGIESFIK 379
             L   D   L+ A++ +   IG S    + E   +  L+LD  +P   ++S     F+ 
Sbjct: 262 MPLHIIDTAGLRDATDEV-ERIGISRAWTEIEQADRIILMLDSSDPESADLSKVRSEFLA 320

Query: 380 KNRSQI 385
           K  S +
Sbjct: 321 KLPSTL 326


>gi|15806914|ref|NP_295638.1| hypothetical protein DR_1915 [Deinococcus radiodurans R1]
 gi|6459699|gb|AAF11468.1|AE002030_7 conserved hypothetical protein [Deinococcus radiodurans R1]
          Length = 373

 Score = 36.6 bits (83), Expect = 6.3,   Method: Composition-based stats.
 Identities = 18/127 (14%), Positives = 39/127 (30%), Gaps = 9/127 (7%)

Query: 90  IISQDLSV-VDDLIAKDTKGYFDIAIVYALKKYFSGQLEE---SSKELSKIKDKDNTRGI 145
             S   S+ +   + +D     D   +  ++ Y  GQL+         S  +        
Sbjct: 235 FTSGQPSLNLALDLNRDGILDLDREYLPGVRAYLKGQLDTPQGFLNIYSDTRSLPPVTAQ 294

Query: 146 VPYL---HLLIGRAMMPFSSQQAVHFFDYVRLTSPG--TFLEEIALRNLLEITQNEVGER 200
           VPYL    L++       + +  +       + + G  T      L + L    + + + 
Sbjct: 295 VPYLKVPMLIVQGINDANTPEPYLMTLQQAIVQAKGRATIKRYAGLGHTLGPASSVIDDN 354

Query: 201 AFGYIRA 207
                + 
Sbjct: 355 FRPIAQQ 361


>gi|218184739|gb|EEC67166.1| hypothetical protein OsI_34027 [Oryza sativa Indica Group]
          Length = 1025

 Score = 36.6 bits (83), Expect = 6.4,   Method: Composition-based stats.
 Identities = 22/111 (19%), Positives = 39/111 (35%), Gaps = 6/111 (5%)

Query: 218 KDHFISVLLRFFLHGQLKLPDEDIVFT----ISFFSLEEQRAIYLKIAQNSVISGKRKIG 273
                 +++   L        ED        +S    +EQ A+Y +IA+++  +    + 
Sbjct: 405 ASSLFKIIVESHLKAAADSAFEDTDDAEYFHVSVSKRDEQLALYAQIARSAADTTIPFLA 464

Query: 274 FLAIKQLKRIIDRLDYKDLATIQ--LYENILNIPFVDIMSLQRSTCNIPYY 322
            L  ++  R+  R    D       LY  +L    V   S +  T  IP  
Sbjct: 465 QLFSERFARLSQRNGENDPTQTLEELYWLLLITSHVLTDSGEGETLLIPEA 515


>gi|222613005|gb|EEE51137.1| hypothetical protein OsJ_31887 [Oryza sativa Japonica Group]
          Length = 1025

 Score = 36.6 bits (83), Expect = 6.5,   Method: Composition-based stats.
 Identities = 22/111 (19%), Positives = 39/111 (35%), Gaps = 6/111 (5%)

Query: 218 KDHFISVLLRFFLHGQLKLPDEDIVFT----ISFFSLEEQRAIYLKIAQNSVISGKRKIG 273
                 +++   L        ED        +S    +EQ A+Y +IA+++  +    + 
Sbjct: 405 ASSLFKIIVESHLKAAADSAFEDTDDAEYFHVSVSKRDEQLALYAQIARSAADTTIPFLA 464

Query: 274 FLAIKQLKRIIDRLDYKDLATIQ--LYENILNIPFVDIMSLQRSTCNIPYY 322
            L  ++  R+  R    D       LY  +L    V   S +  T  IP  
Sbjct: 465 QLFSERFARLSQRNGENDPTQTLEELYWLLLITSHVLTDSGEGETLLIPEA 515


>gi|256832463|ref|YP_003161190.1| ABC transporter-like protein [Jonesia denitrificans DSM 20603]
 gi|256685994|gb|ACV08887.1| ABC transporter related [Jonesia denitrificans DSM 20603]
          Length = 631

 Score = 36.6 bits (83), Expect = 6.8,   Method: Composition-based stats.
 Identities = 13/92 (14%), Positives = 26/92 (28%), Gaps = 9/92 (9%)

Query: 88  YTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVP 147
           Y +   +       IA+      DI ++     +   + E +               +  
Sbjct: 525 YRMSGGERQ--RLAIARLLLKEPDIVVLDEATAHLDSESEAAVSA-------ALREALAG 575

Query: 148 YLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGT 179
              L+I   +       A+   D  R+   GT
Sbjct: 576 RTALVIAHRLSTVRDADAILVLDQGRIVEQGT 607


>gi|260912765|ref|ZP_05919251.1| tRNA modification GTPase TrmE [Pasteurella dagmatis ATCC 43325]
 gi|260633143|gb|EEX51308.1| tRNA modification GTPase TrmE [Pasteurella dagmatis ATCC 43325]
          Length = 476

 Score = 36.6 bits (83), Expect = 6.9,   Method: Composition-based stats.
 Identities = 47/246 (19%), Positives = 83/246 (33%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D +RL  PG F E+  L + L++ Q E + +               S         
Sbjct: 119 ILQIDGIRLARPGEFSEQAFLNDKLDLAQAEAIADLIDASSEQAARSALKSLQGEFSNKV 178

Query: 216 -------IY-------KDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++    DI+  ++    E ++   L+  
Sbjct: 179 NQLVDSVIYLRTYVEAAIDFPDEEIDFLADGKIEAHLNDIIEQLNKVRSEAKQGSILREG 238

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 239 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 285

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQKDLL-LDKKEPRHTNVSMGIESFIK 379
             L   D   L++A++ +   IG      + E   + LL LD  E  + N+      F+ 
Sbjct: 286 MPLHIIDTAGLREATDEV-ERIGIVRAWSEIEQADRILLMLDSTEQDNQNLDNVWPEFLA 344

Query: 380 KNRSQI 385
           K  SQI
Sbjct: 345 KLPSQI 350


>gi|229843939|ref|ZP_04464080.1| tRNA modification GTPase TrmE [Haemophilus influenzae 6P18H1]
 gi|229812933|gb|EEP48621.1| tRNA modification GTPase TrmE [Haemophilus influenzae 6P18H1]
          Length = 452

 Score = 36.6 bits (83), Expect = 7.0,   Method: Composition-based stats.
 Identities = 45/246 (18%), Positives = 82/246 (33%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D +RL  PG F E+  L + L++ Q E + +         V     S         
Sbjct: 95  ILQIDGIRLARPGEFSEQAFLNDKLDLAQAEAIADLIDATSEQAVRSALKSLQGEFSKKV 154

Query: 216 -------IYKD-------HFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++     I+  +     E ++   L+  
Sbjct: 155 NALVDSVIYLRTYVEASIDFPDEEIDFLADGKIEANLRGIINQLEDVRSEAKQGSILREG 214

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 215 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 261

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQK-DLLLDKKEPRHTNVSMGIESFIK 379
             L   D   L+ A++ +   IG S    + E   +  L+LD  +P   ++S     F+ 
Sbjct: 262 MPLHIIDTAGLRDATDEV-ERIGISRAWTEIEQADRIILMLDSSDPESADLSKVRSEFLA 320

Query: 380 KNRSQI 385
           K  S +
Sbjct: 321 KLPSTL 326


>gi|16272938|ref|NP_439164.1| tRNA modification GTPase TrmE [Haemophilus influenzae Rd KW20]
 gi|1574033|gb|AAC22664.1| thiophene and furan oxidation protein (thdF) [Haemophilus
           influenzae Rd KW20]
          Length = 461

 Score = 36.6 bits (83), Expect = 7.2,   Method: Composition-based stats.
 Identities = 45/246 (18%), Positives = 81/246 (32%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D +RL  PG F E+  L + L++ Q E + +         V     S         
Sbjct: 104 ILQIDGIRLARPGEFSEQAFLNDKLDLAQAEAIADLIDATSEQAVRSALKSLQGEFSKKV 163

Query: 216 -------IYKD-------HFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++     I+  +     E ++   L+  
Sbjct: 164 NELVDSVIYLRTYVEASIDFPDEEIDFLADGKIEANLRGIINQLEDVRSEAKQGSILREG 223

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 224 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 270

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQK-DLLLDKKEPRHTNVSMGIESFIK 379
             L   D   L+ A + +   IG S    + E   +  L+LD  +P   ++S     F+ 
Sbjct: 271 MPLHIIDTAGLRDAIDEV-ERIGISRAWTEIEQADRIILMLDSSDPESADLSKVRSEFLA 329

Query: 380 KNRSQI 385
           K  S +
Sbjct: 330 KLPSTL 335


>gi|304437451|ref|ZP_07397409.1| lipid-A-disaccharide synthase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304369501|gb|EFM23168.1| lipid-A-disaccharide synthase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 381

 Score = 36.6 bits (83), Expect = 7.3,   Method: Composition-based stats.
 Identities = 17/163 (10%), Positives = 51/163 (31%)

Query: 124 GQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEE 183
           G  + + +    +    +   I  +L        +   ++ A+       + + GT + E
Sbjct: 214 GAADPTRRFFLPVAGGVDEERIRRHLAASTAEVTLTHDARYALMGLARAAMATSGTVVME 273

Query: 184 IALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVF 243
            AL  L  +    +   ++   R  V     S+             L G ++        
Sbjct: 274 AALMGLPAVVLYRMSALSYLIGRLLVDVPRFSLPNILLGETFETELLQGAVQPNRIAAEM 333

Query: 244 TISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDR 286
                   ++R +  ++++ +   G+        +++  +  +
Sbjct: 334 EKIIADGADRRYVTERLSRAAARLGEPHAARRVAEKILALGRK 376


>gi|145632387|ref|ZP_01788122.1| tRNA modification GTPase [Haemophilus influenzae 3655]
 gi|144987294|gb|EDJ93824.1| tRNA modification GTPase [Haemophilus influenzae 3655]
          Length = 452

 Score = 36.6 bits (83), Expect = 7.3,   Method: Composition-based stats.
 Identities = 45/246 (18%), Positives = 81/246 (32%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D +RL  PG F E+  L + L++ Q E + +         V     S         
Sbjct: 95  ILQIDGIRLARPGEFSEQAFLNDKLDLAQAEAIADLIDATSEQAVRSALKSLQGEFSKKV 154

Query: 216 -------IYKD-------HFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++     I+  +     E ++   L+  
Sbjct: 155 NELVDSVIYLRTYVEASIDFPDEEIDFLADGKIEANLRGIINQLEDVRSEAKQGSILREG 214

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 215 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 261

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQK-DLLLDKKEPRHTNVSMGIESFIK 379
             L   D   L+ A + +   IG S    + E   +  L+LD  +P   ++S     F+ 
Sbjct: 262 MPLHIIDTAGLRDAIDEV-ERIGISRAWTEIEQADRIILMLDSSDPESADLSKVRSEFLA 320

Query: 380 KNRSQI 385
           K  S +
Sbjct: 321 KLPSTL 326


>gi|167904905|ref|ZP_02492110.1| hypothetical protein BpseN_21844 [Burkholderia pseudomallei NCTC
           13177]
          Length = 581

 Score = 36.6 bits (83), Expect = 7.6,   Method: Composition-based stats.
 Identities = 12/79 (15%), Positives = 30/79 (37%)

Query: 222 ISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLK 281
                        +LPD  +   +       Q  I +++A+ ++I+ +R+I     + + 
Sbjct: 186 RDHERTARPADAERLPDARLSGPLRSRPRMMQHEIEIELARGAIIAARREIACDGARPVL 245

Query: 282 RIIDRLDYKDLATIQLYEN 300
           R  D +  +  A   ++  
Sbjct: 246 RKHDAVRAEFGARGCVFAG 264


>gi|167826463|ref|ZP_02457934.1| hypothetical protein Bpseu9_22510 [Burkholderia pseudomallei 9]
          Length = 580

 Score = 36.6 bits (83), Expect = 7.6,   Method: Composition-based stats.
 Identities = 12/79 (15%), Positives = 30/79 (37%)

Query: 222 ISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLK 281
                        +LPD  +   +       Q  I +++A+ ++I+ +R+I     + + 
Sbjct: 186 RDHERTARPADAERLPDARLSGPLRSRPRMMQHEIEIELARGAIIAARREIACDGARPVL 245

Query: 282 RIIDRLDYKDLATIQLYEN 300
           R  D +  +  A   ++  
Sbjct: 246 RKHDAVRAEFGARGCVFAG 264


>gi|116623467|ref|YP_825623.1| phosphonoacetate hydrolase [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226629|gb|ABJ85338.1| phosphonoacetate hydrolase [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 377

 Score = 36.6 bits (83), Expect = 7.6,   Method: Composition-based stats.
 Identities = 19/133 (14%), Positives = 44/133 (33%), Gaps = 13/133 (9%)

Query: 85  VWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRG 144
           V +  I   D + V+  +A+     F   +         G    +    +   +     G
Sbjct: 38  VVVILIDGGDPAYVNAALAQGLLPNFKKIMTEGFVSIAVG----AMPSFTNPNNISVITG 93

Query: 145 IVPYLHLLIGRAMM--PFSSQQAVHFFDYVR---LTSPGTFLEEIALRNLLEITQNEVGE 199
           + P +H + G   +      +  +    ++R   + +  TF E  A   ++ +T  +   
Sbjct: 94  VPPSVHGISGNFFLNPATGQETMMDQPQFLRADSILA--TFSEHGA--KVVALTAKDKLA 149

Query: 200 RAFGYIRAYVTQF 212
           +   Y   +   F
Sbjct: 150 KILAYKLQHGISF 162


>gi|289523036|ref|ZP_06439890.1| excinuclease ABC subunit C [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503579|gb|EFD24743.1| excinuclease ABC subunit C [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 504

 Score = 36.6 bits (83), Expect = 7.7,   Method: Composition-based stats.
 Identities = 26/149 (17%), Positives = 52/149 (34%), Gaps = 18/149 (12%)

Query: 94  DLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQLEESSKELSKIKDKDNTRGIVPYLHLLI 153
           + S+    + K  +G  D   +           E   +  S + +K+     +P L L+ 
Sbjct: 312 NPSLYRRYVIKTVEGIDDFRSIE----------EIVRRRYSSLLEKNMP---LPQLLLVD 358

Query: 154 GRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIAL-----RNLLEITQNEVGERAFGYIRAY 208
           G A+    + +A++      + +     EE  L     R  L++  ++ G      IR  
Sbjct: 359 GGALQLSFALKALNELGIENIYAVALAKEEEELYLPDSRRPLKLPLDDPGLNLLRKIRDE 418

Query: 209 VTQFHHSIYKDHFISVLLRFFLHGQLKLP 237
             +F  S + + F     R  L     + 
Sbjct: 419 AHRFALSSHNNKFNKRYSRSALEDIPGVG 447


>gi|260580092|ref|ZP_05847922.1| tRNA modification GTPase TrmE [Haemophilus influenzae RdAW]
 gi|205371770|sp|P43730|MNME_HAEIN RecName: Full=tRNA modification GTPase mnmE
 gi|260093376|gb|EEW77309.1| tRNA modification GTPase TrmE [Haemophilus influenzae RdAW]
          Length = 452

 Score = 36.6 bits (83), Expect = 7.8,   Method: Composition-based stats.
 Identities = 45/246 (18%), Positives = 81/246 (32%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   D +RL  PG F E+  L + L++ Q E + +         V     S         
Sbjct: 95  ILQIDGIRLARPGEFSEQAFLNDKLDLAQAEAIADLIDATSEQAVRSALKSLQGEFSKKV 154

Query: 216 -------IYKD-------HFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++     I+  +     E ++   L+  
Sbjct: 155 NELVDSVIYLRTYVEASIDFPDEEIDFLADGKIEANLRGIINQLEDVRSEAKQGSILREG 214

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 215 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 261

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQK-DLLLDKKEPRHTNVSMGIESFIK 379
             L   D   L+ A + +   IG S    + E   +  L+LD  +P   ++S     F+ 
Sbjct: 262 MPLHIIDTAGLRDAIDEV-ERIGISRAWTEIEQADRIILMLDSSDPESADLSKVRSEFLA 320

Query: 380 KNRSQI 385
           K  S +
Sbjct: 321 KLPSTL 326


>gi|186476184|ref|YP_001857654.1| putative lipoprotein [Burkholderia phymatum STM815]
 gi|184192643|gb|ACC70608.1| putative lipoprotein [Burkholderia phymatum STM815]
          Length = 382

 Score = 36.6 bits (83), Expect = 7.8,   Method: Composition-based stats.
 Identities = 39/206 (18%), Positives = 66/206 (32%), Gaps = 23/206 (11%)

Query: 69  RATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALK-KYFSGQLE 127
           RA   D +   R +  V  +   S        L+++DT G  DI+I +A   +  +GQ +
Sbjct: 157 RANIPDDWF-RRTVGKVIDFAYSSGTRDSFRTLVSRDTSGGTDISITHAAMEEVLTGQDK 215

Query: 128 ESSKELSKIKDKDNTRGIVPYLHLLIG-------RAMMPFSSQQAVHFFDY----VRLTS 176
            SS+ + + ++       +  L    G       + +       A    D       L  
Sbjct: 216 TSSRWVERPRNPALEAEFLAKLMQKFGLTDAQSKQLLTDARPATAAAQLDKGAGGATLDL 275

Query: 177 PGTFLEEIALRNLLEI------TQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFL 230
           P +  +   LR  L +        N   E+   Y+R Y            F  +      
Sbjct: 276 PES-FDRAWLRVGLALDRTNFTVDNRDREKGIYYVR-YADSMQELKRDGLFGKLFYS--D 331

Query: 231 HGQLKLPDEDIVFTISFFSLEEQRAI 256
               K   E +V   S      Q A+
Sbjct: 332 KSTKKDGHEFLVNVRSKGDAMTQVAV 357


>gi|298368678|ref|ZP_06979996.1| tetratricopeptide repeat protein [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298282681|gb|EFI24168.1| tetratricopeptide repeat protein [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 610

 Score = 36.6 bits (83), Expect = 7.9,   Method: Composition-based stats.
 Identities = 19/165 (11%), Positives = 51/165 (30%), Gaps = 3/165 (1%)

Query: 188 NLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDEDIVFTISF 247
             LE+  +         I     Q      +       +R  + G+     + +   +S 
Sbjct: 94  RALEMAVSLNAFEPAEMIYQKWRQIEPVPGEAQKRMGWVRNLMMGRADKSLKGLDEILSR 153

Query: 248 FSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDR-LDYKDLATIQLYENILNIPF 306
              E  + I+L ++Q +V   +  +      Q+ +   +  D  + +      +  +   
Sbjct: 154 AEEEHAKQIFLLLSQAAVQ--QPDLAAKGASQVHKAAQKYPDMPEASIADAIYSAQSGSD 211

Query: 307 VDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDF 351
              +S  ++   +    L      L+  ++     + +   D D 
Sbjct: 212 RHAVSALQNLAKLDSEILPPTALTLRLVAQRNPEILSRFFRDTDS 256


>gi|15603031|ref|NP_246103.1| tRNA modification GTPase TrmE [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|12721514|gb|AAK03250.1| ThdF [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 465

 Score = 36.2 bits (82), Expect = 8.5,   Method: Composition-based stats.
 Identities = 44/246 (17%), Positives = 81/246 (32%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   + +RL  PG F E+  L + L++ Q E + +               S         
Sbjct: 108 ILQLEGLRLARPGEFSEQAFLNDKLDLAQAEAIADLIDASSEQAARSALKSLQGEFSNKV 167

Query: 216 -------IY-------KDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++    DI+  +     E ++   L+  
Sbjct: 168 NQLVDSVIYLRTYVEAAIDFPDEEIDFLADGKIEAHLNDIITQLDHVRSEAKQGSILREG 227

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 228 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 274

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQKDLL-LDKKEPRHTNVSMGIESFIK 379
             L   D   L++A++ +   IG      + E   + LL LD  E  + ++      F+ 
Sbjct: 275 MPLHIIDTAGLREATDEV-ERIGIVRAWSEIEQADRILLMLDSTEADNQDLEKVRSEFLT 333

Query: 380 KNRSQI 385
           K  S I
Sbjct: 334 KLPSNI 339


>gi|239944137|ref|ZP_04696074.1| hypothetical protein SrosN15_24261 [Streptomyces roseosporus NRRL
           15998]
 gi|239990590|ref|ZP_04711254.1| hypothetical protein SrosN1_25008 [Streptomyces roseosporus NRRL
           11379]
 gi|291447606|ref|ZP_06586996.1| conserved hypothetical protein [Streptomyces roseosporus NRRL
           15998]
 gi|291350553|gb|EFE77457.1| conserved hypothetical protein [Streptomyces roseosporus NRRL
           15998]
          Length = 474

 Score = 36.2 bits (82), Expect = 9.3,   Method: Composition-based stats.
 Identities = 34/227 (14%), Positives = 67/227 (29%), Gaps = 24/227 (10%)

Query: 170 DYVRLTSPGTFLEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFF 229
           D VRL      L E A +  L      +    FG + AY       +       V+ +F 
Sbjct: 248 DEVRLYL---ALREAAHQR-LFAHVPWLRSHLFGAVEAYARGIK--VDTSKLEDVVGQFD 301

Query: 230 LHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQN-SVISGKRKIGFLAIKQLKRIIDRLD 288
                +L D             EQ+A   ++    +++ G          + +       
Sbjct: 302 PSQPEQLQDALQQGMFQPEDTPEQKASLARLETALALVEGWVDAVVHEAAKSRLTSSDAL 361

Query: 289 YKDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLID 348
            + +   +        P       +++   +    L    R L+ A+ +       SL D
Sbjct: 362 RETMRRRR----ASGGP------AEQTFATLIGLQLRP--RRLRDAARLWA-----SLTD 404

Query: 349 IDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEA 395
                 +  L          +     + F+   ++    +D +L EA
Sbjct: 405 ARGLEGRDALWAHPDMLPTAHDLDDPDGFVHHEQADFSELDKMLGEA 451


>gi|86158672|ref|YP_465457.1| sigma-24 FecI-like protein [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85775183|gb|ABC82020.1| RNA polymerase, sigma subunit, ECF family [Anaeromyxobacter
           dehalogenans 2CP-C]
          Length = 327

 Score = 36.2 bits (82), Expect = 9.3,   Method: Composition-based stats.
 Identities = 20/166 (12%), Positives = 51/166 (30%), Gaps = 2/166 (1%)

Query: 230 LHGQLKLPDEDIVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDY 289
           L G ++      + T      E  R  Y +    S       +     +    +      
Sbjct: 11  LAGAVQASWHRFLDTYEPLRPELYR--YCRSLARSPWDADDLVQDAMARAFVTLGCMDGP 68

Query: 290 KDLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDI 349
            D     L+    N+    +   +    ++P  +   + R  ++A+  ++  +       
Sbjct: 69  PDNPRAWLFRVASNLWIDRLRRTREDAGDVPEGAAAPEPRASREAAGTLIGRLSPQERAA 128

Query: 350 DFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEA 395
                  DL L++     +     +++ + + R ++   D  L  A
Sbjct: 129 VVLKEAFDLSLEEIAEALSTSVGAVKAALHRGRGKLAEPDEALTAA 174


>gi|14195273|sp|Q9CLQ1|MNME_PASMU RecName: Full=tRNA modification GTPase mnmE
          Length = 452

 Score = 36.2 bits (82), Expect = 9.3,   Method: Composition-based stats.
 Identities = 44/246 (17%), Positives = 81/246 (32%), Gaps = 40/246 (16%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHS--------- 215
           +   + +RL  PG F E+  L + L++ Q E + +               S         
Sbjct: 95  ILQLEGLRLARPGEFSEQAFLNDKLDLAQAEAIADLIDASSEQAARSALKSLQGEFSNKV 154

Query: 216 -------IY-------KDHFISVLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYLKIA 261
                  IY          F    + F   G+++    DI+  +     E ++   L+  
Sbjct: 155 NQLVDSVIYLRTYVEAAIDFPDEEIDFLADGKIEAHLNDIITQLDHVRSEAKQGSILREG 214

Query: 262 QNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVDIMSLQRSTCNIPY 321
              VI+G+   G  ++       +     D+A                  + R   +I  
Sbjct: 215 MKVVIAGRPNAGKSSLLNALAGREAAIVTDIA-------------GTTRDVLREHIHIDG 261

Query: 322 YSLMEQDRY-LKKASEIIMSEIGKSLIDIDFEHIQKDLL-LDKKEPRHTNVSMGIESFIK 379
             L   D   L++A++ +   IG      + E   + LL LD  E  + ++      F+ 
Sbjct: 262 MPLHIIDTAGLREATDEV-ERIGIVRAWSEIEQADRILLMLDSTEADNQDLEKVRSEFLT 320

Query: 380 KNRSQI 385
           K  S I
Sbjct: 321 KLPSNI 326


>gi|251791873|ref|YP_003006593.1| tRNA modification GTPase TrmE [Aggregatibacter aphrophilus NJ8700]
 gi|247533260|gb|ACS96506.1| tRNA modification GTPase TrmE [Aggregatibacter aphrophilus NJ8700]
          Length = 451

 Score = 36.2 bits (82), Expect = 9.7,   Method: Composition-based stats.
 Identities = 45/233 (19%), Positives = 86/233 (36%), Gaps = 25/233 (10%)

Query: 166 VHFFDYVRLTSPGTFLEEIALRNLLEITQNE-VGERAFGYIRAYVTQFHHSIYKDHFIS- 223
           +   D +RL  PG F E+  L + L++ Q E + +               S+ +  F + 
Sbjct: 95  ILRIDGIRLARPGEFSEQAFLNDKLDLAQAEAIADLIDASSEQAARSALKSL-QGEFSNK 153

Query: 224 --------VLLRFFLHGQLKLPDEDIVFTISFFSLEEQRAIYL--KIAQNSVISGKRKIG 273
                   + LR ++   +  PDE+I F       + +   YL   IAQ   +  + K G
Sbjct: 154 VNQLVDSVIYLRTYVEAAIDFPDEEIDFL-----ADGKIESYLNDIIAQLDGVRAEAKQG 208

Query: 274 FLAIKQLKRIIDRLDYKDLATIQ--LYENILNIPFV---DIMSLQRSTCNIPYYSLMEQD 328
            +  + +K +I        +++   L      I          + R   ++    L   D
Sbjct: 209 SILQEGMKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHLDGMPLHIID 268

Query: 329 RY-LKKASEIIMSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESFIKK 380
              L++A++ +   IG S    + E   + LL+        ++S     F+ K
Sbjct: 269 TAGLREATDEV-ERIGISRAWSEIEQADRILLMLDGSDTEQDLSKVRSEFLAK 320


>gi|258575269|ref|XP_002541816.1| predicted protein [Uncinocarpus reesii 1704]
 gi|237902082|gb|EEP76483.1| predicted protein [Uncinocarpus reesii 1704]
          Length = 674

 Score = 36.2 bits (82), Expect = 9.8,   Method: Composition-based stats.
 Identities = 25/159 (15%), Positives = 47/159 (29%), Gaps = 16/159 (10%)

Query: 235 KLPDEDIVFTISFFSLEEQRAIY----LKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYK 290
           K P +D+  T+   S   +R       L +++++ +  +      A  ++     +    
Sbjct: 67  KRPGDDVPRTLPPGSPPTKRRATTPDTLSLSRSASVRSQLARQHSARSRIGHSARKAGTA 126

Query: 291 DLATIQLYENILNIPFVDIMSLQRSTCNIPYYSLMEQ--------DRYLKKASEII---- 338
                         P   I  L           L +         D  L  A+  I    
Sbjct: 127 SGPRASWNHPPALAPSPQIEGLAAVRSQATASPLQQSQTLSTEYWDHGLDGAAAPIHSNR 186

Query: 339 MSEIGKSLIDIDFEHIQKDLLLDKKEPRHTNVSMGIESF 377
            S    S I++D +H      L         +++G ES 
Sbjct: 187 ASGSSSSPIEVDMDHSPAADALVLDSQHQGQLAVGTESL 225


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.309    0.135    0.350 

Lambda     K      H
   0.267   0.0416    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,208,294,967
Number of Sequences: 14124377
Number of extensions: 225550472
Number of successful extensions: 968934
Number of sequences better than 10.0: 884
Number of HSP's better than 10.0 without gapping: 130
Number of HSP's successfully gapped in prelim test: 849
Number of HSP's that attempted gapping in prelim test: 967698
Number of HSP's gapped (non-prelim): 1631
length of query: 396
length of database: 4,842,793,630
effective HSP length: 141
effective length of query: 255
effective length of database: 2,851,256,473
effective search space: 727070400615
effective search space used: 727070400615
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (20.7 bits)
S2: 82 (36.2 bits)