RPSBLAST alignment for GI: 254780528 and conserved domain: PRK12798

>gnl|CDD|183755 PRK12798, PRK12798, chemotaxis protein; Reviewed. Length = 421
 Score =  163 bits (415), Expect = 7e-41
 Identities = 104/417 (24%), Positives = 175/417 (41%), Gaps = 35/417 (8%)

Query: 7   ICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDIVKETGV 66
           +     A     + A   D    + PY+ VRSLQ   D    GD S  +    ++     
Sbjct: 12  LALAGPAAGTAAAAAQTGD---VLEPYKLVRSLQLLQDSVAAGDHSAHEMQRFLLGTIDE 68

Query: 67  QLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQL 126
           +LRA   +V+ D RN+DA  IY +   + + +  L+A+D  G FD  +      Y SG+ 
Sbjct: 69  RLRAADPEVWDDPRNVDAALIYLLSGGNPATLRKLLARDKLGNFDQRLADGALAYLSGRG 128

Query: 127 EESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTFLEEIAL 186
            E+ K L+ +  +     +  YL L+ G  M+      A+   D  RL +PGT +EE AL
Sbjct: 129 REARKLLAGVAPEYLPAELGAYLALVQGNLMVATDPATALKLLDQARLLAPGTLVEEAAL 188

Query: 187 RNLLEIT-QNEVGERAFGYIRAYVTQFHHSIY----KDHFISVLLRFFLHGQLKLPDEDI 241
           R  L I  Q    ++     R Y+ +F HS Y       F+ +++R     +++  D  +
Sbjct: 189 RRSLFIAAQLGDADKFEALARNYLRRFRHSPYASQFAQRFVDLVVRLD--DEIR--DARL 244

Query: 242 VFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENI 301
           V  +SF   E QR +YL+IA+ ++I GK ++   A ++  ++ D     D A  +LY   
Sbjct: 245 VEILSFMDPERQRELYLRIARAALIDGKTELARFASERALKLADPDS-ADAARARLYRGA 303

Query: 302 LNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLI--------DIDFE- 352
             +   D  S       I    L E+DR L +A+  +  ++ ++          D   E 
Sbjct: 304 ALVASDDAESALEELSQIDRDKLSERDRALLEAARSVARQVRRAPATSPAKRSADAASEP 363

Query: 353 ----HIQKDLLLDKKEPRHTNVSM---------GIESFIKKNRSQIESIDVLLAEAR 396
                                V            ++ F+ + RS+++ ID LL +  
Sbjct: 364 PSAVAPAPQAPAQLPLSVPVEVDSNSARTRSDPDLQKFVARARSKLDEIDALLKKEG 420