RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780528|ref|YP_003064941.1| chemotaxis protein [Candidatus Liberibacter asiaticus str. psy62] (396 letters) >d2ddha1 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 183 Score = 29.0 bits (64), Expect = 0.71 Identities = 16/107 (14%), Positives = 35/107 (32%), Gaps = 10/107 (9%) Query: 27 VRTIVPYQCVRSLQRALDEAMR-------GDISLQKKIPDIVKETGVQLRATHMDVFVDN 79 VR+ + +SL +A A+R +I + P I+ Q + + Sbjct: 4 VRSFLVGNAAQSLSKACTIAIRYSAVRRQSEIKQSEPEPQILDFQTQQYKLFPLLATAYA 63 Query: 80 RNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKKYFSGQL 126 + + L + + + D ++ + A K F+ Sbjct: 64 FHF---VGRYMKETYLRINESIGQGDLSELPELHALTAGLKAFTTWT 107 >d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Length = 450 Score = 25.6 bits (55), Expect = 6.7 Identities = 15/63 (23%), Positives = 30/63 (47%), Gaps = 4/63 (6%) Query: 249 SLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYENILNIPFVD 308 SL+EQR+ Y +I Q + + + + + D Y L Q+ ++++N P V Sbjct: 2 SLDEQRSRYAQIKQAW----DNRQMDVVEQMMPGLKDYPLYPYLEYRQITDDLMNQPAVT 57 Query: 309 IMS 311 + + Sbjct: 58 VTN 60 >d1w07a1 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 189 Score = 25.5 bits (55), Expect = 8.1 Identities = 11/77 (14%), Positives = 22/77 (28%), Gaps = 9/77 (11%) Query: 25 DLVRTIVPYQCVRSLQRALDEAMR--------GDISLQKKIPDIVKETGVQLRATHMDVF 76 VR + +L RA+ A R G + + ++ Q R + Sbjct: 10 VYVRQTIVADASNALSRAVCIATRYSAVRRQFGAHNGGIETQ-VIDYKTQQNRLFPLLAS 68 Query: 77 VDNRNIDAVWIYTIISQ 93 W+ + + Sbjct: 69 AYAFRFVGEWLKWLYTD 85 >d1t8sa_ c.56.2.1 (A:) AMP nucleosidase {Escherichia coli [TaxId: 562]} Length = 477 Score = 25.3 bits (55), Expect = 9.2 Identities = 11/41 (26%), Positives = 17/41 (41%), Gaps = 7/41 (17%) Query: 349 IDFEHIQKDLLLDKKEPRHTNVSMGIESFIKKNRSQIESID 389 EH Q +L TN + ++ F++ SQI D Sbjct: 185 TPVEHFQPFVLF-------TNYTRYVDEFVRWGCSQILDPD 218 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.325 0.140 0.392 Gapped Lambda K H 0.267 0.0627 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,492,010 Number of extensions: 73527 Number of successful extensions: 240 Number of sequences better than 10.0: 1 Number of HSP's gapped: 240 Number of HSP's successfully gapped: 17 Length of query: 396 Length of database: 2,407,596 Length adjustment: 87 Effective length of query: 309 Effective length of database: 1,213,086 Effective search space: 374843574 Effective search space used: 374843574 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 54 (24.8 bits)