BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780528|ref|YP_003064941.1| chemotaxis protein [Candidatus
Liberibacter asiaticus str. psy62]
         (396 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780528|ref|YP_003064941.1| chemotaxis protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 396

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/396 (100%), Positives = 396/396 (100%)

Query: 1   MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDI 60
           MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDI
Sbjct: 1   MNQKYLICTMMVAMDVFFSFATDQDLVRTIVPYQCVRSLQRALDEAMRGDISLQKKIPDI 60

Query: 61  VKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKK 120
           VKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKK
Sbjct: 61  VKETGVQLRATHMDVFVDNRNIDAVWIYTIISQDLSVVDDLIAKDTKGYFDIAIVYALKK 120

Query: 121 YFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTF 180
           YFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTF
Sbjct: 121 YFSGQLEESSKELSKIKDKDNTRGIVPYLHLLIGRAMMPFSSQQAVHFFDYVRLTSPGTF 180

Query: 181 LEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDED 240
           LEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDED
Sbjct: 181 LEEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKDHFISVLLRFFLHGQLKLPDED 240

Query: 241 IVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYEN 300
           IVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYEN
Sbjct: 241 IVFTISFFSLEEQRAIYLKIAQNSVISGKRKIGFLAIKQLKRIIDRLDYKDLATIQLYEN 300

Query: 301 ILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLL 360
           ILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLL
Sbjct: 301 ILNIPFVDIMSLQRSTCNIPYYSLMEQDRYLKKASEIIMSEIGKSLIDIDFEHIQKDLLL 360

Query: 361 DKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR 396
           DKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR
Sbjct: 361 DKKEPRHTNVSMGIESFIKKNRSQIESIDVLLAEAR 396


>gi|254780579|ref|YP_003064992.1| hypothetical protein CLIBASIA_02330 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 207

 Score = 26.6 bits (57), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 6/38 (15%)

Query: 182 EEIALRNLLEITQNEVGERAFGYIRAYVTQFHHSIYKD 219
           E I +    E+ +N++GE+ F      ++  HHS+ KD
Sbjct: 46  EPIRIERAFELLENQIGEKIF------ISGVHHSVSKD 77


>gi|254780217|ref|YP_003064630.1| DNA polymerase III subunit delta' [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 347

 Score = 25.8 bits (55), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 8/43 (18%)

Query: 97  VVDDLIAKDTKGYFDIAIVYALKK--------YFSGQLEESSK 131
           + D+L+++D K  FD  I + LK+          SGQLEE+ +
Sbjct: 258 IADELLSQDQKIAFDFLIEFILKEICKSAKAAALSGQLEEADQ 300


>gi|254781118|ref|YP_003065531.1| lysyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 502

 Score = 22.7 bits (47), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 3/34 (8%)

Query: 82  IDAVWIYTIISQDLSVVDDL---IAKDTKGYFDI 112
           I+A W YT     + +V+DL   +AK   G  DI
Sbjct: 271 IEAYWAYTDYRDMMKLVEDLCHNLAKTLHGTTDI 304


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.325    0.140    0.392 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 243,905
Number of Sequences: 1233
Number of extensions: 9914
Number of successful extensions: 40
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 37
Number of HSP's gapped (non-prelim): 5
length of query: 396
length of database: 328,796
effective HSP length: 76
effective length of query: 320
effective length of database: 235,088
effective search space: 75228160
effective search space used: 75228160
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 39 (19.6 bits)