>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA; InterPro: IPR004432 Members of this entry represent PfaA, which is involved in omega-3 polyunsaturated fatty acid biosynthesis, for example PfaA from the eicosapentaenoic acid biosynthesis operon in Photobacterium profundum strain SS9. PfaA is found together with PfaB, PfaC, and PfaD, and the functions of the individual polypeptides have not yet been described. More distant homologues of PfaA, also included in this entry, appear to be involved in polyketide-like biosynthetic mechanisms of polyunsaturated fatty acid biosynthesis; an alternative to the more familiar iterated mechanism of chain extension and desaturation, and like PfaA the more distant homologues are likewise found near genes for homologues of PfaB, PfaC, and/or PfaD..

Probab=98.03 E-value=3.7e-06 Score=55.43 Aligned_cols=77 Identities=17% Similarity=0.301 Sum_probs=43.4 Q ss_pred CHHHHHHHHHHHHHHHHCCCCHHHCCCCCCHHHHCCCCHHHHHHHHHHHHHHHC--CCCCHHHHHCCCCHHHHHHHHHHH Q ss_conf 858999999999999836999988487867454206571009999999999838--834888985058899999999985 Q gi|254780534|r 4 ANDDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFS--LEIPEESANKILTVKDAVDFIRKA 81 (85) Q Consensus 4 t~~ei~~~v~~ii~~~l~~~~~~~i~~ds~l~~dLg~DSLd~vel~~~lE~~f~--i~i~~~~~~~~~Tv~dlv~~I~~~ 81 (85) T Consensus 1543 d~d~i~~~M~~VVAdK-TGYP~EMLeL~MDMEADLGIDSIKRVEILG~VQd~lP~LPEL~PEDLAE~RTLGEIV~y~~~~ 1621 (2773) T TIGR02813 1543 DLDEIQSTMMTVVADK-TGYPTEMLELEMDMEADLGIDSIKRVEILGTVQDELPDLPELNPEDLAECRTLGEIVSYMQSK 1621 (2773) T ss_pred CHHHHHHHHHHHHHCC-CCCCHHHHHCCCCCCCCCCCCCEEEEEEECCHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCC T ss_conf 7788888888875226-788533430121200005876142134411166517787898733588742578999987201

HHsearch alignment for GI: 254780534 and conserved domain: TIGR02813