HHsearch results for GI: 254780534 and protein with PDBid: 1dny_A

>1dny_A Non-ribosomal peptide synthetase peptidyl carrier protein; four-helix bundle, modular enzyme, domain, flexible region; NMR {Brevibacillus brevis} SCOP: a.28.1.2 PDB: 2gdw_A 2gdx_A 2gdy_A 2k2q_A
Probab=98.90  E-value=4.5e-09  Score=70.53  Aligned_cols=74  Identities=18%  Similarity=0.277  Sum_probs=66.5

Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHCCCCCCHHHHCCCCHHHHHHHHHHHHHHHCCCCCHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             589999999999998369999884878674542065710099999999998388348889850588999999999855
Q gi|254780534|r    5 NDDVFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESANKILTVKDAVDFIRKAK   82 (85)
Q Consensus         5 ~~ei~~~v~~ii~~~l~~~~~~~i~~ds~l~~dLg~DSLd~vel~~~lE~~f~i~i~~~~~~~~~Tv~dlv~~I~~~~   82 (85)
                      ..+++.++.++.++.+ +.+  .+.++.+|. ++|.|||..+.++..++++||+.+|-.++.+..||+++++||..+-
T Consensus        12 ~~~~E~~l~~i~~~vL-~~~--~i~~~~~Ff-~lGgdSL~a~~l~~~i~~~~~~~l~~~~lf~~pTi~~LA~~i~~rs   85 (91)
T 1dny_A           12 TNAVESKLAEIWERVL-GVS--GIGILDNFF-QIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATRS   85 (91)
T ss_dssp             SSHHHHHHHHHHHHHH-TCS--SCCSSCCTT-SSCCSSHHHHHHHHHHHHHCCCCCCHHHHHHSCSHHHHHHHHHC--
T ss_pred             CCHHHHHHHHHHHHHC-CCC--CCCCCCCHH-HCCCCHHHHHHHHHHHHHHHCCCCCHHHHHCCCCHHHHHHHHHHCC
T ss_conf             8999999999999984-999--889998978-8289589999999999999889978999985998999999999816