HHsearch results for GI: 254780534 and protein with PDBid: 2kci_A

>2kci_A Putative acyl carrier protein; alpha, ACP, PCP, structural genomics, unknown function, PSI- 2, protein structure initiative; NMR {Geobacter metallireducens gs-15} PDB: 2kjs_A* 2kwm_A*
Probab=99.59  E-value=1.5e-15  Score=106.74  Aligned_cols=76  Identities=14%  Similarity=0.201  Sum_probs=70.4

Q ss_pred             HHHHHHHHHHHHHCCCCHHHCCCCCCHHHHCCCCHHHHHHHHHHHHHHHCCCCCHHHHHCCCCHHHHHHHHHHHHHC
Q ss_conf             99999999999836999988487867454206571009999999999838834888985058899999999985537
Q gi|254780534|r    8 VFEAVKEVILSQLTSVKEDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESANKILTVKDAVDFIRKAKQT   84 (85)
Q Consensus         8 i~~~v~~ii~~~l~~~~~~~i~~ds~l~~dLg~DSLd~vel~~~lE~~f~i~i~~~~~~~~~Tv~dlv~~I~~~~~~   84 (85)
                      ..+++++|+++.+ +++++.|+++++|.+++|||||+.++++..+|++||++||++++.++.||+++++||.++.++
T Consensus         3 tle~L~~I~~e~l-~~~~~~i~~~t~~~d~~g~DSL~~veli~~ie~~f~i~i~~~~~~~~~Tv~~l~~~I~~kl~~   78 (87)
T 2kci_A            3 TLDALTPIFRQVF-DDDSIVLTRETSANDIDAWDSLSHMNLIVSLEVHYKIKFALGELQKLKNVGDLADLVDKKLAR   78 (87)
T ss_dssp             SHHHHHHHHHHHT-TCSCCCCCTTCCSTTCCCCCSTHHHHHHHHHHHHHTCCCCHHHHTTCCSHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHH-CCCHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCEECHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             4999999999995-897323488778033689877899999999999959656598886069999999999999998