HHsearch results for GI: 254780534 and protein with PDBid: 2l4b_A

>2l4b_A Acyl carrier protein; infectious disease, human granulocytic anaplasmosis, ssgcid, structural genomics; NMR {Anaplasma phagocytophilum}
Probab=99.74  E-value=1e-17  Score=118.97  Aligned_cols=82  Identities=29%  Similarity=0.511  Sum_probs=76.0

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCC---HHHCCCCCCHHHHCCCCHHHHHHHHHHHHHHHCCCCCHHHHHCCCCHHHHHHHH
Q ss_conf             87858999999999999836999---988487867454206571009999999999838834888985058899999999
Q gi|254780534|r    2 PNANDDVFEAVKEVILSQLTSVK---EDQIVESARFIEELGADSLDVVELVMIFEEKFSLEIPEESANKILTVKDAVDFI   78 (85)
Q Consensus         2 ~~t~~ei~~~v~~ii~~~l~~~~---~~~i~~ds~l~~dLg~DSLd~vel~~~lE~~f~i~i~~~~~~~~~Tv~dlv~~I   78 (85)
                      +|+++++..+|+++|++.+. ++   ++.++++++|.+|||+|||+.++++..+|++||++||++++.++.||+++++||
T Consensus         3 ~m~~eei~~~v~eiv~~~L~-~~~~~~~~i~~~~~l~~DLG~DSl~~~el~~~le~~f~i~i~~~~~~~~~Tv~~lv~~i   81 (88)
T 2l4b_A            3 SMVSEEIKAQVMESVIGCLK-LNDEQKQILSGTTNLAKDFNLDSLDFVDLIMSLEERFSLEISDEDAQKLETVDDICRYI   81 (88)
T ss_dssp             SSSCHHHHHHHHHHHHHHHT-CCHHHHHSCCTTSCTTTTTTCCHHHHHHHHHHHHHHTTCCCCHHHHHTCCSHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHC-CCCCCCCCCCCCCCHHHHCCCCHHHHHHHHHHHHHHHCCCCCHHHHHCCCCHHHHHHHH
T ss_conf             78899999999999999977-78532101898653888749848999999999999968998999987179999999999


Q ss_pred             HHHHHC
Q ss_conf             985537
Q gi|254780534|r   79 RKAKQT   84 (85)
Q Consensus        79 ~~~~~~   84 (85)
                      .+|+..
T Consensus        82 ~~~~~~   87 (88)
T 2l4b_A           82 ASKSSD   87 (88)
T ss_dssp             HHHSSC
T ss_pred             HHHCCC
T ss_conf             973318