RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780535|ref|YP_003064948.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Candidatus Liberibacter asiaticus str. psy62] (247 letters) >gnl|CDD|36414 KOG1200, KOG1200, KOG1200, Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism]. Length = 256 Score = 207 bits (527), Expect = 3e-54 Identities = 99/245 (40%), Positives = 142/245 (57%), Gaps = 2/245 (0%) Query: 4 LTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANF 63 L K A VTG S IG AIA++L K+GA V + E A + F + Sbjct: 12 LMSKVAAVTGGSSGIGRAIAQLLAKKGARVAVADLDSAAAEATAGDLGGYGDHSAFSCDV 71 Query: 64 SDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLLTRQ 123 S V+ + + + +G +LVN AGI RD L +R + E WD V++VNLT FL+T+ Sbjct: 72 SKAHDVQNTLEEMEKSLGTPSVLVNCAGITRDGLLLRMKQEQWDSVIAVNLTGVFLVTQA 131 Query: 124 LV--PLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVNC 181 V +M + + +IN++S+VG GN GQ NY A+K G+ GFTK A+E R+N+ VN Sbjct: 132 AVRAMVMNQQQGLSIINVSSIVGKIGNFGQTNYAASKGGVIGFTKTAARELARKNIRVNV 191 Query: 182 VAPGFIGSDMTVNLTEDQKGKIISSIPMKRMGAVDDIAAAVLYLSSLEASYVTGQTIHVN 241 V PGFI + MT + KI+ IPM R+G +++A VL+L+S +SY+TG T+ V Sbjct: 192 VLPGFIATPMTEAMPPKVLDKILGMIPMGRLGEAEEVANLVLFLASDASSYITGTTLEVT 251 Query: 242 GGMAM 246 GG+AM Sbjct: 252 GGLAM 256 >gnl|CDD|31231 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]. Length = 251 Score = 190 bits (482), Expect = 5e-49 Identities = 112/254 (44%), Positives = 148/254 (58%), Gaps = 13/254 (5%) Query: 2 FDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHG--TSQEKLEKVAKNFDD--VDRFL 57 DL+GK ALVTGAS IG AIA+ L ++GA V + + +E E +A + R Sbjct: 1 MDLSGKVALVTGASSGIGRAIARALAREGARVVVAARRSEEEAAEALAAAIKEAGGGRAA 60 Query: 58 LFPANFSDRV-SVEYLSKRVNEEMGGVDILVNNAGIVR-DSLFMRARYEDWDDVLSVNLT 115 A+ SD SVE L EE G +DILVNNAGI D+ EDWD V+ VNL Sbjct: 61 AVAADVSDDEESVEALVAAAEEEFGRIDILVNNAGIAGPDAPLEELTEEDWDRVIDVNLL 120 Query: 116 SAFLLTRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRR 175 AFLLTR +PLM + R++NI+SV G G GQ Y A+K+ L G TKALA E R Sbjct: 121 GAFLLTRAALPLMKK---QRIVNISSVAGLGGPPGQAAYAASKAALIGLTKALALELAPR 177 Query: 176 NVTVNCVAPGFIGSDMTVNLTED---QKGKIISSIPMKRMGAVDDIAAAVLYL-SSLEAS 231 + VN VAPG+I + MT L ++ + IP+ R+G +++AAAV +L S AS Sbjct: 178 GIRVNAVAPGYIDTPMTAALESAELEALKRLAARIPLGRLGTPEEVAAAVAFLASDEAAS 237 Query: 232 YVTGQTIHVNGGMA 245 Y+TGQT+ V+GG+ Sbjct: 238 YITGQTLPVDGGLL 251 >gnl|CDD|35944 KOG0725, KOG0725, KOG0725, Reductases with broad range of substrate specificities [General function prediction only]. Length = 270 Score = 159 bits (404), Expect = 5e-40 Identities = 89/259 (34%), Positives = 140/259 (54%), Gaps = 15/259 (5%) Query: 1 MFDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAK----NFDDVDRF 56 L GK ALVTG S IG AIA +L K GA V + G S+E+LE+ A+ + Sbjct: 3 GGRLAGKVALVTGGSSGIGKAIALLLAKAGAKVVITGRSEERLEETAQELGGLGYTGGKV 62 Query: 57 LLFPANFSDRVSVEYL-SKRVNEEMGGVDILVNNAGIVR-DSLFMRARYEDWDDVLSVNL 114 L + S V VE L V + G +DILVNNAG + + E +D +++ NL Sbjct: 63 LAIVCDVSKEVDVEKLVEFAVEKFFGKIDILVNNAGALGLTGSILDLSEEVFDKIMATNL 122 Query: 115 T-SAFLLTRQLVPLMIRNRFGRVINITSVVGFTGNAGQ-VNYCAAKSGLTGFTKALAQET 172 SAF L + P++ +++ G ++NI+SV G G V Y +K+ L T++LA+E Sbjct: 123 RGSAFCLKQAARPMLKKSKGGSIVNISSVAGVGPGPGSGVAYGVSKAALLQLTRSLAKEL 182 Query: 173 GRRNVTVNCVAPGFIGSDMTVNLTEDQKGKII-------SSIPMKRMGAVDDIAAAVLYL 225 + + VN V+PG + + + +D + + ++P+ R+G +++A A +L Sbjct: 183 AKHGIRVNSVSPGLVKTSLRAAGLDDGEMEEFKEATDSKGAVPLGRVGTPEEVAEAAAFL 242 Query: 226 SSLEASYVTGQTIHVNGGM 244 +S +ASY+TGQTI V+GG Sbjct: 243 ASDDASYITGQTIIVDGGF 261 >gnl|CDD|30648 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only]. Length = 265 Score = 150 bits (379), Expect = 4e-37 Identities = 65/226 (28%), Positives = 113/226 (50%), Gaps = 6/226 (2%) Query: 1 MFDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDV--DRFLL 58 + GK AL+TGAS IG +AK L ++G ++ L ++KLE +AK +D + Sbjct: 1 PGPMKGKTALITGASSGIGAELAKQLARRGYNLILVARREDKLEALAKELEDKTGVEVEV 60 Query: 59 FPANFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAF 118 PA+ SD ++E L + E G +D+LVNNAG F+ ++ ++++ +N+ + Sbjct: 61 IPADLSDPEALERLEDELKERGGPIDVLVNNAGFGTFGPFLELSLDEEEEMIQLNILALT 120 Query: 119 LLTRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVT 178 LT+ ++P M+ G +INI S G Y A K+ + F++AL +E V Sbjct: 121 RLTKAVLPGMVERGAGHIINIGSAAGLIPTPYMAVYSATKAFVLSFSEALREELKGTGVK 180 Query: 179 VNCVAPGFIGSDMTVNLTEDQKGKIISSIPMKRMGAVDDIAAAVLY 224 V V PG ++ + + + P + + + +D+A A L Sbjct: 181 VTAVCPGPTRTEF----FDAKGSDVYLLSPGELVLSPEDVAEAALK 222 >gnl|CDD|33946 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only]. Length = 246 Score = 139 bits (352), Expect = 6e-34 Identities = 72/233 (30%), Positives = 113/233 (48%), Gaps = 4/233 (1%) Query: 1 MFDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFP 60 M L GK AL+TGAS IG A A+ L + GA V L +E+LE +A L Sbjct: 1 MTTLKGKVALITGASSGIGEATARALAEAGAKVVLAARREERLEALADEIGA-GAALALA 59 Query: 61 ANFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLL 120 + +DR +VE + + EE G +DILVNNAG+ A +DWD ++ N+ Sbjct: 60 LDVTDRAAVEAAIEALPEEFGRIDILVNNAGLALGDPLDEADLDDWDRMIDTNVKGLLNG 119 Query: 121 TRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVN 180 TR ++P M+ + G +IN+ S+ G G Y A K+ + F+ L QE + V Sbjct: 120 TRAVLPGMVERKSGHIINLGSIAGRYPYPGGAVYGATKAAVRAFSLGLRQELAGTGIRVT 179 Query: 181 CVAPGFIGSDMTVNLTEDQKGKIISSIPMKRMGAV--DDIAAAVLYLSSLEAS 231 ++PG + + + + + + K A+ +DIA AVL+ ++ Sbjct: 180 VISPGLVETTEFSTVRFEGDDERADKV-YKGGTALTPEDIAEAVLFAATQPQH 231 >gnl|CDD|36419 KOG1205, KOG1205, KOG1205, Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]. Length = 282 Score = 135 bits (340), Expect = 1e-32 Identities = 71/230 (30%), Positives = 107/230 (46%), Gaps = 5/230 (2%) Query: 1 MFDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDV---DRFL 57 M L GK L+TGAS IG A+A L K+GA + L +LE+VA+ + ++ L Sbjct: 7 MERLAGKVVLITGASSGIGEALAYELAKRGAKLVLVARRARRLERVAEELRKLGSLEKVL 66 Query: 58 LFPANFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSA 117 + + SD SV+ + G VD+LVNNAGI ED +V+ N+ Sbjct: 67 VLQLDVSDEESVKKFVEWAIRHFGRVDVLVNNAGISLVGFLEDTDIEDVRNVMDTNVFGT 126 Query: 118 FLLTRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGR-RN 176 LT+ +P M + G ++ I+S+ G + Y A+K L GF + L QE Sbjct: 127 VYLTKAALPSMKKRNDGHIVVISSIAGKMPLPFRSIYSASKHALEGFFETLRQELIPLGT 186 Query: 177 VTVNCVAPGFIGSDMTVNLTEDQKGKIISSIPMKRMGAVDDIAAAVLYLS 226 + + V+PG I ++ T ++GK P R V D A +S Sbjct: 187 IIIILVSPGPIETEFTGKELLGEEGKSQQG-PFLRTEDVADPEAVAYAIS 235 >gnl|CDD|36415 KOG1201, KOG1201, KOG1201, Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism]. Length = 300 Score = 125 bits (315), Expect = 1e-29 Identities = 62/192 (32%), Positives = 97/192 (50%), Gaps = 3/192 (1%) Query: 3 DLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPAN 62 ++G+ L+TG +G IA K+GA + L +++ E+ K + + + Sbjct: 35 SVSGEIVLITGGGSGLGRLIALEFAKRGAKLVLWDINKQGNEETVKEIRKIGEAKAYTCD 94 Query: 63 FSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLLTR 122 SDR + L+K+V +E+G VDILVNNAGIV + E+ VN + F T+ Sbjct: 95 ISDREEIYRLAKKVKKEVGDVDILVNNAGIVTGKKLLDCSDEEIQKTFDVNTIAHFWTTK 154 Query: 123 QLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQET---GRRNVTV 179 +P M+ N G ++ I SV G G AG +YCA+K GF ++L+ E G+ + Sbjct: 155 AFLPKMLENNNGHIVTIASVAGLFGPAGLADYCASKFAAVGFHESLSMELRALGKDGIKT 214 Query: 180 NCVAPGFIGSDM 191 V P FI + M Sbjct: 215 TLVCPYFINTGM 226 >gnl|CDD|143883 pfam00106, adh_short, short chain dehydrogenase. This family contains a wide variety of dehydrogenases. Length = 167 Score = 118 bits (299), Expect = 1e-27 Identities = 46/169 (27%), Positives = 77/169 (45%), Gaps = 8/169 (4%) Query: 7 KKALVTGASGSIGLAIAKILYKQGAS----VGLHGTSQEKLEKVAKNFDDVDRFLLFPAN 62 L+TG +G +GLA+A+ L +GA V G + E VA+ + + Sbjct: 1 GTVLITGGTGGLGLALARWLAAEGARHLVLVSRRGDAPGAAELVAELEALGAEVTVAACD 60 Query: 63 FSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLLTR 122 +DR ++ L + +G +D +V+NAG++ D E ++ VL+ +T A+ L Sbjct: 61 VADRDALAALLAALPAALGPLDGVVHNAGVLDDGPLEELTPERFERVLAPKVTGAWNLHE 120 Query: 123 QLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQE 171 + L G + +SV G G+ GQ NY AA + L + E Sbjct: 121 LTLDL----DLGAFVLFSSVAGVLGSPGQANYAAANAALDALAEHRRAE 165 >gnl|CDD|36421 KOG1207, KOG1207, KOG1207, Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism]. Length = 245 Score = 114 bits (286), Expect = 3e-26 Identities = 78/245 (31%), Positives = 115/245 (46%), Gaps = 11/245 (4%) Query: 3 DLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPAN 62 L G LVTGA IG I L K GA V ++ L + K L+ P Sbjct: 4 SLAGVIVLVTGAGAGIGKEIVLSLAKAGAQVIAVARNEANLLSLVKE----TPSLIIPIV 59 Query: 63 FSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLLTR 122 +S ++ + +D LVNNAG+ + F + +D +VN+ + L+ Sbjct: 60 GD--LSAWEALFKLLVPVFPIDGLVNNAGVATNHPFGEITQQSFDRTFAVNVRAVILVA- 116 Query: 123 QLVP--LMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVN 180 QLV L+ R G ++N++S YCA K+ L TK LA E G + + VN Sbjct: 117 QLVARNLVDRQIKGAIVNVSSQASIRPLDNHTVYCATKAALDMLTKCLALELGPQKIRVN 176 Query: 181 CVAPGFIGSDMTVNLTED--QKGKIISSIPMKRMGAVDDIAAAVLYLSSLEASYVTGQTI 238 V P + +DM + D +K K++ IP+KR VD++ AVL+L S +S TG T+ Sbjct: 177 SVNPTVVMTDMGRDNWSDPDKKKKMLDRIPLKRFAEVDEVVNAVLFLLSDNSSMTTGSTL 236 Query: 239 HVNGG 243 V GG Sbjct: 237 PVEGG 241 >gnl|CDD|39371 KOG4169, KOG4169, KOG4169, 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism, General function prediction only]. Length = 261 Score = 109 bits (275), Expect = 6e-25 Identities = 67/204 (32%), Positives = 107/204 (52%), Gaps = 17/204 (8%) Query: 2 FDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRF---LL 58 DLTGK ALVTG +G IGLA +K L ++G V + S+E E +AK ++ + Sbjct: 1 MDLTGKNALVTGGAGGIGLATSKALLEKGIKVLVIDDSEENPEAIAK-LQAINPSVSVIF 59 Query: 59 FPANFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAF 118 + ++R +E ++ G +DIL+N AGI+ D +DW+ ++VNLT Sbjct: 60 IKCDVTNRGDLEAAFDKILATFGTIDILINGAGILDD--------KDWERTINVNLTGVI 111 Query: 119 LLTRQLVPLMIRNRFGR---VINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQET--G 173 T+ +P M + + G+ ++N++SV G Y A+K+G+ GFT++LA Sbjct: 112 NGTQLALPYMDKKQGGKGGIIVNMSSVAGLDPMPVFPVYAASKAGVVGFTRSLADLAYYQ 171 Query: 174 RRNVTVNCVAPGFIGSDMTVNLTE 197 R V N V PGF +D+ N+ Sbjct: 172 RSGVRFNAVCPGFTRTDLAENIDA 195 >gnl|CDD|36413 KOG1199, KOG1199, KOG1199, Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]. Length = 260 Score = 107 bits (269), Expect = 2e-24 Identities = 78/254 (30%), Positives = 111/254 (43%), Gaps = 17/254 (6%) Query: 6 GKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFSD 65 G ALVTG + +G A A+ L KQGASV L Q K VAK F PA+ + Sbjct: 9 GLVALVTGGASGLGKATAERLAKQGASVALLDLPQSKGADVAKELGGKVVFT--PADVTS 66 Query: 66 RVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLF------MRARYEDWDDVLSVNLTSAFL 119 V + + G +D LVN AGI ED+ V+ VN+ F Sbjct: 67 EKDVRAALAKAKAKFGRLDALVNCAGIAYAFKTYNVQKKKHHDLEDFQRVIDVNVLGTFN 126 Query: 120 LTRQLVPLMIRN------RFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETG 173 + R LM N + G +IN SV F G GQ Y A+K + G T +A++ Sbjct: 127 VIRLGAGLMGENEPDQNGQRGVIINTASVAAFDGQTGQAAYSASKGAIVGMTLPIARDLA 186 Query: 174 RRNVTVNCVAPGFIGSDMTVNLTEDQKGKIISSIPM-KRMGAVDDIAAAVLYLSSLEASY 232 + N +APG + + +L E K + IP R+G + A V + +E Y Sbjct: 187 GDGIRFNTIAPGLFDTPLLSSLPEKVKSFLAQLIPFPSRLGHPHEYAHLVQAI--IENPY 244 Query: 233 VTGQTIHVNGGMAM 246 + G+ I +G + M Sbjct: 245 LNGEVIRFDGALRM 258 >gnl|CDD|36232 KOG1014, KOG1014, KOG1014, 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism]. Length = 312 Score = 105 bits (264), Expect = 1e-23 Identities = 57/193 (29%), Positives = 95/193 (49%), Gaps = 7/193 (3%) Query: 5 TGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANF- 63 G A+VTGA+ IG A A+ L K+G +V L +QEKLE VAK ++ + + Sbjct: 48 LGSWAVVTGATDGIGKAYARELAKRGFNVVLISRTQEKLEAVAKEIEEKYKVEVRIIAID 107 Query: 64 --SDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYED--WDDVLSVNLTSAFL 119 E L +++ V ILVNN G+ D +Y + ++++VN+ S L Sbjct: 108 FTKGDEVYEKLLEKLAG--LDVGILVNNVGMSYDYPESFLKYPEGELQNIINVNILSVTL 165 Query: 120 LTRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTV 179 LT+ ++P M+ + G ++NI S G Y A+K+ + F++ L +E + + V Sbjct: 166 LTQLILPGMVERKKGIIVNIGSFAGLIPTPLLSVYSASKAFVDFFSRCLQKEYESKGIFV 225 Query: 180 NCVAPGFIGSDMT 192 V P + + M Sbjct: 226 QSVIPYLVATKMA 238 >gnl|CDD|36422 KOG1208, KOG1208, KOG1208, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism]. Length = 314 Score = 95.4 bits (237), Expect = 1e-20 Identities = 52/203 (25%), Positives = 94/203 (46%), Gaps = 19/203 (9%) Query: 1 MFDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAK---NFDDVDRFL 57 DL+GK ALVTGA+ IG A+ L +GA V L ++E+ E+ + + Sbjct: 30 GIDLSGKVALVTGATSGIGFETARELALRGAHVVLACRNEERGEEAKEQIQKGKANQKIR 89 Query: 58 LFPANFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSA 117 + + S SV ++ ++ G +D+L+NNAG++ + + + + N Sbjct: 90 VIQLDLSSLKSVRKFAEEFKKKEGPLDVLINNAGVMAPPFSLTK--DGLELTFATNYLGH 147 Query: 118 FLLTRQLVPLMIRNRFGRVINITSVVG-FTGNAGQVN------------YCAAKSGLTGF 164 FLLT L+PL+ R+ R++N++S++G + ++ Y +K Sbjct: 148 FLLTELLLPLLKRSAPSRIVNVSSILGGGKIDLKDLSGEKAKLYSSDAAYALSKLANVLL 207 Query: 165 TKALAQETGRRNVTVNCVAPGFI 187 LA+ ++ VT V PG + Sbjct: 208 ANELAKRL-KKGVTTYSVHPGVV 229 >gnl|CDD|36424 KOG1210, KOG1210, KOG1210, Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism]. Length = 331 Score = 91.5 bits (227), Expect = 2e-19 Identities = 47/183 (25%), Positives = 77/183 (42%), Gaps = 4/183 (2%) Query: 7 KKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDD---VDRFLLFPANF 63 + L+TG S +GLA+A ++GA V + S +KL + + V+ + Sbjct: 34 RHILITGGSSGLGLALALECKREGADVTITARSGKKLLEAKAELELLTQVEDVSYKSVDV 93 Query: 64 SDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLLTRQ 123 D SV + + + + G +D L AG+ LF E + ++ VN + + Sbjct: 94 IDYDSVSKVIEELRDLEGPIDNLFCCAGVAVPGLFEDLSPEVVEKLMDVNYLGTVNVAKA 153 Query: 124 LVPLM-IRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVNCV 182 M R GR+I ++S + G G Y +K L G +AL QE + V V Sbjct: 154 AARAMKKREHLGRIILVSSQLAMLGIYGYSAYSPSKFALRGLAEALRQELIKYGVHVTLY 213 Query: 183 APG 185 P Sbjct: 214 YPP 216 >gnl|CDD|33748 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane]. Length = 245 Score = 91.1 bits (226), Expect = 2e-19 Identities = 53/183 (28%), Positives = 93/183 (50%), Gaps = 5/183 (2%) Query: 4 LTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANF 63 TG L+TG + IGLA+AK + G +V + G ++E+L + + + Sbjct: 3 TTGNTILITGGASGIGLALAKRFLELGNTVIICGRNEERLAEAKAENPE---IHTEVCDV 59 Query: 64 SDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRAR--YEDWDDVLSVNLTSAFLLT 121 +DR S L + + +E +++L+NNAGI R+ A +D + ++ NL + LT Sbjct: 60 ADRDSRRELVEWLKKEYPNLNVLINNAGIQRNEDLTGAEDLLDDAEQEIATNLLAPIRLT 119 Query: 122 RQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVNC 181 L+P ++R +IN++S + F A YCA K+ + +T AL ++ +V V Sbjct: 120 ALLLPHLLRQPEATIINVSSGLAFVPMASTPVYCATKAAIHSYTLALREQLKDTSVEVIE 179 Query: 182 VAP 184 +AP Sbjct: 180 LAP 182 >gnl|CDD|30968 COG0623, FabI, Enoyl-[acyl-carrier-protein]. Length = 259 Score = 89.8 bits (223), Expect = 5e-19 Identities = 63/258 (24%), Positives = 123/258 (47%), Gaps = 24/258 (9%) Query: 1 MFDLTGKKALVTGASG--SIGLAIAKILYKQGASVGLHGTSQEKLEK-VAKNFDDVDRFL 57 M L GK+ L+ G + SI IAK L +QGA + E+LEK V + +++ L Sbjct: 1 MGLLEGKRILIMGVANNRSIAWGIAKALAEQGAELAF-TYQGERLEKRVEELAEELGSDL 59 Query: 58 LFPANFSDRVSVEYLSKRVNEEMGGVDILVNNAGIV-RDSL---FMRARYEDWDDVLSVN 113 + P + ++ S++ L + ++ G +D LV++ ++ L ++ E + + ++ Sbjct: 60 VLPCDVTNDESIDALFATIKKKWGKLDGLVHSIAFAPKEELKGDYLDTSREGFLIAMDIS 119 Query: 114 LTSAFLLTRQLVPLMIRNRFGRVINITSVVGFTGNAGQV-NY---CAAKSGLTGFTKALA 169 S L + PLM N G ++ +T + G+ V NY AK+ L + LA Sbjct: 120 AYSFTALAKAARPLM--NNGGSILTLT----YLGSERVVPNYNVMGVAKAALEASVRYLA 173 Query: 170 QETGRRNVTVNCVAPGFIGSDMTVNLTEDQKGKIISSI----PMKRMGAVDDIAAAVLYL 225 + G+ + VN ++ G I + + + K++ P++R ++++ +L Sbjct: 174 ADLGKEGIRVNAISAGPIRTLAASGIGD--FRKMLKENEANAPLRRNVTIEEVGNTAAFL 231 Query: 226 SSLEASYVTGQTIHVNGG 243 S +S +TG+ I+V+ G Sbjct: 232 LSDLSSGITGEIIYVDSG 249 >gnl|CDD|36823 KOG1610, KOG1610, KOG1610, Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism, General function prediction only]. Length = 322 Score = 86.1 bits (213), Expect = 8e-18 Identities = 60/200 (30%), Positives = 95/200 (47%), Gaps = 19/200 (9%) Query: 3 DLTGKKALVTGASGSIGLAIAKILYKQGASVG---LHGTSQEKLEKVAKNFDDVDRFLLF 59 L+ K L+TG G +AK L K+G V L E L K+ R Sbjct: 26 SLSDKAVLITGCDSGFGRLLAKKLDKKGFRVFAGCLTEEGAESLRGETKS----PRLRTL 81 Query: 60 PANFSDRVSVEYLSKRVNEEMG--GVDILVNNAGIVR-----DSLFMRARYEDWDDVLSV 112 + + SV+ ++ V + +G G+ LVNNAGI + L + ED+ VL+V Sbjct: 82 QLDVTKPESVKEAAQWVKKHLGEDGLWGLVNNAGISGFLGPDEWLTV----EDYRKVLNV 137 Query: 113 NLTSAFLLTRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQET 172 NL +T+ +PL+ R R GRV+N++SV+G YC +K + F+ +L +E Sbjct: 138 NLLGTIRVTKAFLPLLRRAR-GRVVNVSSVLGRVALPALGPYCVSKFAVEAFSDSLRREL 196 Query: 173 GRRNVTVNCVAPGFIGSDMT 192 V V+ + PGF +++ Sbjct: 197 RPFGVKVSIIEPGFFKTNLA 216 >gnl|CDD|36418 KOG1204, KOG1204, KOG1204, Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]. Length = 253 Score = 66.5 bits (162), Expect = 6e-12 Identities = 45/202 (22%), Positives = 84/202 (41%), Gaps = 5/202 (2%) Query: 1 MFDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFP 60 M K L+TGAS IG + + +G ++ E D F+ Sbjct: 1 MDLNMRKVILLTGASRGIGTGSVATILAEDDEALRYGVARLLAELEGLKVAYGDDFVHVV 60 Query: 61 ANFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRD--SLFMR-ARYEDWDDVLSVNLTSA 117 + ++ + L + ++ G DI+++NAG + D + + W +NL S Sbjct: 61 GDITEEQLLGALREAPRKKGGKRDIIIHNAGSLGDVSKGAVDLGDSDQWKKYWDLNLFSM 120 Query: 118 FLLTRQLVPLMIRNRF-GRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRN 176 L + +P + ++ G V+N++S+ + YC++K+ + LA E + Sbjct: 121 VSLVQWALPKLKKSPVNGNVVNVSSLAAVRPFSSWAAYCSSKAARNMYFMVLASEE-PFD 179 Query: 177 VTVNCVAPGFIGSDMTVNLTED 198 V V APG + + M V + E Sbjct: 180 VRVLNYAPGVVDTQMQVCIRET 201 >gnl|CDD|36824 KOG1611, KOG1611, KOG1611, Predicted short chain-type dehydrogenase [General function prediction only]. Length = 249 Score = 63.0 bits (153), Expect = 7e-11 Identities = 49/206 (23%), Positives = 89/206 (43%), Gaps = 22/206 (10%) Query: 7 KKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVD----RFLLFPAN 62 K +TGA+ IGL + K L K + T+++ EK A R + + Sbjct: 4 KSVFITGANRGIGLGLVKELLKDKGIEVIIATARD-PEKAATELALKSKSDSRVHIIQLD 62 Query: 63 FSDRVSVEYLSKRVNEEMG--GVDILVNNAGIVRD-SLFMRARYEDWDDVLSVNLTSAFL 119 + S++ + V + +G G+++L+NNAGI + ++ + N L Sbjct: 63 VTCDESIDNFVQEVEKIVGSDGLNLLINNAGIALSYNTVLKPSRAVLLEQYETNAVGPIL 122 Query: 120 LTRQLVPLMIRNR-----------FGRVINITSVVGFTG---NAGQVNYCAAKSGLTGFT 165 LT+ +PL+ + +INI+S G G G Y +K+ L F Sbjct: 123 LTQAFLPLLKKAASKVSGDGLSVSRAAIINISSSAGSIGGFRPGGLSAYRMSKAALNMFA 182 Query: 166 KALAQETGRRNVTVNCVAPGFIGSDM 191 K+L+ + ++ V + PG++ +DM Sbjct: 183 KSLSVDLKDDHILVVSIHPGWVQTDM 208 >gnl|CDD|36423 KOG1209, KOG1209, KOG1209, 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism]. Length = 289 Score = 60.4 bits (146), Expect = 5e-10 Identities = 41/186 (22%), Positives = 70/186 (37%), Gaps = 10/186 (5%) Query: 9 ALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANF---SD 65 + +SG IG A+AK + G V E + ++A F L P Sbjct: 11 LITGCSSGGIGYALAKEFARNGYLVYATARRLEPMAQLAIQFG------LKPYKLDVSKP 64 Query: 66 RVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLLTRQLV 125 V + G +D+L NNAG + A + VN+ + R L Sbjct: 65 EEVVTVSGEVRANPDGKLDLLYNNAGQSCTFPALDATIAAVEQCFKVNVFGHIRMCRALS 124 Query: 126 PLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVNCVAPG 185 +I+ + G ++N+ S+ G Y A+K+ + + + L E V V G Sbjct: 125 HFLIKAK-GTIVNVGSLAGVVPFPFGSIYSASKAAIHAYARTLRLELKPFGVRVINAITG 183 Query: 186 FIGSDM 191 + +D+ Sbjct: 184 GVATDI 189 >gnl|CDD|133446 cd01078, NAD_bind_H4MPT_DH, NADP binding domain of methylene tetrahydromethanopterin dehydrogenase. Methylene Tetrahydromethanopterin Dehydrogenase (H4MPT DH) NADP binding domain. NADP-dependent H4MPT DH catalyzes the dehydrogenation of methylene- H4MPT and methylene-tetrahydrofolate (H4F) with NADP+ as cofactor. H4F and H4MPT are both cofactors that carry the one-carbon units between the formyl and methyl oxidation level. H4F and H4MPT are structurally analogous to each other with respect to the pterin moiety, but each has distinct side chain. H4MPT is present only in anaerobic methanogenic archaea and aerobic methylotrophic proteobacteria. H4MPT seems to have evolved independently from H4F and functions as a distinct carrier in C1 metabolism. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DH, amino acid DHs, repressor rex, NAD-binding potassium channel domain, CoA-binding, and ornithine cyclodeaminase-like domains. These domains have an alpha-beta-alpha configuration. NAD binding involves numerous hydrogen and van der Waals contacts. Length = 194 Score = 43.9 bits (104), Expect = 4e-05 Identities = 19/46 (41%), Positives = 27/46 (58%) Query: 3 DLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAK 48 DL GK A+V G +G +G A +L ++GA V L G E+ +K A Sbjct: 25 DLKGKTAVVLGGTGPVGQRAAVLLAREGARVVLVGRDLERAQKAAD 70 >gnl|CDD|36691 KOG1478, KOG1478, KOG1478, 3-keto sterol reductase [Lipid transport and metabolism]. Length = 341 Score = 41.1 bits (96), Expect = 2e-04 Identities = 46/232 (19%), Positives = 81/232 (34%), Gaps = 46/232 (19%) Query: 7 KKALVTGASGSIGLAIAK-ILYKQGASVGLH----GTSQEKLEKVAKNF-----DDVDRF 56 K AL+TGA+ +GLAI K +L + +V L + K E V Sbjct: 4 KVALITGANSGLGLAICKRLLAEDDENVRLTLCLTCRNMSKAEAVCAALKAFHPKSTIEV 63 Query: 57 LLFPANFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRD----------SLFMRA----- 101 + S+ SV SK + + +D + NAGI+ + LF Sbjct: 64 TYVLVDVSNMQSVFRASKDIKQRFQRLDYIYLNAGIMPNPGINWKAAVFGLFSNPVIAMT 123 Query: 102 ------------RYEDWDDVLSVNLTSAFLLTRQLVPLMIRNRFGRVINITSVVG----- 144 + ++ N+ F L R+L PL+ + +++ +S + Sbjct: 124 SPTEGLLTQGKISADGLGEIFETNVFGHFYLIRELEPLLCHSDNPQLVWTSSRMARKKNL 183 Query: 145 ----FTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVNCVAPGFIGSDMT 192 F + G+ Y ++K AL + + V PG ++ Sbjct: 184 SLEDFQHSKGKEPYSSSKRLTDLLHVALNRNFKPLGINQYVVQPGIFTTNSF 235 >gnl|CDD|36715 KOG1502, KOG1502, KOG1502, Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms]. Length = 327 Score = 41.0 bits (96), Expect = 3e-04 Identities = 26/70 (37%), Positives = 33/70 (47%), Gaps = 7/70 (10%) Query: 1 MFDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGT--SQEKLEKV--AKNFDDVDRF 56 M GKK VTGASG IG I K+L +G +V GT E +K + + Sbjct: 1 MDQDEGKKVCVTGASGFIGSWIVKLLLSRGYTV--RGTVRDPEDEKKTEHLRKLEGAKER 58 Query: 57 L-LFPANFSD 65 L LF A+ D Sbjct: 59 LKLFKADLLD 68 >gnl|CDD|30800 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]. Length = 314 Score = 39.6 bits (91), Expect = 0.001 Identities = 28/142 (19%), Positives = 51/142 (35%), Gaps = 19/142 (13%) Query: 7 KKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFSDR 66 + LVTG +G IG + + L G V ++ L+ + + V + +DR Sbjct: 1 MRILVTGGAGFIGSHLVERLLAAGHDVRGLDRLRDGLDPLLSGVEFV------VLDLTDR 54 Query: 67 VSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLLTRQLVP 126 V+ L+K V D +++ A + ++ DV T L+ Sbjct: 55 DLVDELAKGVP------DAVIHLAAQSSVPDSNASDPAEFLDV-------NVDGTLNLLE 101 Query: 127 LMIRNRFGRVINITSVVGFTGN 148 R + +SV G+ Sbjct: 102 AARAAGVKRFVFASSVSVVYGD 123 >gnl|CDD|144821 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family. This family of proteins utilize NAD as a cofactor. The proteins in this family use nucleotide-sugar substrates for a variety of chemical reactions. Length = 235 Score = 39.2 bits (92), Expect = 0.001 Identities = 29/134 (21%), Positives = 49/134 (36%), Gaps = 17/134 (12%) Query: 9 ALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFSDRVS 68 LVTG +G IG A+ + L ++G V + G + RF + +D + Sbjct: 1 ILVTGGTGFIGSALVRRLLQEGYEVIVLGRRRRSESLN----TGRIRFRFHEGDLTDPDA 56 Query: 69 VEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLLTRQLVPLM 128 +E L D +++ A A +ED + + N L T L+ Sbjct: 57 LERL-----LAEVQPDAVIHLAAQSGV----GASFEDPAEFIRAN----VLGTLNLLEAA 103 Query: 129 IRNRFGRVINITSV 142 R R + +S Sbjct: 104 RRAGVKRFVFASSS 117 >gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. This group contains proteins that share the characteristic catalytic and structural zinc-binding sites of the zinc-dependent alcohol dehydrogenase family. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine (His-51), the ribose of NAD, a serine (Ser-48), then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 332 Score = 35.8 bits (83), Expect = 0.011 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 13/87 (14%) Query: 6 GKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFSD 65 G LVTGA G +G+ ++ GA V S EKL+ + + D ++ + FS+ Sbjct: 163 GDTVLVTGAGGGVGIHAIQLAKALGARVIAVTRSPEKLKILKELGADY---VIDGSKFSE 219 Query: 66 RVSVEYLSKRVNEEMGGVDILVNNAGI 92 V +++GG D+++ G Sbjct: 220 DV----------KKLGGADVVIELVGS 236 >gnl|CDD|30949 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]. Length = 326 Score = 35.4 bits (81), Expect = 0.016 Identities = 35/140 (25%), Positives = 58/140 (41%), Gaps = 16/140 (11%) Query: 6 GKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFSD 65 G+ LV GA+G +G A ++ GA+V +S EKLE + + A+ Sbjct: 143 GETVLVHGAAGGVGSAAIQLAKALGATVVAVVSSSEKLELLKE----------LGADHVI 192 Query: 66 RVSVEYLSKRVNEEMGG--VDILVNNAG--IVRDSLFMRARYEDWDDVLSVNLTSAFLLT 121 E ++V E GG VD++++ G SL A V L+ + Sbjct: 193 NYREEDFVEQVRELTGGKGVDVVLDTVGGDTFAASLAALAPGGRL--VSIGALSGGPPVP 250 Query: 122 RQLVPLMIRNRFGRVINITS 141 L+PL+ + R + + S Sbjct: 251 LNLLPLLGKRLTLRGVTLGS 270 >gnl|CDD|31283 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]. Length = 588 Score = 34.5 bits (79), Expect = 0.032 Identities = 17/73 (23%), Positives = 26/73 (35%), Gaps = 4/73 (5%) Query: 4 LTGKKALVTGASGSIGLAIAKILYKQGAS----VGLHGTSQEKLEKVAKNFDDVDRFLLF 59 LTGK LVTG GSIG + + + K ++ + + + Sbjct: 248 LTGKTVLVTGGGGSIGSELCRQILKFNPKEIILFSRDEYKLYLIDMELREKFPELKLRFY 307 Query: 60 PANFSDRVSVEYL 72 + DR VE Sbjct: 308 IGDVRDRDRVERA 320 >gnl|CDD|133451 cd05212, NAD_bind_m-THF_DH_Cyclohyd_like, NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase. NAD(P) binding domains of methylene-tetrahydrofolate dehydrogenase (m-THF DH) and m-THF DH/cyclohydrolase bifunctional enzymes (m-THF DH/cyclohydrolase). M-THF is a versatile carrier of activated one-carbon units. The major one-carbon folate donors are N-5 methyltetrahydrofolate, N5,N10-m-THF, and N10-formayltetrahydrofolate. The oxidation of metabolic intermediate m-THF to m-THF requires the enzyme m-THF DH. In addition, most DHs also have an associated cyclohydrolase activity which catalyzes its hydrolysis to N10-formyltetrahydrofolate. m-THF DH is typically found as part of a multifunctional protein in eukaryotes. NADP-dependent m-THF DH in mammals, birds and yeast are components of a trifunctional enzyme with DH, cyclohydrolase, and synthetase activities. Certain eukaryotic cells also contain homodimeric bifunctional DH/cyclodrolase form. In bacteria, mono-functional DH, as well as bifunctional DH/cyclodrolase are found. In addition, yeast (S. cerevisiae) also express a monofunctional DH. M-THF DH, like other amino acid DH-like NAD(P)-binding domains, is a member of the Rossmann fold superfamily which includes glutamate, leucine, and phenylalanine DHs, m-THF DH, methylene-tetrahydromethanopterin DH, m-THF DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DH, amino acid DHs, repressor rex, NAD-binding potassium channel domain, CoA-binding, and ornithine cyclodeaminase-like domains. These domains have an alpha-beta-alpha configuration. NAD binding involves numerous hydrogen and van der Waals contacts. Length = 140 Score = 32.9 bits (75), Expect = 0.082 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Query: 3 DLTGKKALVTGASGSIGLAIAKILYKQGASV-GLHGTSQEKLEKVAK 48 L GKK LV G SG +G + +L + GA+V + + KV Sbjct: 25 RLDGKKVLVVGRSGIVGAPLQCLLQRDGATVYSCDWKTIQLQSKVHD 71 >gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family. This group contains members identified as related to zinc-dependent alcohol dehydrogenase and other members of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group includes various activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 337 Score = 32.5 bits (75), Expect = 0.098 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 2/63 (3%) Query: 6 GKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFSD 65 G LV GA G IGL + ++ +GA V + E+LE A+ D + + + Sbjct: 160 GDTVLVVGA-GPIGLGVIQVAKARGARVIVVDIDDERLE-FARELGADDTINVGDEDVAA 217 Query: 66 RVS 68 R+ Sbjct: 218 RLR 220 >gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family. The medium chain reductase/dehydrogenases (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH) , quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Other MDR members have only a catalytic zinc, and some contain no coordinated zinc. Length = 271 Score = 32.3 bits (74), Expect = 0.12 Identities = 23/86 (26%), Positives = 35/86 (40%), Gaps = 10/86 (11%) Query: 6 GKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFSD 65 G LV GA G +GL A++ GA V + S EKLE + L + D Sbjct: 135 GDTVLVLGA-GGVGLLAAQLAKAAGARVIVTDRSDEKLELAKE---------LGADHVID 184 Query: 66 RVSVEYLSKRVNEEMGGVDILVNNAG 91 + + GG D++++ G Sbjct: 185 YKEEDLEEELRLTGGGGADVVIDAVG 210 >gnl|CDD|176210 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 1. Human Reticulon 4 Interacting Protein 1 is a member of the medium chain dehydrogenase/ reductase (MDR) family. Riticulons are endoplasmic reticulum associated proteins involved in membrane trafficking and neuroendocrine secretion. The MDR/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Length = 350 Score = 32.2 bits (74), Expect = 0.13 Identities = 11/29 (37%), Positives = 16/29 (55%) Query: 5 TGKKALVTGASGSIGLAIAKILYKQGASV 33 GK+ L+ G SG +G ++L GA V Sbjct: 162 AGKRVLILGGSGGVGTFAIQLLKAWGAHV 190 >gnl|CDD|36412 KOG1198, KOG1198, KOG1198, Zinc-binding oxidoreductase [Energy production and conversion, General function prediction only]. Length = 347 Score = 31.9 bits (72), Expect = 0.17 Identities = 24/87 (27%), Positives = 35/87 (40%), Gaps = 9/87 (10%) Query: 5 TGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFS 64 GK LV G SG +G A ++ GA + S+EKLE V K D + Sbjct: 157 KGKSVLVLGGSGGVGTAAIQLAKHAGAIKVVTACSKEKLELVKKL--GADEVV------- 207 Query: 65 DRVSVEYLSKRVNEEMGGVDILVNNAG 91 D + GVD++++ G Sbjct: 208 DYKDENVVELIKKYTGKGVDVVLDCVG 234 >gnl|CDD|35292 KOG0069, KOG0069, KOG0069, Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion]. Length = 336 Score = 31.5 bits (71), Expect = 0.20 Identities = 29/99 (29%), Positives = 43/99 (43%), Gaps = 11/99 (11%) Query: 1 MFDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFP 60 +DL GK + G G IG AIAK L G + H +Q E+ + + + Sbjct: 157 GYDLEGKTVGILGL-GRIGKAIAKRLKPFGCVILYHSRTQLPPEEAYEYYAEFVDIEELL 215 Query: 61 ANFSDRVSV---------EYLSKRVNEEMGGVDILVNNA 90 AN SD + V ++K+ E+M +LVN A Sbjct: 216 AN-SDVIVVNCPLTKETRHLINKKFIEKMKDGAVLVNTA 253 >gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 323 Score = 31.7 bits (73), Expect = 0.21 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 6/44 (13%) Query: 6 GKKALVTGASGSIGLA---IAKILYKQGASVGLHGTSQEKLEKV 46 G+ LV GA+G +GLA +AK L GA V +S+EKL Sbjct: 140 GETVLVLGAAGGVGLAAVQLAKAL---GARVIAAASSEEKLALA 180 >gnl|CDD|30539 COG0190, FolD, 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism]. Length = 283 Score = 31.7 bits (72), Expect = 0.22 Identities = 16/49 (32%), Positives = 25/49 (51%) Query: 3 DLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFD 51 DL GK +V G S +G +A +L A+V + + + L + KN D Sbjct: 153 DLRGKNVVVVGRSNIVGKPLALLLLNANATVTVCHSRTKDLASITKNAD 201 >gnl|CDD|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 331 Score = 31.5 bits (72), Expect = 0.24 Identities = 16/39 (41%), Positives = 26/39 (66%), Gaps = 2/39 (5%) Query: 4 LTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEK 42 LTG++ L+ GASG +G A+ ++ GA V +GT+ E+ Sbjct: 138 LTGQRVLIHGASGGVGQALLELALLAGAEV--YGTASER 174 >gnl|CDD|133452 cd05213, NAD_bind_Glutamyl_tRNA_reduct, NADP-binding domain of glutamyl-tRNA reductase. Glutamyl-tRNA reductase catalyzes the conversion of glutamyl-tRNA to glutamate-1-semialdehyde, initiating the synthesis of tetrapyrrole. Whereas tRNAs are generally associated with peptide bond formation in protein translation, here the tRNA activates glutamate in the initiation of tetrapyrrole biosynthesis in archaea, plants and many bacteria. In the first step, activated glutamate is reduced to glutamate-1-semi-aldehyde via the NADPH dependent glutamyl-tRNA reductase. Glutamyl-tRNA reductase forms a V-shaped dimer. Each monomer has 3 domains: an N-terminal catalytic domain, a classic nucleotide binding domain, and a C-terminal dimerization domain. Although the representative structure 1GPJ lacks a bound NADPH, a theoretical binding pocket has been described. (PMID 11172694). Amino acid dehydrogenase (DH)-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DH, amino acid DHs, repressor rex, NAD-binding potassium channel domain, CoA-binding, and ornithine cyclodeaminase-like domains. These domains have an alpha-beta-alpha configuration. NAD binding involves numerous hydrogen and van der Waals contacts. Length = 311 Score = 31.1 bits (71), Expect = 0.31 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Query: 1 MFDLTGKKALVTGASGSIGLAIAKILYKQGAS-VGLHGTSQEKLEKVAKNFD 51 +L GKK LV GA G +G AK L +G + + + + E+ E++AK Sbjct: 173 FGNLKGKKVLVIGA-GEMGELAAKHLAAKGVAEITIANRTYERAEELAKELG 223 >gnl|CDD|31286 COG1089, Gmd, GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane]. Length = 345 Score = 31.0 bits (70), Expect = 0.34 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Query: 5 TGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQE 41 GK AL+TG +G G +A++L ++G V HG + Sbjct: 1 MGKVALITGITGQDGSYLAELLLEKGYEV--HGIKRR 35 >gnl|CDD|34587 COG4982, COG4982, 3-oxoacyl-[acyl-carrier protein]. Length = 866 Score = 30.8 bits (69), Expect = 0.35 Identities = 26/81 (32%), Positives = 37/81 (45%), Gaps = 7/81 (8%) Query: 6 GKKALVTGAS-GSIGLAIAKILYKQGASVGLHGT--SQEKLEKVAKNFDDVDR----FLL 58 K ALVTGAS GSI A+ L GA+V + S+E+ E + R + Sbjct: 396 DKVALVTGASKGSIAAAVVARLLAGGATVIATTSRLSEERTEFYRSLYARHARYGAALWV 455 Query: 59 FPANFSDRVSVEYLSKRVNEE 79 PAN V+ L + + +E Sbjct: 456 VPANMGSYSDVDALIEWIGDE 476 >gnl|CDD|31834 COG1648, CysG, Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism]. Length = 210 Score = 30.7 bits (69), Expect = 0.41 Identities = 32/112 (28%), Positives = 47/112 (41%), Gaps = 19/112 (16%) Query: 1 MFDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTS----------QEKLEKVAKNF 50 DL GKK LV G GS+ L A++L K GA V + + K++ + + F Sbjct: 7 FLDLEGKKVLVVG-GGSVALRKARLLLKAGADVTVVSPEFEPELKALIEEGKIKWIEREF 65 Query: 51 D---DVDRFLLFPANFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFM 99 D D FL+ A E L++R+ + ILVN F+ Sbjct: 66 DAEDLDDAFLVIAA-----TDDEELNERIAKAARERRILVNVVDDPELCDFI 112 >gnl|CDD|144908 pfam01488, Shikimate_DH, Shikimate / quinate 5-dehydrogenase. This family contains both shikimate and quinate dehydrogenases. Shikimate 5-dehydrogenase catalyses the conversion of shikimate to 5-dehydroshikimate. This reaction is part of the shikimate pathway which is involved in the biosynthesis of aromatic amino acids. Quinate 5-dehydrogenase catalyses the conversion of quinate to 5-dehydroquinate. This reaction is part of the quinate pathway where quinic acid is exploited as a source of carbon in prokaryotes and microbial eukaryotes. Both the shikimate and quinate pathways share two common pathway metabolites 3-dehydroquinate and dehydroshikimate. Length = 134 Score = 30.4 bits (69), Expect = 0.52 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Query: 3 DLTGKKALVTGASGSIGLAIAKILYKQGAS-VGLHGTSQEKLEKVAKNFDDV 53 DL GKK L+ GA G + AK L +GA + + + EK +++A+ F Sbjct: 9 DLKGKKVLLIGA-GEMARLAAKHLLSKGAKKITIANRTLEKAKELAEEFGGE 59 >gnl|CDD|36416 KOG1202, KOG1202, KOG1202, Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism]. Length = 2376 Score = 29.9 bits (67), Expect = 0.57 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 8/86 (9%) Query: 79 EMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLL---TRQLVPLMIRNRFGR 135 ++G V + N A ++RD L +++ DV + L +R++ P + Sbjct: 1845 KLGPVGGIFNLAAVLRDGLIENQTPKNFKDVAKPKYSGTINLDRVSREICPEL-----DY 1899 Query: 136 VINITSVVGFTGNAGQVNYCAAKSGL 161 + +SV GNAGQ NY A S + Sbjct: 1900 FVVFSSVSCGRGNAGQTNYGLANSAM 1925 >gnl|CDD|31287 COG1090, COG1090, Predicted nucleoside-diphosphate sugar epimerase [General function prediction only]. Length = 297 Score = 29.8 bits (67), Expect = 0.68 Identities = 35/163 (21%), Positives = 58/163 (35%), Gaps = 25/163 (15%) Query: 10 LVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFSDRVSV 69 L+TG +G IG A+ L K G V + K A+ + +V Sbjct: 2 LITGGTGLIGRALTARLRKGGHQVTILTRRPPK------------------ASQNLHPNV 43 Query: 70 EYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDWDDVLSVNLTSAFLLTRQLVPLM- 128 + G+D ++N AG + + R E + + S T +LV L+ Sbjct: 44 TLWEGLADALTLGIDAVINLAG---EPIAERRWTEKQKEEI---RQSRINTTEKLVELIA 97 Query: 129 IRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQE 171 +V+ S VG+ G++G F L Q+ Sbjct: 98 ASETKPKVLISASAVGYYGHSGDRVVTEESPPGDDFLAQLCQD 140 >gnl|CDD|145831 pfam02882, THF_DHG_CYH_C, Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain. Length = 159 Score = 29.7 bits (68), Expect = 0.72 Identities = 12/31 (38%), Positives = 17/31 (54%) Query: 3 DLTGKKALVTGASGSIGLAIAKILYKQGASV 33 DL GK +V G S +G +A +L A+V Sbjct: 33 DLAGKNVVVIGRSNIVGKPLALLLLNANATV 63 >gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)- dependent oxidation. THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria) and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Length = 341 Score = 29.5 bits (67), Expect = 0.78 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 3 DLTGKKALVTGASGSIGLAIAKILYKQGAS 32 D++GK L+TG G IGL + GAS Sbjct: 161 DVSGKSVLITGC-GPIGLMAIAVAKAAGAS 189 >gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 328 Score = 29.5 bits (67), Expect = 0.80 Identities = 12/24 (50%), Positives = 16/24 (66%) Query: 10 LVTGASGSIGLAIAKILYKQGASV 33 L+T AS S+GLA +I GA+V Sbjct: 149 LITAASSSVGLAAIQIANAAGATV 172 >gnl|CDD|38800 KOG3593, KOG3593, KOG3593, Predicted receptor-like serine/threonine kinase [Signal transduction mechanisms]. Length = 355 Score = 29.3 bits (65), Expect = 0.95 Identities = 17/73 (23%), Positives = 29/73 (39%), Gaps = 3/73 (4%) Query: 21 AIAKILYKQGASVGLHGT--SQEKLEKVAKNFDDVDRFLLFPANFSDRVSVEYLSKRVNE 78 I + A+V +G + + LE V + D L + + Y ++R NE Sbjct: 60 VIPAVNCGGDAAVDNYGIRFAADPLEGVGRA-SDYGMVLGIGCRAEEEDIILYQTERYNE 118 Query: 79 EMGGVDILVNNAG 91 E G D+ + G Sbjct: 119 ETFGYDVPIKEDG 131 >gnl|CDD|31252 COG1052, LdhA, Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only]. Length = 324 Score = 29.4 bits (66), Expect = 0.97 Identities = 17/54 (31%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Query: 1 MFDLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVD 54 FDL GK + G G IG A+A+ L G V + S + VD Sbjct: 141 GFDLRGKTLGIIGL-GRIGQAVARRLKGFGMKVLYYDRSPNPEAEKELGARYVD 193 >gnl|CDD|34904 COG5322, COG5322, Predicted dehydrogenase [General function prediction only]. Length = 351 Score = 29.2 bits (65), Expect = 1.0 Identities = 12/43 (27%), Positives = 18/43 (41%) Query: 3 DLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEK 45 DL+ + GA+G I AIA+ L + L E + Sbjct: 164 DLSQATVAIVGATGDIASAIARWLAPKVGVKELLLRDAEARNR 206 >gnl|CDD|133419 cd00650, LDH_MDH_like, NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family. Members of this family include ubiquitous enzymes like L-lactate dehydrogenases (LDH), L-2-hydroxyisocaproate dehydrogenases, and some malate dehydrogenases (MDH). LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH/MDH-like proteins are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others. Length = 263 Score = 29.2 bits (66), Expect = 1.1 Identities = 25/102 (24%), Positives = 41/102 (40%), Gaps = 20/102 (19%) Query: 11 VTGASGSIGLAIAKILYKQGASVG----LHGTSQEKLEKVAKNFDDVDRFLLFPANFS-- 64 V GA G++G A+A L + L+ +EKL+ VA D+ + A+ Sbjct: 3 VIGAGGNVGPALAFGLADGSVLLAIELVLYDIDEEKLKGVA---MDLQDAVEPLADIKVS 59 Query: 65 ---------DRVSVEYLSKRVN--EEMGGVDILVNNAGIVRD 95 V ++ V MG +D+L N IV++ Sbjct: 60 ITDDPYEAFKDADVVIITAGVGRKPGMGRLDLLKRNVPIVKE 101 >gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 319 Score = 29.1 bits (66), Expect = 1.2 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 6/31 (19%) Query: 6 GKKALVTGASGSIGLA---IAKILYKQGASV 33 G++ L+ GASG +G IAK L GA V Sbjct: 144 GQRVLINGASGGVGTFAVQIAKAL---GAHV 171 >gnl|CDD|31264 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only]. Length = 339 Score = 29.0 bits (65), Expect = 1.3 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Query: 6 GKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAK 48 GK V GA G +G + GA V S+EKLE K Sbjct: 167 GKWVAVVGAGG-LGHMAVQYAKAMGAEVIAITRSEEKLELAKK 208 >gnl|CDD|176231 cd08270, MDR4, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 305 Score = 28.9 bits (65), Expect = 1.3 Identities = 13/31 (41%), Positives = 18/31 (58%) Query: 3 DLTGKKALVTGASGSIGLAIAKILYKQGASV 33 L G++ LVTGASG +G ++ GA V Sbjct: 130 PLLGRRVLVTGASGGVGRFAVQLAALAGAHV 160 >gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR). NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Length = 320 Score = 28.7 bits (65), Expect = 1.4 Identities = 25/97 (25%), Positives = 41/97 (42%), Gaps = 19/97 (19%) Query: 6 GKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFSD 65 G L+ G + S+GLA K+ GA+V T + R L +D Sbjct: 143 GDTLLIRGGTSSVGLAALKLAKALGATV-TATTRSPE------------RAALLKELGAD 189 Query: 66 RVSVE--YLSKRVNEEMGGVDI---LVNNAGIVRDSL 97 V ++ +++++ GG D LV A ++DSL Sbjct: 190 EVVIDDGAIAEQLRAAPGGFDKVLELVGTA-TLKDSL 225 >gnl|CDD|133443 cd01065, NAD_bind_Shikimate_DH, NAD(P) binding domain of Shikimate dehydrogenase. Shikimate dehydrogenase (DH) is an amino acid DH family member. Shikimate pathway links metabolism of carbohydrates to de novo biosynthesis of aromatic amino acids, quinones and folate. It is essential in plants, bacteria, and fungi but absent in mammals, thus making enzymes involved in this pathway ideal targets for broad spectrum antibiotics and herbicides. Shikimate DH catalyzes the reduction of 3-hydroshikimate to shikimate using the cofactor NADH. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DHs, amino acid DHs, repressor rex, NAD-binding potassium channel domain, CoA-binding, and ornithine cyclodeaminase-like domains. These domains have an alpha-beta-alpha configuration. NAD binding involves numerous hydrogen and van der Waals contacts. Length = 155 Score = 28.4 bits (64), Expect = 1.9 Identities = 22/89 (24%), Positives = 41/89 (46%), Gaps = 16/89 (17%) Query: 1 MFDLTGKKALVTGASGSIGLAIAKILYKQGAS-VGLHGTSQEKLEKVAKNFDDVDRFLLF 59 +L GKK L+ GA G+ A+A L + GA+ + + + EK + +A+ F + L Sbjct: 14 GIELKGKKVLILGAGGA-ARAVAYALAELGAAKIVIVNRTLEKAKALAERFGE----LGI 68 Query: 60 PANFSDRVSVEYLSKRVNEEMGGVDILVN 88 + D + E + D+++N Sbjct: 69 AIAYLD----------LEELLAEADLIIN 87 >gnl|CDD|30722 COG0373, HemA, Glutamyl-tRNA reductase [Coenzyme metabolism]. Length = 414 Score = 28.3 bits (63), Expect = 1.9 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Query: 3 DLTGKKALVTGASGSIGLAIAKILYKQGAS-VGLHGTSQEKLEKVAKNFD 51 L KK LV GA G +G +AK L ++G + + + E+ E++AK Sbjct: 175 SLKDKKVLVIGA-GEMGELVAKHLAEKGVKKITIANRTLERAEELAKKLG 223 >gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine, via NAD(H)-dependent oxidation. THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Length = 334 Score = 28.3 bits (64), Expect = 2.3 Identities = 19/40 (47%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Query: 6 GKKALVTGASGSIGLAIAKILYKQGAS-VGLHGTSQEKLE 44 G LV GA G IGL +A++L GAS V + ++EKLE Sbjct: 160 GDSVLVFGA-GPIGLLLAQLLKLNGASRVTVAEPNEEKLE 198 >gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 350 Score = 28.0 bits (63), Expect = 2.5 Identities = 13/29 (44%), Positives = 20/29 (68%) Query: 5 TGKKALVTGASGSIGLAIAKILYKQGASV 33 G+ LVTGASG +G A+ ++ ++GA V Sbjct: 177 AGETVLVTGASGGVGSALVQLAKRRGAIV 205 >gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase. Putative enoyl reductase of polyketide synthase. Polyketide synthases produce polyketides in step by step mechanism that is similar to fatty acid synthesis. Enoyl reductase reduces a double to single bond. Erythromycin is one example of a polyketide generated by 3 complex enzymes (megasynthases). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains, at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Length = 293 Score = 27.9 bits (63), Expect = 2.5 Identities = 26/90 (28%), Positives = 40/90 (44%), Gaps = 20/90 (22%) Query: 6 GKKALVTGASGSIGLA---IAKILYKQGASVGLHGT--SQEKLEKVAKNFDDVDRFLLFP 60 G+ L+ A+G +G A +A+ L GA V T S+EK E + + VD Sbjct: 109 GESVLIHAAAGGVGQAAIQLAQHL---GAEV--FATVGSEEKREFLRELGGPVDHI---- 159 Query: 61 ANFSDRVSVEYLSKRVNEEMG--GVDILVN 88 FS R + + G GVD+++N Sbjct: 160 --FSSRDL--SFADGILRATGGRGVDVVLN 185 >gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase. L-idonate 5-dehydrogenase (L-ido 5-DH ) catalyzes the conversion of L-lodonate to 5-ketogluconate in the metabolism of L-Idonate to 6-P-gluconate. In E. coli, this GntII pathway is a subsidiary pathway to the canonical GntI system, which also phosphorylates and transports gluconate. L-ido 5-DH is found in an operon with a regulator indR, transporter idnT, 5-keto-D-gluconate 5-reductase, and Gnt kinase. L-ido 5-DH is a zinc-dependent alcohol dehydrogenase-like protein. The alcohol dehydrogenase ADH-like family of proteins is a diverse group of proteins related to the first identified member, class I mammalian ADH. This group is also called the medium chain dehydrogenases/reductase family (MDR) which displays a broad range of activities and are distinguished from the smaller short chain dehydrogenases(~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal GroES-like catalytic domain. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 339 Score = 28.0 bits (63), Expect = 2.8 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 3 DLTGKKALVTGASGSIGLAIAKILYKQGAS 32 DL GK+ LVTGA G IG + + GA+ Sbjct: 163 DLAGKRVLVTGA-GPIGALVVAAARRAGAA 191 >gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. Length = 351 Score = 27.9 bits (63), Expect = 2.9 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Query: 6 GKKALVTGASGSIGLAIAKILYKQGAS 32 G ALV GA G IGL L GAS Sbjct: 173 GDTALVLGA-GPIGLLTILALKAAGAS 198 >gnl|CDD|111992 pfam03155, Alg6_Alg8, ALG6, ALG8 glycosyltransferase family. N-linked (asparagine-linked) glycosylation of proteins is mediated by a highly conserved pathway in eukaryotes, in which a lipid (dolichol phosphate)-linked oligosaccharide is assembled at the endoplasmic reticulum membrane prior to the transfer of the oligosaccharide moiety to the target asparagine residues. This oligosaccharide is composed of Glc(3)Man(9)GlcNAc(2). The addition of the three glucose residues is the final series of steps in the synthesis of the oligosaccharide precursor. Alg6 transfers the first glucose residue, and Alg8 transfers the second one. In the human alg6 gene, a C->T transition, which causes Ala333 to be replaced with Val, has been identified as the cause of a congenital disorder of glycosylation, designated as type Ic OMIM:603147. Length = 463 Score = 27.7 bits (62), Expect = 3.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Query: 117 AFLLTRQLVPLMIRNRFGRVINITSVVGFT 146 +LL R L RN F R++ + VV T Sbjct: 198 VYLLRRCLNKKNFRNSFARILKLALVVVGT 227 >gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family. This group shares the zinc coordination sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 306 Score = 27.7 bits (62), Expect = 3.4 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 18/94 (19%) Query: 6 GKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLE-KVAKN--FDDVDRFLLFPAN 62 G +V G G IGL A++ QGA+V + GT ++++ VAK D V+ Sbjct: 165 GDTVVVFG-PGPIGLLAAQVAKLQGATVVVVGTEKDEVRLDVAKELGADAVN-------- 215 Query: 63 FSDRVSVEYLSKRVNEEMG--GVDILVNNAGIVR 94 E L++ VNE G D+++ +G V Sbjct: 216 ----GGEEDLAELVNEITDGDGADVVIECSGAVP 245 >gnl|CDD|146532 pfam03949, Malic_M, Malic enzyme, NAD binding domain. Length = 255 Score = 27.5 bits (62), Expect = 3.7 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 12/57 (21%) Query: 4 LTGK-----KALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDR 55 +TGK K + GA G+ G+ IA++L GL E+ KN VDR Sbjct: 18 ITGKPLSDQKIVFFGA-GAAGIGIAELLVAAMVREGL------SEEEARKNIWMVDR 67 >gnl|CDD|176209 cd08247, AST1_like, AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast. This group contains members identified in targeting of yeast membrane proteins ATPase. AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast, identified as a multicopy suppressor of pma1 mutants which cause temperature sensitive growth arrest due to the inability of ATPase to target to the cell surface. This family is homologous to the medium chain family of dehydrogenases and reductases. Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Length = 352 Score = 27.2 bits (61), Expect = 3.8 Identities = 17/52 (32%), Positives = 21/52 (40%), Gaps = 6/52 (11%) Query: 6 GKKALVTGASGSIGLA---IAKILYKQGASVGL-HGTSQEKLEKVAKNFDDV 53 K LV G S S+G +AK Y G VG S E +K+ D Sbjct: 152 DSKVLVLGGSTSVGRFAIQLAKNHYNIGTVVGTCSSRSAELNKKL--GADHF 201 >gnl|CDD|36417 KOG1203, KOG1203, KOG1203, Predicted dehydrogenase [Carbohydrate transport and metabolism]. Length = 411 Score = 27.3 bits (60), Expect = 3.9 Identities = 17/47 (36%), Positives = 23/47 (48%) Query: 7 KKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDV 53 LV GA+G +G I KIL K+G SV ++K E + F Sbjct: 80 TTVLVVGATGKVGRRIVKILLKRGFSVRALVRDEQKAEDLLGVFFVD 126 >gnl|CDD|145720 pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis protein. This is a family of diverse bacterial polysaccharide biosynthesis proteins including the CapD protein, WalL protein mannosyl-transferase and several putative epimerases (e.g. WbiI). Length = 280 Score = 27.1 bits (61), Expect = 5.2 Identities = 9/23 (39%), Positives = 12/23 (52%) Query: 10 LVTGASGSIGLAIAKILYKQGAS 32 LVTG GSIG + + + K Sbjct: 2 LVTGGGGSIGSELCRQILKFNPK 24 >gnl|CDD|133448 cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase. NADP binding domain of the Methylene-Tetrahydrofolate Dehydrogenase/cyclohydrolase (m-THF DH/cyclohydrolase) bifunctional enzyme. Tetrahydrofolate is a versatile carrier of activated one-carbon units. The major one-carbon folate donors are N-5 methyltetrahydrofolate, N5,N10-m-THF, and N10-formayltetrahydrofolate. The oxidation of metabolic intermediate m-THF to m-THF requires the enzyme m-THF DH. In addition, most DHs also have an associated cyclohydrolase activity which catalyzes its hydrolysis to N10-formyltetrahydrofolate. m-THF DH is typically found as part of a multifunctional protein in eukaryotes. NADP-dependent m-THF DH in mammals, birds and yeast are components of a trifunctional enzyme with DH, cyclohydrolase, and synthetase activities. Certain eukaryotic cells also contain homodimeric bifunctional DH/cyclodrolase form. In bacteria, monofucntional DH, as well as bifunctional m-THF m-THF DHm-THF DHDH/cyclodrolase are found. In addition, yeast (S. cerevisiae) also express an monofunctional DH. This family contains the bifunctional DH/cyclohydrolase. M-THF DH, like other amino acid DH-like NAD(P)-binding domains, is a member of the Rossmann fold superfamily which includes glutamate, leucine, and phenylalanine DHs, m-THF DH, methylene-tetrahydromethanopterin DH, m-THF DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DH, amino acid DHs, repressor rex, NAD-binding potassium channel domain, CoA-binding, and ornithine cyclodeaminase-like domains. Length = 168 Score = 26.7 bits (60), Expect = 5.5 Identities = 13/32 (40%), Positives = 19/32 (59%) Query: 2 FDLTGKKALVTGASGSIGLAIAKILYKQGASV 33 DL GKK +V G S +G +A +L + A+V Sbjct: 40 IDLAGKKVVVVGRSNIVGKPLAALLLNRNATV 71 >gnl|CDD|30801 COG0452, Dfp, Phosphopantothenoylcysteine synthetase/decarboxylase [Coenzyme metabolism]. Length = 392 Score = 26.9 bits (59), Expect = 5.9 Identities = 26/106 (24%), Positives = 38/106 (35%), Gaps = 29/106 (27%) Query: 3 DLTGKKALVTG----------------ASGSIGLAIAKILYKQGASVGLHGTSQEKLEKV 46 DL GKK L+T +SG +G A+A ++GASV L + L+ Sbjct: 180 DLKGKKVLITAGPTREYIDPVRFISNRSSGKMGFALAAAAKRRGASVTLV-SGPTSLKIP 238 Query: 47 AKNFDDVDRFLLFPANFSDRVSVEYLSKRVNEEMGGVDILVNNAGI 92 A S E + V E DI ++ A + Sbjct: 239 AG------------VEVVKVESAEEMLNAVLEAALPADIFISAAAV 272 >gnl|CDD|31263 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only]. Length = 350 Score = 26.5 bits (58), Expect = 6.0 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Query: 6 GKKALVTGASGSIGLAIAKILYKQGAS-VGLHGTSQEKLEKVAKNF 50 G +V GA G IGL + GAS V + S E+LE + Sbjct: 169 GGTVVVVGA-GPIGLLAIALAKLLGASVVIVVDRSPERLELAKEAG 213 >gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR). Zeta-crystallin is a eye lens protein with NADP-dependent quinone reductase activity (QOR). It has been cited as a structural component in mammalian eyes, but also has homology to quinone reductases in unrelated species. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 325 Score = 26.8 bits (60), Expect = 6.1 Identities = 11/30 (36%), Positives = 16/30 (53%) Query: 4 LTGKKALVTGASGSIGLAIAKILYKQGASV 33 G+ LV G SG++G A ++ GA V Sbjct: 143 KAGETVLVHGGSGAVGHAAVQLARWAGARV 172 >gnl|CDD|176183 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative quinone oxidoreductases. Yhdh and yhfp-like putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 325 Score = 26.7 bits (60), Expect = 6.3 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 2/25 (8%) Query: 10 LVTGASGSIG-LAIAKILYKQGASV 33 LVTGA+G +G +A+A IL K G +V Sbjct: 151 LVTGATGGVGSIAVA-ILAKLGYTV 174 >gnl|CDD|30630 COG0282, ackA, Acetate kinase [Energy production and conversion]. Length = 396 Score = 26.7 bits (59), Expect = 6.9 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 3/82 (3%) Query: 21 AIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPANFSDRVSVEYLSKRVNEEM 80 I +L K+ +GL G S + + + + + + L F R+ +Y+ + Sbjct: 261 EIDTLLNKKSGLLGLSGLSSD-MRDLEEAAAEGNEAKLALDMFVYRI-AKYIGSYAAA-L 317 Query: 81 GGVDILVNNAGIVRDSLFMRAR 102 GG+D LV AGI +S +R Sbjct: 318 GGLDALVFTAGIGENSALVREL 339 >gnl|CDD|145796 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain. This domain is inserted into the catalytic domain, the large dehydrogenase and D-lactate dehydrogenase families in SCOP. N-terminal portion of which is represented by family pfam00389. Length = 176 Score = 26.7 bits (60), Expect = 7.0 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Query: 3 DLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTS-QEKLEKVAKNFDDVDRFL 57 +L+GK + G G IG A+A+ L G V + + + E + + +D L Sbjct: 33 ELSGKTVGIIGL-GRIGRAVARRLKAFGMKVIAYDRYPKAEAEALGARYVSLDELL 87 >gnl|CDD|48470 cd03482, MutL_Trans_MutL, MutL_Trans_MutL: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to Escherichia coli MutL. EcMutL belongs to the DNA mismatch repair (MutL/MLH1/PMS2) family. This transducer domain is homologous to the second domain of the DNA gyrase B subunit, which is known to be important in nucleotide hydrolysis and the transduction of structural signals from the ATP-binding site to the DNA breakage/reunion regions of the enzymes. It has been suggested that during initiation of DNA mismatch repair in E. coli, the mismatch recognition protein MutS recruits MutL in the presence of ATP. The MutS(ATP)-MutL ternary complex formed, then recruits the latent endonuclease MutH. Prokaryotic MutS and MutL are homodimers.. Length = 123 Score = 26.3 bits (58), Expect = 8.3 Identities = 11/32 (34%), Positives = 16/32 (50%) Query: 89 NAGIVRDSLFMRARYEDWDDVLSVNLTSAFLL 120 N +VRD L A + + DVL A++L Sbjct: 51 NGRMVRDKLISHAVRQAYSDVLHGGRHPAYVL 82 >gnl|CDD|35096 COG5537, IRR1, Cohesin [Cell division and chromosome partitioning]. Length = 740 Score = 26.1 bits (57), Expect = 8.4 Identities = 21/75 (28%), Positives = 32/75 (42%), Gaps = 12/75 (16%) Query: 67 VSVEYLSKRVNEEMGGVDILVNNAGIVRD-------SLFMRARYEDWDDVLSVNLTSAFL 119 S+ R+NE + N ++RD S+F+ +RY D DDV+ V + + Sbjct: 246 FSLSEKKSRMNELA----LYDLNPSLIRDEIKDICDSVFV-SRYIDVDDVIRVLCSMSLR 300 Query: 120 LTRQLVPLMIRNRFG 134 LVP R G Sbjct: 301 DWIGLVPDYFRKILG 315 >gnl|CDD|146655 pfam04127, DFP, DNA / pantothenate metabolism flavoprotein. The DNA/pantothenate metabolism flavoprotein (EC:4.1.1.36) affects synthesis of DNA, and pantothenate metabolism. Length = 197 Score = 26.1 bits (58), Expect = 8.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Query: 14 ASGSIGLAIAKILYKQGASV 33 +SG +G AIA+ K+GA V Sbjct: 26 SSGKMGAAIAEEFLKRGADV 45 >gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 323 Score = 26.3 bits (59), Expect = 9.1 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 10/46 (21%) Query: 6 GKKALVTGASGSIGLA---IAKILYKQGASVGLHGT--SQEKLEKV 46 G+ L+ G + +G A +AK L GA V T S+EKLE Sbjct: 140 GETVLIHGGASGVGTAAIQLAKAL---GARV--IATAGSEEKLEAC 180 >gnl|CDD|177015 CHL00076, chlB, photochlorophyllide reductase subunit B. Length = 513 Score = 26.1 bits (58), Expect = 9.5 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Query: 4 LTGKKALVTGASGSIGLAIAKILYKQ-GASVGLHGT 38 LTGKKA+V G + + ++ KIL ++ G V GT Sbjct: 303 LTGKKAVVFGDA-THAASMTKILAREMGIRVSCAGT 337 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.135 0.379 Gapped Lambda K H 0.267 0.0752 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,765,722 Number of extensions: 142349 Number of successful extensions: 525 Number of sequences better than 10.0: 1 Number of HSP's gapped: 479 Number of HSP's successfully gapped: 96 Length of query: 247 Length of database: 6,263,737 Length adjustment: 91 Effective length of query: 156 Effective length of database: 4,297,318 Effective search space: 670381608 Effective search space used: 670381608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 56 (25.3 bits)