RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780537|ref|YP_003064950.1| periplasmic solute binding protein [Candidatus Liberibacter asiaticus str. psy62] (294 letters) >gnl|CDD|29740 cd01137, PsaA, Metal binding protein PsaA. These proteins have been shown to function as initial receptors in ABC transport of Mn2+ and as surface adhesins in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).. Length = 287 Score = 300 bits (770), Expect = 3e-82 Identities = 121/279 (43%), Positives = 170/279 (60%), Gaps = 1/279 (0%) Query: 15 MSASATTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNAD 74 S + K V+++FSI+ DI +NIA D V VT++V G D H Y+ T +D K+ AD Sbjct: 9 SSPATAASKLKVVATFSILADIARNIAGDRVNVTSIVPPGADPHEYEPTPSDIKKLSKAD 68 Query: 75 LILCNGLHLEETYMKYFTNLKKGTKIITVTDGINPIGVSEDTSVDSEPNPHAWMSLTNAM 134 LIL NGL+LE + N K ++ V++GI+PI + E +P+PHAWMS NA+ Sbjct: 69 LILYNGLNLEPWLERLVKNAGKDVPVVAVSEGIDPIPLEEGHYKG-KPDPHAWMSPKNAI 127 Query: 135 IYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEKVDPEKRWFVTSEGCL 194 IY++NI KAL+ DP+NA+ Y+ NA Y K++ K + + EKR VTSEG Sbjct: 128 IYVKNIAKALSEADPANAETYQKNAAAYKAKLKALDEWAKAKFATIPAEKRKLVTSEGAF 187 Query: 195 VYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQVAYE 254 Y A+ +G K YLWPIN++ E +P + I Q++ K+ +F EST +D+ KQVA E Sbjct: 188 SYFAKAYGLKEAYLWPINTEEEGTPKQVATLIEQVKKEKVPAVFVESTVNDRLMKQVAKE 247 Query: 255 TNASYGGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTL 293 T A GG LY DSLS+ GPA TYLD++ +L IV+ L Sbjct: 248 TGAKIGGQLYTDSLSEKGGPADTYLDMMEHNLDTIVEGL 286 >gnl|CDD|31146 COG0803, LraI, ABC-type metal ion transport system, periplasmic component/surface adhesin [Inorganic ion transport and metabolism]. Length = 303 Score = 239 bits (611), Expect = 8e-64 Identities = 104/294 (35%), Positives = 157/294 (53%), Gaps = 3/294 (1%) Query: 1 MLRYFICLLFSYIPMSASATTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSY 60 L + L ++ + K V+++F I D+ +NIA D V V +LV G D HSY Sbjct: 10 ALLLILLLAGCGTSAASDGDSAKLKVVTTFPPIADVVKNIAGDKVDVVSLVPPGADPHSY 69 Query: 61 QVTSADAIKIQNADLILCNGLHLEETYMKYFTNL-KKGTKIITVTDGINPIGVSEDTSVD 119 + T +D K++ ADLI+ NGL LE K + KK +I V+DGI + + + + Sbjct: 70 EPTPSDIAKLRKADLIVYNGLGLEPWLEKLLESADKKKVLVIEVSDGIELLPLPGE-EEE 128 Query: 120 SEPNPHAWMSLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEK 179 +PH W+ NA IY ENI AL LDP N + YE NA Y +K+ K ++ K Sbjct: 129 GVNDPHVWLDPKNAKIYAENIADALVELDPENKETYEKNAEAYLKKLNKLDEEAKAKLSK 188 Query: 180 VDPEKRWFVTSEGCLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFS 239 + P +R VTS G YLA D+G K + + I+ ++E SP + ++ ++ IK IF Sbjct: 189 I-PAQRDVVTSHGAFGYLARDYGLKQVAIAGISPEAEPSPKDLAKLVDLIKKKNIKAIFV 247 Query: 240 ESTNSDQPAKQVAYETNASYGGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTL 293 ES S + A+ +A ET G+LY+DSL D TY+ +++ +L IV+ L Sbjct: 248 ESNVSSKSAETLAKETGVKILGLLYLDSLGDKDSKGDTYISMMKANLDTIVEGL 301 >gnl|CDD|144773 pfam01297, SBP_bac_9, Periplasmic solute binding protein family. This family includes periplasmic solute binding proteins such as TroA that interacts with an ATP-binding cassette transport system in Treponema pallidum. Length = 272 Score = 209 bits (533), Expect = 9e-55 Identities = 84/276 (30%), Positives = 135/276 (48%), Gaps = 13/276 (4%) Query: 26 VLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLHLEE 85 V++S + D+ + I D V VT+LV G D H+Y+ T +D K+ ADL++ NG LE Sbjct: 1 VVASIPPLADLVKAIGGDKVEVTSLVPPGADPHTYEPTPSDIKKLAKADLVVYNGAGLEP 60 Query: 86 TYMKYFTNLKKGTKIITVTDGINPIGVSEDTSVD--------SEPNPHAWMSLTNAMIYI 137 K +L K++ +++GI + +PH W+ NA Sbjct: 61 WLDKLLASLANKVKVVDLSEGIELLDAPGHEHDHDEHDHDDHGHGDPHIWLDPKNAKAMA 120 Query: 138 ENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEKVDPEKRWFVTSEGCLVYL 197 E I AL+ LDP NA YE NA + +K+ +K ++ + P KR +T Y Sbjct: 121 EAIADALSELDPENAATYEKNAAAFLKKLDELDAEIKAKLAPI-PGKR-VITFHDAFGYF 178 Query: 198 AEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQVAYETNA 257 A+ +G + + + + +SE SP+ + I ++ H +K IF E S + A+ +A ET A Sbjct: 179 AKAYGLEQIAILGESPESEPSPADLAELIKLIKEHNVKVIFVEPQFSPKLAETLAEETGA 238 Query: 258 SYGGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTL 293 LY+D L G TYL+L+R +L + + L Sbjct: 239 K-VVPLYLDPLGSEGG--DTYLELMRHNLDTLAEAL 271 >gnl|CDD|29736 cd01017, AdcA, Metal binding protein AcdA. These proteins have been shown to function in the ABC uptake of Zn2+ and Mn2+ and in competence for genetic transformation and adhesion. The AcdA proteins belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. They are comprised of two globular subdomains connected by a long alpha helix and they bind their ligand in the cleft between these domains. In addition, many of these proteins have a low complexity region containing metal binding histidine-rich motif (repetitive HDH sequence).. Length = 282 Score = 151 bits (382), Expect = 2e-37 Identities = 72/283 (25%), Positives = 137/283 (48%), Gaps = 12/283 (4%) Query: 21 TQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNG 80 + K V+++F + + T+ I D V ++ AG + H ++ + D +I +AD+ + NG Sbjct: 1 SGKLKVVTTFYPLYEFTKAIGGDKADVKLIIPAGTEPHDFEPSPKDIARIADADVFVYNG 60 Query: 81 LHLEETYMKYFTNLK-KGTKIITVTDGINPIGVSE--------DTSVDSEPNPHAWMSLT 131 L +E K +L+ K K++ + GI + + + +PH W+S Sbjct: 61 LGMETWAEKVLKSLQNKKLKVVEASKGIKLLKAGGAEHDHDHSHSHHHGDYDPHVWLSPV 120 Query: 132 NAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEKVDPEKRWFVTSE 191 A+ +ENI+ AL LDP N + YE NA Y++K+ + ++ K + + FVT Sbjct: 121 LAIQQVENIKDALIKLDPDNKEYYEKNAAAYAKKLEALDQEYRAKLAKA--KGKTFVTQH 178 Query: 192 GCLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQV 251 YLA +G K + + ++ + E SP + + ++ +K+IF E S + A+ + Sbjct: 179 AAFGYLARRYGLKQIAIVGVSPEVEPSPKQLAELVEFVKKSDVKYIFFEENASSKIAETL 238 Query: 252 AYETNASYGGVLYVDSLSKPDGPAP-TYLDLLRFSLTKIVDTL 293 A ET A + +++L+K + Y L++ +L + L Sbjct: 239 AKETGAKLLVLNPLETLTKEEIDDGKDYFSLMKENLETLKRAL 281 >gnl|CDD|29735 cd01016, TroA, Metal binding protein TroA. These proteins have been shown to function as initial receptors in ABC transport of Zn2+ and possibly Fe3+ in many eubacterial species. The TroA proteins belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).. Length = 276 Score = 134 bits (339), Expect = 3e-32 Identities = 71/276 (25%), Positives = 133/276 (48%), Gaps = 6/276 (2%) Query: 23 KKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLH 82 K V+++ +I D +NI D V VT L+ G D H Y+ T+ D K+QNAD++ NGLH Sbjct: 1 KPNVVTTTGMIADAVENIGGDHVEVTGLMGPGVDPHLYKATAGDVEKLQNADVVFYNGLH 60 Query: 83 LEETYMKYFTNLKKGTKIITVTDGINPIGVSEDTSVDSEPNPHAWMSLTNAMIYIENIRK 142 LE + L +I + D ++ + D + +PH W + ++ + + Sbjct: 61 LEGKMSDVLSKLGSSKSVIALEDTLDRSQLILDEE-EGTYDPHIWFDVKLWKYAVKAVAE 119 Query: 143 ALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEKVDPEKRWFVTSEGCLVYLAEDFG 202 L+ P + +++ N+ Y E++ + K +I ++ ++R VT+ Y +G Sbjct: 120 VLSEKLPEHKDEFQANSEAYVEELDSLDAYAKKKIAEIPEQQRVLVTAHDAFGYFGRAYG 179 Query: 203 FKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQV-----AYETNA 257 F+ L I++DSE + ++ + KIK IF ES+ + + + + A + Sbjct: 180 FEVKGLQGISTDSEAGLRDINELVDLIVERKIKAIFVESSVNQKSIEALQDAVKARGHDV 239 Query: 258 SYGGVLYVDSLSKPDGPAPTYLDLLRFSLTKIVDTL 293 GG LY D++ + TY+ + + ++ IV+ L Sbjct: 240 QIGGELYSDAMGEEGTSEGTYIGMFKHNVDTIVEAL 275 >gnl|CDD|29737 cd01018, ZntC, Metal binding protein ZntC. These proteins are predicted to function as initial receptors in ABC transport of metal ions. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. They are comprised of two globular subdomains connected by a long alpha helix and bind their specific ligands in the cleft between these domains. In addition, many of these proteins possess a metal-binding histidine-rich motif (repetitive HDH sequence).. Length = 266 Score = 108 bits (271), Expect = 2e-24 Identities = 64/244 (26%), Positives = 111/244 (45%), Gaps = 18/244 (7%) Query: 37 TQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLHLEETYMKYFTNLKK 96 + IA D V V LV G++ H+Y+ K+ ADL GL EE +++ F + Sbjct: 16 VEKIAGDTVDVVVLVPPGSNPHTYEPKPQQMKKLSEADLYFRIGLGFEEVWLERFRSNNP 75 Query: 97 GTKIITVTDGINPIGVS----EDTSVDSEP-----NPHAWMSLTNAMIYIENIRKALTAL 147 +++ ++ GI I ++ +PH W+S NA I ENI +AL L Sbjct: 76 KMQVVNMSKGITLIPMADHHHHHHGEHEHHHHGNYDPHIWLSPANAKIMAENIYEALAEL 135 Query: 148 DPSNAKKYELNAREYSEKIRNSILPLKTRIEKVDPEKRWFVTSEGCLVYLAEDFGFKSLY 207 DP NA Y+ N ++ ++T + K+ +R F+ Y A D+G + Sbjct: 136 DPQNATYYQANLDALLAELDALDSEIRTILSKLK--QRAFMVYHPAWGYFARDYGLTQI- 192 Query: 208 LWPINSD-SERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQVAYETNASYGGVLYVD 266 PI + E SP+ ++ I+ + ++ +F + S + A+ +A E A V+ +D Sbjct: 193 --PIEEEGKEPSPADLKRLIDLAKEKGVRVVFVQPQFSTKSAEAIAREIGA---KVVTID 247 Query: 267 SLSK 270 L+ Sbjct: 248 PLAA 251 >gnl|CDD|29738 cd01019, ZnuA, Zinc binding protein ZnuA. These proteins have been shown to function as initial receptors in the ABC uptake of Zn2+. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. They are comprised of two globular subdomains connected by a single helix and bind their specific ligands in the cleft between these domains. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).. Length = 286 Score = 106 bits (266), Expect = 7e-24 Identities = 62/279 (22%), Positives = 113/279 (40%), Gaps = 29/279 (10%) Query: 26 VLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLHLEE 85 VL+S +G I I + V LV G H Y++ +DA K+Q ADL++ G LE Sbjct: 6 VLTSIKPLGFIAAAIMGGVGEVEVLVPPGASPHDYELRPSDARKLQEADLVVWIGPDLEA 65 Query: 86 TYMKYFTNLKKGTKIITVTDGINPIGVSEDTSVDSEP------------------NPHAW 127 ++ +K K++T+ I+ + + S +PH W Sbjct: 66 -FLDKVLQGRKKGKVLTLAKLIDLKTLEDGASHGDHEHDHEHAHGEHDGHEEGGLDPHLW 124 Query: 128 MSLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRI-EKVDP-EKR 185 +S NA + + + L+ALDP NA Y N ++ + + L I E++ P + + Sbjct: 125 LSPENAAEVAQAVAEKLSALDPDNAATYAANLEAFNAR----LAELDATIKERLAPVKTK 180 Query: 186 WFVTSEGCLVYLAEDFGFKSLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSD 245 F Y + +G ++ I+ + + + +++ +F+E Sbjct: 181 PFFVFHDAYGYFEKRYGLTQAGVFTIDPEIDPGAKRLAKIRKEIKEKGATCVFAEPQFHP 240 Query: 246 QPAKQVAYETNASYGGVLYVDSLSKPDGPAPT-YLDLLR 283 + A+ +A T A G +D L Y++ LR Sbjct: 241 KIAETLAEGTGAKVG---ELDPLGGLIELGKNSYVNFLR 276 >gnl|CDD|29739 cd01020, TroA_b, Metal binding protein TroA_b. These proteins are predicted to function as initial receptors in ABC transport of metal ions. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).. Length = 264 Score = 87.3 bits (216), Expect = 4e-18 Identities = 56/238 (23%), Positives = 98/238 (41%), Gaps = 22/238 (9%) Query: 22 QKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGN-DSHSYQVTSADAIKIQNADLILCNG 80 K V++S + G + + + D V VT+++ + D H ++ T DA K+ AD+++ NG Sbjct: 1 GKINVVASTNFWGSVAEAVGGDHVEVTSIITNPDVDPHDFEPTPTDAAKVSTADIVVYNG 60 Query: 81 LHLEETYMKYFTNLKKGTKIITVTDGINPIGVSEDTSVDSEP-NPHAWMSLTNAMIYIEN 139 Y + T L TK + V I D D E NPH W Sbjct: 61 G----GYDPWMTKLLADTKDVIV------IAADLDGHDDKEGDNPHLWYDPETMSKVANA 110 Query: 140 IRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEKV--DPEKRWFVTSEGCLVYL 197 + AL DP N K Y+ NA+++ ++ PL +I ++ + +E YL Sbjct: 111 LADALVKADPDNKKYYQANAKKFVASLK----PLAAKIAELSAKYKGAPVAATEPVFDYL 166 Query: 198 AEDFGFK----SLYLWPINSDSERSPSMMRHAINQMRSHKIKFIFSESTNSDQPAKQV 251 + G K Y S++E SP+ + N +++ +I + + + Sbjct: 167 LDALGMKERTPKGYTATTESETEPSPADIAAFQNAIKNRQIDALIVNPQQASSATTNI 224 >gnl|CDD|29748 cd01145, TroA_c, Periplasmic binding protein TroA_c. These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.. Length = 203 Score = 81.6 bits (201), Expect = 2e-16 Identities = 44/160 (27%), Positives = 70/160 (43%), Gaps = 6/160 (3%) Query: 23 KKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSHSYQVTSADAIKIQNADLILCNGLH 82 V+ +F + D+ + +A D V V+ L G D H YQ+ +D K++ ADL++ +G Sbjct: 2 ALNVVVTFPDLKDLVREVAGDAVIVSALTPPGVDPHQYQLKPSDIAKMRKADLVVTSGHE 61 Query: 83 LEETYMKYFTNLKK-----GTKIITVTDGINPIGVSEDTSVDSEPNPHAWMSLTNAMIYI 137 LE K G KI+ + + NPH W+ NA Sbjct: 62 LEGFEPKLAELSSNSKVQPGIKILIEDSDTVGMVDRAMGDYHGKGNPHVWLDPNNAPALA 121 Query: 138 ENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRI 177 + + AL LDPS ++Y+ N R + K+ N +L R Sbjct: 122 KALADALIELDPSEQEEYKENLRVFLAKL-NKLLREWERQ 160 >gnl|CDD|34180 COG4531, ZnuA, ABC-type Zn2+ transport system, periplasmic component/surface adhesin [Inorganic ion transport and metabolism]. Length = 318 Score = 77.7 bits (191), Expect = 4e-15 Identities = 69/296 (23%), Positives = 115/296 (38%), Gaps = 48/296 (16%) Query: 1 MLRYFICLL--FSYIPMSASATTQKKVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDSH 58 ML LL + + ++ V++S +G I IA + L+ G H Sbjct: 2 MLHKKTLLLSALFALLLGSAPAAAAAAVVTSIKPLGFIASAIADGVGEPEVLLPGGASPH 61 Query: 59 SYQVTSADAIKIQNADLILCNGLHLEETYMKYFTNLKKGTKIITVTD--GINPIGVSEDT 116 Y + +D ++Q+ADL++ G LE K + L G K++T+ D G+ P+ E Sbjct: 62 DYSLRPSDVKRLQSADLVVWVGPDLEAFLDKPLSGLP-GAKVVTLADLPGVKPLLFREAH 120 Query: 117 SVDSEP-----------------------NPHAWMSLTNAMIYIENIRKALTALDPSNAK 153 + E + H W+S A I K L LDP NA Sbjct: 121 DHEEEHDHGHDHAGADHKGDHDHHHEGEYDMHLWLSPAIAKAVAAAIAKKLAELDPQNAA 180 Query: 154 KYELNAREY-------SEKIRNSILPLKTRIEKVDPEKRWFVTSEGCLVYLAEDFGFKSL 206 KY+ N +++ +K+ + P+K K +FV + Y +G K L Sbjct: 181 KYDANLKDFEAQLAALDKKVGEELAPVK--------GKPFFVFHDA-YGYFENAYGLKPL 231 Query: 207 YLWPINSDSERSPSMMR-HAIN-QMRSHKIKFIFSESTNSDQPAKQVAYETNASYG 260 + ++ E P R I Q++ K +F+E + + VA T+ G Sbjct: 232 GHFTVS--PEVQPGAKRLAEIRTQLKEQKATCVFAEPQFRPKVVETVAEGTSVRSG 285 >gnl|CDD|29734 cd00636, TroA-like, Helical backbone metal receptor (TroA-like domain). These proteins have been shown to function in the ABC transport of ferric siderophores and metal ions such as Mn2+, Fe3+, Cu2+ and/or Zn2+. Their ligand binding site is formed in the interface between two globular domains linked by a single helix. Many of these proteins also possess a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence). The TroA-like proteins differ in their fold and ligand-binding mechanism from the PBPI and PBPII proteins, but are structurally similar, however, to the beta-subunit of the nitrogenase molybdenum-iron protein MoFe. Most TroA-like proteins are encoded by ABC-type operons and appear to function as periplasmic components of ABC transporters in metal ion uptake.. Length = 148 Score = 42.2 bits (98), Expect = 2e-04 Identities = 34/180 (18%), Positives = 56/180 (31%), Gaps = 45/180 (25%) Query: 24 KVVLSSFSIIGDITQNIAKDLVTVTTLVEAGNDS-------------HSYQVTSADAIKI 70 K V++ ++ + D V +G H Y+ + + I Sbjct: 1 KRVVALDPGATELLLALGGDDKPVGVADPSGYPPEAKALLEKVPDVGHGYEP-NLEKIAA 59 Query: 71 QNADLILCNGLHLEETYMKYFTNLKKGTKIITVTDGINPIGVSEDTSVDSEPNPHAWMSL 130 DLI+ NG LE K K ++ V + +SL Sbjct: 60 LKPDLIIANGSGLEAWLDKL---SKIAIPVVVVDEASE-------------------LSL 97 Query: 131 TNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEKVDPEKRWFVTS 190 N I I KAL E NA E ++ + L+ ++ K+ +K V Sbjct: 98 ENIKESIRLIGKALG---------KEENAEELIAELDARLAELRAKLAKIPKKKVSLVVG 148 >gnl|CDD|32005 COG1820, NagA, N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism]. Length = 380 Score = 30.6 bits (69), Expect = 0.57 Identities = 11/41 (26%), Positives = 21/41 (51%) Query: 76 ILCNGLHLEETYMKYFTNLKKGTKIITVTDGINPIGVSEDT 116 I+ +G+H+ ++ K G KI+ VTD + G+ + Sbjct: 243 IIADGVHVHPAAIRLALKAKGGDKIVLVTDAMAAAGLPDGE 283 >gnl|CDD|32830 COG3013, COG3013, Uncharacterized conserved protein [Function unknown]. Length = 168 Score = 29.5 bits (66), Expect = 1.1 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 127 WMSLTNAM-IYIENIRKALTALDPSNAKKYE 156 WM +TNA + + N K +T LDP NA++Y Sbjct: 4 WMEMTNAQRLILSNQYKMMTMLDPENAERYR 34 >gnl|CDD|36399 KOG1185, KOG1185, KOG1185, Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism, Coenzyme transport and metabolism]. Length = 571 Score = 28.7 bits (64), Expect = 1.9 Identities = 29/155 (18%), Positives = 58/155 (37%), Gaps = 28/155 (18%) Query: 56 DSHSYQVTSADAIKIQNADLILCNGLHLEETYMKYF---TNLKKGTKIITVTDGINPIGV 112 D+H V+SA ++ ++ AD++L G L ++ +F K K I V + Sbjct: 260 DNHPLNVSSARSLALKKADVVLLAGARLN--WILHFGLPPKWSKDVKFIQVD-------I 310 Query: 113 SEDTSVDSEPNPHAWMSLTNAMIYIENIRKALTA----LDPSN------AKKYELNAREY 162 + + ++ P + + +++ + + L PS +K + N Sbjct: 311 NPEELGNNFVKPDVAI-QGDIGLFVLQLVEELQDQPWTWGPSTDWVKELREKDKQNEAAV 369 Query: 163 SEKIRNSILPLK-----TRIEKVDPEKRWFVTSEG 192 EK PL + ++ P + SEG Sbjct: 370 EEKAAKKSTPLNYYQVLQTVRELLPNDDTILVSEG 404 >gnl|CDD|176330 cd01254, PH_PLD, Phospholipase D (PLD) pleckstrin homology (PH) domain. Phospholipase D (PLD) pleckstrin homology (PH) domain. PLD hydrolyzes phosphatidylcholine to phosphatidic acid (PtdOH), which can bind target proteins. PLD contains a PH domain, a PX domain and four conserved PLD signature domains. The PLD PH domain is specific for bisphosphorylated inositides. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. Length = 121 Score = 28.2 bits (63), Expect = 2.4 Identities = 7/21 (33%), Positives = 11/21 (52%) Query: 184 KRWFVTSEGCLVYLAEDFGFK 204 KRWF+ E L Y+ + + Sbjct: 35 KRWFIVKESFLAYMDDPSSAQ 55 >gnl|CDD|30034 cd00854, NagA, N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate. This is the first committed step in the biosynthetic pathway to amino-sugar-nucleotides, which is needed for cell wall peptidoglycan and teichoic acid biosynthesis. Deacetylation of N-acetylglucosamine is also important in lipopolysaccharide synthesis and cell wall recycling.. Length = 374 Score = 27.9 bits (62), Expect = 3.2 Identities = 9/39 (23%), Positives = 20/39 (51%) Query: 76 ILCNGLHLEETYMKYFTNLKKGTKIITVTDGINPIGVSE 114 ++ +G+H+ ++ K KI+ VTD + G+ + Sbjct: 242 LIADGIHVHPAAVRLAYRAKGADKIVLVTDAMAAAGLPD 280 >gnl|CDD|146493 pfam03887, YfbU, YfbU domain. This presumed domain is about 160 residues long. It is found in archaebacteria and eubacteria. In In Corynebacterium glutamicum Ycg4L it is associated with a helix-turn-helix domain. This suggests that this may be a ligand binding domain. Length = 166 Score = 27.9 bits (62), Expect = 3.9 Identities = 16/30 (53%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 128 MSLTNAMIYI-ENIRKALTALDPSNAKKYE 156 M +TNA I N K + ALDP NAKKY Sbjct: 1 MEMTNAQRLILSNQYKLMLALDPYNAKKYR 30 >gnl|CDD|31484 COG1293, COG1293, Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription]. Length = 564 Score = 27.6 bits (61), Expect = 4.2 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 5/67 (7%) Query: 137 IENIRKALTALDPSNAKKYELNAREYSEKIRNSILP-LKTRIEKVD--PEKRWFVTSEGC 193 I A TAL+ + KK RE E I +L K + +K + + RWFV+S+G Sbjct: 393 IAYYESAKTALEKAEGKKAIEEIRE--ELIEEGLLKSKKKKRKKKEWFEKFRWFVSSDGF 450 Query: 194 LVYLAED 200 LV + Sbjct: 451 LVIGGRN 457 >gnl|CDD|176328 cd01252, PH_cytohesin, Cytohesin Pleckstrin homology (PH) domain. Cytohesin Pleckstrin homology (PH) domain. Cytohesin is an ARF-Guanine nucleotide Exchange Factor (GEF), which has a Sec7-type Arf-GEFdomain and a pleckstrin homology domain. It specifically binds phosphatidylinositol-3,4,5-trisphosphate (PtdIns(3,4, 5)P3) via its PH domain and it acts as a PI 3-kinase effector mediating biological responses such as cell adhesion and membrane trafficking. PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. Length = 125 Score = 26.7 bits (59), Expect = 7.6 Identities = 6/14 (42%), Positives = 11/14 (78%) Query: 183 EKRWFVTSEGCLVY 196 ++RWF+ ++ CL Y Sbjct: 17 KRRWFILTDNCLYY 30 >gnl|CDD|34155 COG4477, EzrA, Negative regulator of septation ring formation [Cell division and chromosome partitioning]. Length = 570 Score = 26.8 bits (59), Expect = 8.5 Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 5/43 (11%) Query: 137 IENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEK 179 E +++ LT+L +K EL ARE E++++ + +K +EK Sbjct: 398 QEKVQEHLTSL-----RKDELEARENLERLKSKLHEIKRYMEK 435 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.132 0.377 Gapped Lambda K H 0.267 0.0631 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,349,616 Number of extensions: 166804 Number of successful extensions: 444 Number of sequences better than 10.0: 1 Number of HSP's gapped: 425 Number of HSP's successfully gapped: 22 Length of query: 294 Length of database: 6,263,737 Length adjustment: 93 Effective length of query: 201 Effective length of database: 4,254,100 Effective search space: 855074100 Effective search space used: 855074100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 57 (25.9 bits)