RPSBLAST alignment for GI: 254780538 and conserved domain: PRK13642

>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 277
 Score = 57.0 bits (137), Expect = 5e-09
 Identities = 61/237 (25%), Positives = 111/237 (46%), Gaps = 17/237 (7%)

Query: 28  LEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQ--TVENAL----K 81
           L  V+  I +    ++IG NG+GKST  + I GL    +G + I  +  T EN      K
Sbjct: 23  LNGVSFSITKGEWVSIIGQNGSGKSTTARLIDGLFEEFEGKVKIDGELLTAENVWNLRRK 82

Query: 82  ADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSSMR 141
             ++   P  + +  T    VED V  G    M  + +      + V EAL  V M   +
Sbjct: 83  IGMVFQNPDNQFVGAT----VEDDVAFG----MENQGIPREEMIKRVDEALLAVNMLDFK 134

Query: 142 QRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNE-DIMI 200
            R+   LS GQ++RV +A  +A + ++II+DE  + +D    +E++ ++  +  +  + +
Sbjct: 135 TREPARLSGGQKQRVAVAGIIALRPEIIILDESTSMLDPTGRQEIMRVIHEIKEKYQLTV 194

Query: 201 LVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIFNEDNIQKTFGAQVSPQSSILNE 256
           L  TH+++   S  DR + +K   ++     S++F         G  V   S+++ +
Sbjct: 195 LSITHDLDEAAS-SDRILVMKAGEIIKEAAPSELFATSEDMVEIGLDVPFSSNLMKD 250