RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780538|ref|YP_003064951.1| ABC transporter, nucleotide binding/ATPase protein (iron) [Candidatus Liberibacter asiaticus str. psy62] (280 letters) >gnl|CDD|31318 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]. Length = 254 Score = 273 bits (699), Expect = 4e-74 Identities = 104/236 (44%), Positives = 153/236 (64%), Gaps = 1/236 (0%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +E+++++V+Y N LED++L + + ITALIG NGAGKSTL +AI+GL+ G I I Sbjct: 5 IEVENLTVSYGNRP-VLEDISLSVEKGEITALIGPNGAGKSTLLKAILGLLKPSSGEIKI 63 Query: 72 FNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEA 131 F + V K I Y+PQ S+D +FPI V+DVV++GRY W R + D V EA Sbjct: 64 FGKPVRKRRKRLRIGYVPQKSSVDRSFPITVKDVVLLGRYGKKGWFRRLNKKDKEKVDEA 123 Query: 132 LENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLK 191 LE VGM +R RQIGELS GQ++RV LARALAQ ++++DEPF +D ++E+ LLK Sbjct: 124 LERVGMEDLRDRQIGELSGGQKQRVLLARALAQNPDLLLLDEPFTGVDVAGQKEIYDLLK 183 Query: 192 SLLNEDIMILVSTHNINSIPSFCDRTIFLKKTVLASGLTSDIFNEDNIQKTFGAQV 247 L E +L+ TH++ + ++ DR I L + ++ASG ++ E+N++K FG + Sbjct: 184 ELRQEGKTVLMVTHDLGLVMAYFDRVICLNRHLIASGPPEEVLTEENLEKAFGGSL 239 >gnl|CDD|72994 cd03235, ABC_Metallic_Cations, ABC component of the metal-type transporters. This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc. The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor. The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri. Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.. Length = 213 Score = 256 bits (657), Expect = 3e-69 Identities = 101/216 (46%), Positives = 139/216 (64%), Gaps = 3/216 (1%) Query: 13 ELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIF 72 E++D++V+Y G+ LEDV+ + A++G NGAGKSTL +AI+GL+ GSI +F Sbjct: 1 EVEDLTVSY-GGHPVLEDVSFEVKPGEFLAIVGPNGAGKSTLLKAILGLLKPTSGSIRVF 59 Query: 73 NQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEAL 132 + +E K I Y+PQ SID FPI V DVV+MG Y H R S D V EAL Sbjct: 60 GKPLEKERK--RIGYVPQRRSIDRDFPISVRDVVLMGLYGHKGLFRRLSKADKAKVDEAL 117 Query: 133 ENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKS 192 E VG+S + RQIGELS GQQ+RV LARAL Q ++++DEPFA +D KT+ ++ LL+ Sbjct: 118 ERVGLSELADRQIGELSGGQQQRVLLARALVQDPDLLLLDEPFAGVDPKTQEDIYELLRE 177 Query: 193 LLNEDIMILVSTHNINSIPSFCDRTIFLKKTVLASG 228 L E + ILV TH++ + + DR + L +TV+ASG Sbjct: 178 LRREGMTILVVTHDLGLVLEYFDRVLLLNRTVVASG 213 >gnl|CDD|31317 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]. Length = 258 Score = 202 bits (516), Expect = 7e-53 Identities = 77/238 (32%), Positives = 141/238 (59%), Gaps = 8/238 (3%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 LE++++S Y G L+D++ IP+ IT ++G NG+GKSTL + + GL+ G + + Sbjct: 3 LEVENLSFGY-GGKPILDDLSFSIPKGEITGILGPNGSGKSTLLKCLAGLLKPKSGEVLL 61 Query: 72 FNQTVEN---ALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIV 128 + + + A +AY+PQ+ S F + V ++V++GRY H+ S D IV Sbjct: 62 DGKDIASLSPKELAKKLAYVPQSPSAP--FGLTVYELVLLGRYPHLGLFGRPSKEDEEIV 119 Query: 129 TEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIF 188 EALE +G+ + R + ELS G+++RV +ARALAQ++ ++++DEP + +D + E++ Sbjct: 120 EEALELLGLEHLADRPVDELSGGERQRVLIARALAQETPILLLDEPTSHLDIAHQIEVLE 179 Query: 189 LLKSLLNEDIM-ILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIFNEDNIQKTFG 244 LL+ L E + +++ H++N + D I LK ++A G ++ E+N+++ +G Sbjct: 180 LLRDLNREKGLTVVMVLHDLNLAARYADHLILLKDGKIVAQGTPEEVLTEENLREVYG 237 >gnl|CDD|73015 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosphonate transport system. Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 241 Score = 154 bits (392), Expect = 2e-38 Identities = 74/241 (30%), Positives = 124/241 (51%), Gaps = 9/241 (3%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +E++++S TYPNG AL+DV+L I ALIG +GAGKSTL + + GL+ GS+ I Sbjct: 1 IEVENLSKTYPNGKKALKDVSLSINPGEFVALIGPSGAGKSTLLRCLNGLVEPTSGSVLI 60 Query: 72 FNQTVENALKADLIAYIPQTESIDWTFPIL----VEDVVMMGRYKHMNWRRVASN----N 123 + L Q I F ++ V + V+ GR + R Sbjct: 61 DGTDINKLKGKALRQLRRQIGMIFQQFNLIERLSVLENVLSGRLGRRSTWRSLFGLFPKE 120 Query: 124 DYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTE 183 + + ALE VG+ ++ +LS GQQ+RV +ARAL Q+ ++I+ DEP A++D + Sbjct: 121 EKQRALAALERVGLLDKAYQRADQLSGGQQQRVAIARALMQQPKLILADEPVASLDPASS 180 Query: 184 REMIFLLKSLLNED-IMILVSTHNINSIPSFCDRTIFLKKTVLASGLTSDIFNEDNIQKT 242 R+++ LLK + E+ I ++VS H ++ + DR + LK + ++ + + Sbjct: 181 RQVMDLLKRINREEGITVIVSLHQVDLAREYADRIVGLKDGRIVFDGPPAELTDEVLDEI 240 Query: 243 F 243 + Sbjct: 241 Y 241 >gnl|CDD|31326 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms]. Length = 293 Score = 150 bits (381), Expect = 3e-37 Identities = 63/267 (23%), Positives = 117/267 (43%), Gaps = 10/267 (3%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +E+++++ Y AL+ V+ + I L+G NGAGK+TL + + GL+ G I + Sbjct: 5 IEVRNLTKKYGGDKTALDGVSFEVEPGEIFGLLGPNGAGKTTLLKILAGLLKPTSGEILV 64 Query: 72 FNQTVENALKA--DLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVT 129 V I Y+PQ S+ + E++ R ++ + Sbjct: 65 LGYDVVKEPAKVRRRIGYVPQEPSLYPELTVR-ENLEFFARL-----YGLSKEEAEERIE 118 Query: 130 EALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFL 189 E LE G+ +++ LS G ++R+ +A AL +++I+DEP + +D ++ RE+ L Sbjct: 119 ELLELFGLEDKANKKVRTLSGGMKQRLSIALALLHDPELLILDEPTSGLDPESRREIWEL 178 Query: 190 LKSLLNEDIM-ILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIFNEDNIQKTFGAQV 247 L+ L E + IL+STH + CDR I L ++A G ++ + + + Sbjct: 179 LRELAKEGGVTILLSTHILEEAEELCDRVIILNDGKIIAEGTPEELKEKFGGKGVIELEP 238 Query: 248 SPQSSILNESNIQTTFKAEVYPQINST 274 ++ E +I Sbjct: 239 ERLELAELLEGLKLVKGEEELAEILEA 265 >gnl|CDD|72973 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea. Only very few species lack representatives of the siderophore family transporters. The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake. The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA. The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme. A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.. Length = 180 Score = 150 bits (382), Expect = 3e-37 Identities = 65/221 (29%), Positives = 108/221 (48%), Gaps = 46/221 (20%) Query: 13 ELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIF 72 E++++SV Y G L+D++L I I ++G NGAGKSTL + + GL+ G I + Sbjct: 1 EVENLSVGY-GGRTVLDDLSLSIEAGEIVGILGPNGAGKSTLLKTLAGLLKPSSGEILLD 59 Query: 73 NQTVEN---ALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVT 129 + + + A IAY+PQ Sbjct: 60 GKDLASLSPKELARKIAYVPQ--------------------------------------- 80 Query: 130 EALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFL 189 ALE +G++ + R ELS G+++RV LARALAQ+ ++++DEP + +D + E++ L Sbjct: 81 -ALELLGLAHLADRPFNELSGGERQRVLLARALAQEPPILLLDEPTSHLDIAHQIELLEL 139 Query: 190 LKSLLNE-DIMILVSTHNINSIPSFCDRTIFLK-KTVLASG 228 L+ L E +++ H++N + DR I LK ++A G Sbjct: 140 LRRLARERGKTVVMVLHDLNLAARYADRVILLKDGRIVAQG 180 >gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.. Length = 211 Score = 145 bits (367), Expect = 2e-35 Identities = 68/214 (31%), Positives = 111/214 (51%), Gaps = 9/214 (4%) Query: 13 ELKDISVTYPNGY-CALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 ELK++S +YP+G AL+D++L I + ++G NG+GKSTL + + GL+ G + + Sbjct: 1 ELKNLSFSYPDGARPALDDISLTIKKGEFVLIVGPNGSGKSTLLRLLNGLLGPTSGEVLV 60 Query: 72 FNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIV 128 + + +L + + Q D F VE+ V G + + V Sbjct: 61 DGKDLTKLSLKELRRKVGLVFQ-NPDDQFFGPTVEEEVAFG----LENLGLPEEEIEERV 115 Query: 129 TEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIF 188 EALE VG+ +R R LS GQ++RV +A LA ++++DEP A +D RE++ Sbjct: 116 EEALELVGLEGLRDRSPFTLSGGQKQRVAIAGVLAMDPDILLLDEPTAGLDPAGRRELLE 175 Query: 189 LLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 LLK L E I++ TH+++ + DR I L+ Sbjct: 176 LLKKLKAEGKTIIIVTHDLDLLLELADRVIVLED 209 >gnl|CDD|31319 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 235 Score = 145 bits (366), Expect = 2e-35 Identities = 67/231 (29%), Positives = 112/231 (48%), Gaps = 11/231 (4%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +E +++S YP AL+DV+L I + LIG NG+GKSTL + + GL+ G + + Sbjct: 4 IEAENLSFRYPGRKAALKDVSLEIEKGERVLLIGPNGSGKSTLLKLLNGLLKPTSGEVLV 63 Query: 72 FNQTVENALK----ADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRI 127 + + + Q P + ++V + + Sbjct: 64 DGLDTSSEKSLLELRQKVGLVFQNPDDQLFGPTVEDEVAFGLENLGLPREEIE-----ER 118 Query: 128 VTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMI 187 V EALE VG+ + R LS GQ++RV +A LA +++++DEP A +D K RE++ Sbjct: 119 VAEALELVGLEELLDRPPFNLSGGQKQRVAIAGVLAMGPEILLLDEPTAGLDPKGRRELL 178 Query: 188 FLLKSL-LNEDIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIFNE 236 LLK L I++ TH++ + + DR + L +LA G ++IFN+ Sbjct: 179 ELLKKLKEEGGKTIIIVTHDLELVLEYADRVVVLDDGKILADGDPAEIFND 229 >gnl|CDD|33436 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 258 Score = 140 bits (354), Expect = 5e-34 Identities = 76/248 (30%), Positives = 132/248 (53%), Gaps = 11/248 (4%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +E+K++S TYP G+ AL+DVNL I + + A+IG +GAGKSTL +++ GL+ G I Sbjct: 4 IEVKNLSKTYPGGHQALKDVNLEINQGEMVAIIGPSGAGKSTLLRSLNGLVDPTSGEILF 63 Query: 72 FNQTVENALKADLIAYIPQTESIDWTFPILVEDV-----VMMGRYKHMNWRRVA----SN 122 + +L I F LV + V++GR + + R S Sbjct: 64 NGVQITKLKGKELRKLRRDIGMIFQQFN-LVPRLSVLENVLLGRLGYTSTWRSLFGLFSK 122 Query: 123 NDYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKT 182 D +ALE VG+ ++ LS GQQ+RV +ARAL Q+ ++I+ DEP A++D ++ Sbjct: 123 EDKAQALDALERVGILDKAYQRASTLSGGQQQRVAIARALVQQPKIILADEPVASLDPES 182 Query: 183 EREMIFLLKSLLNED-IMILVSTHNINSIPSFCDRTIFLKKTVLASGLTSDIFNEDNIQK 241 ++++ +LK + ED I ++V+ H ++ + DR I LK + + ++ + + Sbjct: 183 AKKVMDILKDINQEDGITVIVNLHQVDLAKKYADRIIGLKAGRIVFDGPASELTDEALDE 242 Query: 242 TFGAQVSP 249 +G ++S Sbjct: 243 IYGNEISE 250 >gnl|CDD|72978 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).. Length = 236 Score = 139 bits (353), Expect = 7e-34 Identities = 75/234 (32%), Positives = 120/234 (51%), Gaps = 12/234 (5%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 LE++ ++ + G AL+DV+ + I LIG NGAGK+TLF I G + GS+ + Sbjct: 1 LEVRGLTKRF-GGLVALDDVSFSVRPGEIHGLIGPNGAGKTTLFNLISGFLRPTSGSV-L 58 Query: 72 FNQTVENALKADLIA--YIPQTESIDWTFPIL-VEDVVMMGRYKH-----MNWRRVASNN 123 F+ L IA I +T I FP L V + VM+ + R Sbjct: 59 FDGEDITGLPPHEIARLGIGRTFQIPRLFPELTVLENVMVAAQARTGSGLLLARARREER 118 Query: 124 DYR-IVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKT 182 + R E LE VG++ + R GELS GQQ+R+ +ARALA +++++DEP A ++ + Sbjct: 119 EARERAEELLERVGLADLADRPAGELSYGQQRRLEIARALATDPKLLLLDEPAAGLNPEE 178 Query: 183 EREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIFN 235 E+ L++ L I +L+ H+++ + S DR L + V+A G ++ N Sbjct: 179 TEELAELIRELRERGITVLLVEHDMDVVMSLADRVTVLDQGRVIAEGTPDEVRN 232 >gnl|CDD|73052 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 220 Score = 137 bits (346), Expect = 4e-33 Identities = 69/216 (31%), Positives = 106/216 (49%), Gaps = 14/216 (6%) Query: 12 LELKDISVTYPNG---YCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGS 68 LE++++S TY G ALED++L + E AL+G +G GKSTL + I GL G Sbjct: 1 LEVRNVSKTYGGGGGAVTALEDISLSVEEGEFVALVGPSGCGKSTLLRIIAGLERPTSGE 60 Query: 69 ISIFNQTVENALKADLIAYIPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRVASNNDYRI 127 + + + V Y+ Q +++ P L V D V +G + + V Sbjct: 61 VLVDGEPVTGPGPD--RGYVFQQDAL---LPWLTVLDNVALG----LELQGVPKAEARER 111 Query: 128 VTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMI 187 E LE VG+S +LS G ++RV LARALA V+++DEPF+A+D T ++ Sbjct: 112 AEELLELVGLSGFENAYPHQLSGGMRQRVALARALAVDPDVLLLDEPFSALDALTREQLQ 171 Query: 188 FLLKSLLNEDIM-ILVSTHNINSIPSFCDRTIFLKK 222 L + E +L+ TH+I+ DR + L Sbjct: 172 EELLDIWRETGKTVLLVTHDIDEAVFLADRVVVLSA 207 >gnl|CDD|34201 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 259 Score = 135 bits (342), Expect = 1e-32 Identities = 74/246 (30%), Positives = 126/246 (51%), Gaps = 15/246 (6%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 + +++S + G L+ V+L + + A++G NGAGKSTL +A+ G + D G +++ Sbjct: 2 IRAENLSYSL-AGRRLLDGVSLDLRPGEVLAILGPNGAGKSTLLKALSGELSPDSGEVTL 60 Query: 72 FNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIV 128 + + +L A +PQ S+ FP V++VV MGR H + R D RI Sbjct: 61 NGVPLNSWPPEELARHRAVLPQNSSL--AFPFTVQEVVQMGRIPHRSGRE--PEEDERIA 116 Query: 129 TEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQ------VIIMDEPFAAIDFKT 182 +AL +S + R LS G+Q+RV LAR LAQ + +DEP +A+D Sbjct: 117 AQALAATDLSGLAGRDYRTLSGGEQQRVQLARVLAQLWPPVPSGRWLFLDEPTSALDIAH 176 Query: 183 EREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIFNEDNIQK 241 + + L + L E +L H++N + DR + L + V+ASG D+ ++ +++ Sbjct: 177 QHHTLRLARQLAREGGAVLAVLHDLNLAAQYADRIVLLHQGRVIASGSPQDVLTDETLER 236 Query: 242 TFGAQV 247 +GA + Sbjct: 237 VYGADI 242 >gnl|CDD|73018 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and Solute Transporters-like subgroup. This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 213 Score = 134 bits (338), Expect = 3e-32 Identities = 73/218 (33%), Positives = 108/218 (49%), Gaps = 11/218 (5%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 LELK +S TY + AL+D++L + AL+G +G GK+TL + I GL D G I I Sbjct: 1 LELKGLSKTYGSVR-ALDDLSLTVEPGEFLALLGPSGCGKTTLLRLIAGLERPDSGEILI 59 Query: 72 FNQTVENALKADL-IAYIPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRVASNNDYRIVT 129 + V I + Q ++ FP L V + + G + R V V Sbjct: 60 DGRDVTGVPPERRNIGMVFQDYAL---FPHLTVAENIAFG----LKLRGVPKAEIRARVR 112 Query: 130 EALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFL 189 E LE VG+ + R ELS GQQ+RV LARALA++ ++++DEP +A+D K E+ Sbjct: 113 ELLELVGLEGLLNRYPHELSGGQQQRVALARALAREPSLLLLDEPLSALDAKLREELREE 172 Query: 190 LKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKKTVLA 226 LK L E I + TH+ + DR + + + Sbjct: 173 LKELQRELGITTIYVTHDQEEALALADRIAVMNEGRIV 210 >gnl|CDD|31313 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 248 Score = 133 bits (336), Expect = 6e-32 Identities = 65/213 (30%), Positives = 108/213 (50%), Gaps = 12/213 (5%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 LE++ +S ++ G LED+NL + + A++G +G GKSTL + I GL G + + Sbjct: 4 LEIEGVSKSFG-GVEVLEDINLSVEKGEFVAILGPSGCGKSTLLRLIAGLEKPTSGEVLL 62 Query: 72 FNQTVENALKADLIAYIPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRVASNNDYRIVTE 130 + V D I Y+ Q +++ P L V D V +G + R + E Sbjct: 63 DGRPV-TGPGPD-IGYVFQEDAL---LPWLTVLDNVALG----LELRGKSKAEARERAKE 113 Query: 131 ALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLL 190 LE VG++ + +LS G ++RV +ARALA + +++++DEPF A+D T E+ L Sbjct: 114 LLELVGLAGFEDKYPHQLSGGMRQRVAIARALATRPKLLLLDEPFGALDALTREELQDEL 173 Query: 191 KSLLNED-IMILVSTHNINSIPSFCDRTIFLKK 222 L E +L+ TH+++ DR + L Sbjct: 174 LRLWEETRKTVLLVTHDVDEAVYLADRVVVLSN 206 >gnl|CDD|34235 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 252 Score = 132 bits (334), Expect = 9e-32 Identities = 71/237 (29%), Positives = 126/237 (53%), Gaps = 10/237 (4%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 + ++++S +Y L+DV+L IP+ IT++IG NGAGKSTL + L+ D G I+I Sbjct: 2 ITIENVSKSY-GTKVVLDDVSLDIPKGGITSIIGPNGAGKSTLLSMMSRLLKKDSGEITI 60 Query: 72 FNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIV 128 + + +L ++ + Q I + V D+V GR+ + R + D RI+ Sbjct: 61 DGLELTSTPSKELAKKLSILKQENHI--NSRLTVRDLVGFGRFPYSQGR--LTKEDRRII 116 Query: 129 TEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIF 188 EA+E + + + R + ELS GQ++R F+A LAQ + +++DEP +D K +++ Sbjct: 117 NEAIEYLHLEDLSDRYLDELSGGQRQRAFIAMVLAQDTDYVLLDEPLNNLDMKHSVQIMK 176 Query: 189 LLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIFNEDNIQKTF 243 +L+ L +E I+V H+IN + D + LK V+ G +I + + + + Sbjct: 177 ILRRLADELGKTIVVVLHDINFASCYSDHIVALKNGKVVKQGSPDEIIQPEILSEIY 233 >gnl|CDD|30760 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]. Length = 250 Score = 131 bits (331), Expect = 2e-31 Identities = 73/237 (30%), Positives = 117/237 (49%), Gaps = 15/237 (6%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 LE++ +S + G A+ DV+L + I LIG NGAGK+TLF I G G++ I Sbjct: 5 LEVRGLSKRF-GGLTAVNDVSLEVRPGEIVGLIGPNGAGKTTLFNLITGFYKPSSGTV-I 62 Query: 72 FNQTVENALKADLIAY--IPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRV----ASNND 124 F L IA I +T I FP L V + V +G + + + + + Sbjct: 63 FRGRDITGLPPHRIARLGIARTFQITRLFPGLTVLENVAVGAHARLGLSGLLGRPRARKE 122 Query: 125 YRIVTE----ALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDF 180 R E LE VG+ + R G LS GQQ+R+ +ARALA + +++++DEP A ++ Sbjct: 123 EREARERARELLEFVGLGELADRPAGNLSYGQQRRLEIARALATQPKLLLLDEPAAGLNP 182 Query: 181 KTEREMIFLLKSL-LNEDIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIFN 235 + E+ L++ L + IL+ H++ + DR + L V+A G ++ N Sbjct: 183 EETEELAELIRELRDRGGVTILLIEHDMKLVMGLADRIVVLNYGEVIAEGTPEEVRN 239 >gnl|CDD|72989 cd03230, ABC_DR_subfamily_A, This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity. In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins. Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family. The ATP-binding domain shows the highest similarity between all members of the ABC transporter family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 173 Score = 128 bits (323), Expect = 2e-30 Identities = 57/213 (26%), Positives = 101/213 (47%), Gaps = 45/213 (21%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +E++++S Y AL+D++L + + I L+G NGAGK+TL + I+GL+ D G I + Sbjct: 1 IEVRNLSKRYGKKT-ALDDISLTVEKGEIYGLLGPNGAGKTTLIKIILGLLKPDSGEIKV 59 Query: 72 FNQTVENALKA--DLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVT 129 + ++ + I Y+P+ S+ Y+++ Sbjct: 60 LGKDIKKEPEEVKRRIGYLPEEPSL----------------YENLT-------------- 89 Query: 130 EALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFL 189 EN+ +LS G ++R+ LA+AL +++I+DEP + +D ++ RE L Sbjct: 90 -VRENL-----------KLSGGMKQRLALAQALLHDPELLILDEPTSGLDPESRREFWEL 137 Query: 190 LKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 L+ L E IL+S+H + CDR L Sbjct: 138 LRELKKEGKTILLSSHILEEAERLCDRVAILNN 170 >gnl|CDD|33633 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]. Length = 352 Score = 127 bits (321), Expect = 3e-30 Identities = 66/224 (29%), Positives = 112/224 (50%), Gaps = 12/224 (5%) Query: 7 STKGGLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDK 66 K LE++++S ++ + A++D++L I + L+G +G GK+TL + I G Sbjct: 1 MPKPALEIRNVSKSF-GDFTAVDDISLDIKKGEFVTLLGPSGCGKTTLLRMIAGFEQPSS 59 Query: 67 GSISIFNQTVEN--ALKADLIAYIPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRVASNN 123 G I + + + + K I + Q+ ++ FP + VE+ V G + + + Sbjct: 60 GEILLDGEDITDVPPEKRP-IGMVFQSYAL---FPHMTVEENVAFG--LKVRKKLKKAEI 113 Query: 124 DYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTE 183 R V EALE VG+ R+ +LS GQQ+RV LARAL + +V+++DEP +A+D K Sbjct: 114 KAR-VEEALELVGLEGFADRKPHQLSGGQQQRVALARALVPEPKVLLLDEPLSALDAKLR 172 Query: 184 REMIFLLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKKTVLA 226 +M LK L E I + TH+ + DR + + Sbjct: 173 EQMRKELKELQRELGITFVYVTHDQEEALAMSDRIAVMNDGRIE 216 >gnl|CDD|73014 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.. Length = 218 Score = 126 bits (319), Expect = 5e-30 Identities = 67/222 (30%), Positives = 107/222 (48%), Gaps = 20/222 (9%) Query: 12 LELKDISVTYPNG---YCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGS 68 +ELK++S TY G AL+ V+L I + A++G +G+GKSTL + GL G Sbjct: 1 IELKNLSKTYGGGGEKVQALKGVSLSIEKGEFVAIVGPSGSGKSTLLNILGGLDRPTSGE 60 Query: 69 ISIFNQTVEN-------ALKADLIAYIPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRVA 120 + + + A + I ++ Q+ ++ P L + V + + V Sbjct: 61 VRVDGTDISKLSEKELAAFRRRHIGFVFQSFNL---LPDLTALENVELP----LLLAGVP 113 Query: 121 SNNDYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDF 180 E LE VG+ ELS GQQ+RV +ARALA ++I+ DEP +D Sbjct: 114 KKERRERAEELLERVGLGDRLNHYPSELSGGQQQRVAIARALANDPKIILADEPTGNLDS 173 Query: 181 KTEREMIFLLKSLLNED-IMILVSTHNINSIPSFCDRTIFLK 221 +T +E++ LL+ L E I+V TH+ + + DR I L+ Sbjct: 174 ETGKEVMELLRELNKEAGTTIVVVTHD-PELAEYADRIIELR 214 >gnl|CDD|73023 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component. The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 211 Score = 125 bits (315), Expect = 1e-29 Identities = 66/214 (30%), Positives = 110/214 (51%), Gaps = 13/214 (6%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 L+L++++ Y AL+ V+L + + L+G NGAGK+TL + + L P G+I I Sbjct: 1 LQLENLTKRYGKK-RALDGVSLTLGPG-MYGLLGPNGAGKTTLMRILATLTPPSSGTIRI 58 Query: 72 FNQTVENALKA--DLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNW-RRVASNNDYRIV 128 Q V + I Y+PQ + F V + + ++ W + + S V Sbjct: 59 DGQDVLKQPQKLRRRIGYLPQEFGVYPNFT--VREFL-----DYIAWLKGIPSKEVKARV 111 Query: 129 TEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIF 188 E LE V + +++IG LS G ++RV +A+AL ++I+DEP A +D + ER Sbjct: 112 DEVLELVNLGDRAKKKIGSLSGGMRRRVGIAQALVGDPSILIVDEPTAGLDPE-ERIRFR 170 Query: 189 LLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 L S L ED ++++STH + + S C++ L K Sbjct: 171 NLLSELGEDRIVILSTHIVEDVESLCNQVAVLNK 204 >gnl|CDD|31325 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]. Length = 500 Score = 124 bits (314), Expect = 2e-29 Identities = 69/244 (28%), Positives = 122/244 (50%), Gaps = 11/244 (4%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 LEL+ IS ++ G AL+ V+L + + AL+G NGAGKSTL + + G+ P D G I I Sbjct: 9 LELRGISKSFG-GVKALDGVSLTVRPGEVHALLGENGAGKSTLMKILSGVYPPDSGEILI 67 Query: 72 FNQTVENALKADL----IAYIPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRVASNNDYR 126 + V + D IA + Q S+ P L V + + +GR + + R Sbjct: 68 DGKPVAFSSPRDALAAGIATVHQELSL---VPNLSVAENIFLGREPTRRFGLIDRKAMRR 124 Query: 127 IVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREM 186 E L +G+ +G+LSI Q++ V +ARAL+ ++V+I+DEP AA+ K + Sbjct: 125 RARELLARLGLDIDPDTLVGDLSIAQRQMVEIARALSFDARVLILDEPTAALTVKETERL 184 Query: 187 IFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLK--KTVLASGLTSDIFNEDNIQKTFG 244 L++ L + + I+ +H ++ + DR L+ + V ++ ++ ++ G Sbjct: 185 FDLIRRLKAQGVAIIYISHRLDEVFEIADRITVLRDGRVVGTRPTAAETSEDELVRLMVG 244 Query: 245 AQVS 248 ++ Sbjct: 245 RELE 248 Score = 93.7 bits (233), Expect = 5e-20 Identities = 57/222 (25%), Positives = 101/222 (45%), Gaps = 13/222 (5%) Query: 28 LEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVEN-----ALKA 82 + DV+ + I + GL GAG++ L +A+ G P G I + + V A+KA Sbjct: 275 VRDVSFTVRAGEILGIAGLVGAGRTELARALFGARPASSGEILLDGKPVRIRSPRDAIKA 334 Query: 83 DLIAYIP---QTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALE--NVGM 137 IAY+P ++E + I E++ + + + + + + + Sbjct: 335 -GIAYVPEDRKSEGLVLDMSIA-ENITLASLRRFSRRGLIDRRKERALAERYIRRLRIKT 392 Query: 138 SSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNED 197 S Q IG LS G Q++V LAR LA +V+I+DEP ID + E+ L++ L E Sbjct: 393 PSPEQP-IGTLSGGNQQKVVLARWLATDPKVLILDEPTRGIDVGAKAEIYRLIRELAAEG 451 Query: 198 IMILVSTHNINSIPSFCDRTIFLKKTVLASGLTSDIFNEDNI 239 IL+ + + + DR + +++ + L + E+ I Sbjct: 452 KAILMISSELPELLGLSDRILVMREGRIVGELDREEATEEAI 493 >gnl|CDD|73022 cd03263, ABC_subfamily_A, The ABCA subfamily mediates the transport of a variety of lipid compounds. Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.. Length = 220 Score = 122 bits (309), Expect = 9e-29 Identities = 53/221 (23%), Positives = 106/221 (47%), Gaps = 11/221 (4%) Query: 12 LELKDISVTYPNGYC-ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 L++++++ TY G A++D++L + + I L+G NGAGK+T + + G + G+ Sbjct: 1 LQIRNLTKTYKKGTKPAVDDLSLNVYKGEIFGLLGHNGAGKTTTLKMLTGELRPTSGTAY 60 Query: 71 IFNQTVENALKA--DLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIV 128 I ++ KA + Y PQ +++ + E + R K + + V Sbjct: 61 INGYSIRTDRKAARQSLGYCPQFDALFDELTVR-EHLRFYARLKGLPKSEIKEE-----V 114 Query: 129 TEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIF 188 L +G++ ++ LS G ++++ LA AL V+++DEP + +D + R + Sbjct: 115 ELLLRVLGLTDKANKRARTLSGGMKRKLSLAIALIGGPSVLLLDEPTSGLDPASRRAIWD 174 Query: 189 LLKSLLNEDIMILVSTHNINSIPSFCDRT-IFLKKTVLASG 228 L+ + +IL +TH+++ + CDR I + G Sbjct: 175 LILEVRKGRSIIL-TTHSMDEAEALCDRIAIMSDGKLRCIG 214 >gnl|CDD|33631 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]. Length = 338 Score = 121 bits (306), Expect = 2e-28 Identities = 63/232 (27%), Positives = 108/232 (46%), Gaps = 18/232 (7%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 LELK++ ++ + L+DVNL I + L+G +G GKSTL + I GL G I I Sbjct: 4 LELKNVRKSFGSFE-VLKDVNLDIEDGEFVVLLGPSGCGKSTLLRMIAGLEEPTSGEILI 62 Query: 72 FNQTVENALKADL-IAYIPQTESIDWTFPILVEDVVMMGRYKHMNW----RRVASNNDYR 126 + V + IA + Q ++ +P M Y+++ + R V + Sbjct: 63 DGRDVTDLPPEKRGIAMVFQNYAL---YP-------HMTVYENIAFGLKLRGVPKAEIDK 112 Query: 127 IVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREM 186 V E + +G+ + R+ +LS GQ++RV LARAL +K +V ++DEP + +D K M Sbjct: 113 RVKEVAKLLGLEHLLNRKPLQLSGGQRQRVALARALVRKPKVFLLDEPLSNLDAKLRVLM 172 Query: 187 IFLLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIFNE 236 +K L + TH+ + DR + + + G +++ Sbjct: 173 RSEIKKLHERLGTTTIYVTHDQVEAMTLADRIVVMNDGRIQQVGTPLELYER 224 >gnl|CDD|72983 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids. The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.. Length = 222 Score = 120 bits (304), Expect = 3e-28 Identities = 67/233 (28%), Positives = 116/233 (49%), Gaps = 19/233 (8%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 LE+++++ Y L V+L +PE I AL+G NGAGK+TL + IMGL+P GSI Sbjct: 1 LEVENLNAGY-GKSQILFGVSLTVPEGEIVALLGRNGAGKTTLLKTIMGLLPPRSGSIRF 59 Query: 72 FNQTVENALKADL----IAYIPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRVASNNDYR 126 + + + I Y+P+ I FP L VE+ +++G Y R + R Sbjct: 60 DGRDITGLPPHERARAGIGYVPEGRRI---FPELTVEENLLLGAY-----ARRRAKRKAR 111 Query: 127 I--VTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTER 184 + V E + R++ G LS G+Q+ + +ARAL + +++++DEP + K Sbjct: 112 LERVYELFPRLK--ERRKQLAGTLSGGEQQMLAIARALMSRPKLLLLDEPSEGLAPKIVE 169 Query: 185 EMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIFNE 236 E+ ++ L +E + IL+ N DR L++ V+ G +++ + Sbjct: 170 EIFEAIRELRDEGVTILLVEQNARFALEIADRAYVLERGRVVLEGTAAELLAD 222 >gnl|CDD|73016 cd03257, ABC_NikE_OppD_transporters, The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE). The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE). The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis. The molecular mechanism of nickel uptake in many bacteria and most archaea is not known. Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides. The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.. Length = 228 Score = 119 bits (301), Expect = 7e-28 Identities = 65/224 (29%), Positives = 108/224 (48%), Gaps = 17/224 (7%) Query: 12 LELKDISVTYPNGYC---ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGS 68 LE+K++SV++P G AL+DV+ I + L+G +G+GKSTL +AI+GL+ GS Sbjct: 2 LEVKNLSVSFPTGGGSVKALDDVSFSIKKGETLGLVGESGSGKSTLARAILGLLKPTSGS 61 Query: 69 ISIFNQTVENALKADL------IAYIPQ--TESIDWTFPILVEDVVMMGRYKHMNWRRVA 120 I + + + I + Q S++ I + + H + Sbjct: 62 IIFDGKDLLKLSRRLRKIRRKEIQMVFQDPMSSLNPRMTI--GEQIAEPLRIHGKLSKKE 119 Query: 121 SNNDYRIVTEALENVGMSSMR-QRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAID 179 + V L VG+ R ELS GQ++RV +ARALA +++I DEP +A+D Sbjct: 120 ARK--EAVLLLLVGVGLPEEVLNRYPHELSGGQRQRVAIARALALNPKLLIADEPTSALD 177 Query: 180 FKTEREMIFLLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKK 222 + +++ LLK L E + +L TH++ + DR + Sbjct: 178 VSVQAQILDLLKKLQEELGLTLLFITHDLGVVAKIADRVAVMYA 221 >gnl|CDD|73020 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 235 Score = 119 bits (300), Expect = 9e-28 Identities = 66/234 (28%), Positives = 117/234 (50%), Gaps = 12/234 (5%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +EL+ ++ ++ G L+ V+L + I A+IG +G+GKSTL + I+GL+ D G + I Sbjct: 1 IELRGLTKSF-GGRTVLKGVDLDVRRGEILAIIGPSGSGKSTLLRLIVGLLRPDSGEVLI 59 Query: 72 FNQTVENALKADLIAYIPQTESIDWTFPIL-----VEDVVMMGRYKHMNWRRVASNNDYR 126 + + +A+L + + + + L V + V +H R++ Sbjct: 60 DGEDISGLSEAELYR-LRRRMGMLFQSGALFDSLTVFENVAFPLREH---TRLSEEEIRE 115 Query: 127 IVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREM 186 IV E LE VG+ ELS G +KRV LARALA ++++ DEP A +D + Sbjct: 116 IVLEKLEAVGLRGAEDLYPAELSGGMKKRVALARALALDPELLLYDEPTAGLDPIASGVI 175 Query: 187 IFLLKSLLNE-DIMILVSTHNINSIPSFCDRTIFL-KKTVLASGLTSDIFNEDN 238 L++SL E + ++ TH++++ + DR L ++A G ++ D+ Sbjct: 176 DDLIRSLKKELGLTSIMVTHDLDTAFAIADRIAVLYDGKIVAEGTPEELRASDD 229 >gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]. Length = 539 Score = 118 bits (298), Expect = 1e-27 Identities = 65/243 (26%), Positives = 117/243 (48%), Gaps = 21/243 (8%) Query: 12 LELKDISVTYPNGY---CALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIP----L 64 LE+++++V + A+ DV+ + I ++G +G+GKSTL A+MGL+P + Sbjct: 6 LEVENLTVEFATDGGRVPAVRDVSFEVEPGEILGIVGESGSGKSTLALALMGLLPEGGRI 65 Query: 65 DKGSISIFNQTV-------ENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWR 117 G + + + + L+ IA I Q + + D + H Sbjct: 66 TSGEVILDGRDLLGLSEREMRKLRGKRIAMIFQDPMTSLNPVMTIGDQIREALRLHGK-- 123 Query: 118 RVASNNDYRIVTEALENVGMS-SMRQRQIG-ELSIGQQKRVFLARALAQKSQVIIMDEPF 175 + + E LE VG+ R+ + +LS G ++RV +A ALA K +++I DEP Sbjct: 124 -GSRAEARKRAVELLEQVGLPDPERRDRYPHQLSGGMRQRVMIAMALALKPKLLIADEPT 182 Query: 176 AAIDFKTEREMIFLLKSLLNEDIM-ILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDI 233 A+D T+ +++ LLK L E M +L TH++ + DR + + K ++ +G T +I Sbjct: 183 TALDVTTQAQILDLLKDLQRELGMAVLFITHDLGVVAELADRVVVMYKGEIVETGPTEEI 242 Query: 234 FNE 236 + Sbjct: 243 LSN 245 Score = 112 bits (281), Expect = 1e-25 Identities = 64/248 (25%), Positives = 112/248 (45%), Gaps = 31/248 (12%) Query: 12 LELKDISVTYPNG----------YCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGL 61 L ++++S Y + A++DV+ + E L+G +G+GKSTL + + GL Sbjct: 281 LSVRNLSKRYGSRKGLFVRERGEVKAVDDVSFDLREGETLGLVGESGSGKSTLARILAGL 340 Query: 62 IPLDKGSISIFNQTVENALKADL-------IAYIPQTESIDWTFPI---LVEDVVMMGRY 111 +P GSI Q ++ + + S++ + L E + + G Sbjct: 341 LPPSSGSIIFDGQDLDLTGGELRRLRRRIQMVFQDPYSSLNPRMTVGDILAEPLRIHGGG 400 Query: 112 KHMNWRRVASNNDYRIVTEALENVGMS-SMRQRQIGELSIGQQKRVFLARALAQKSQVII 170 R V E LE VG+ R ELS GQ++RV +ARALA + +++I Sbjct: 401 SGAERRA--------RVAELLELVGLPPEFLDRYPHELSGGQRQRVAIARALALEPKLLI 452 Query: 171 MDEPFAAIDFKTEREMIFLLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKK-TVLASG 228 +DEP +A+D + +++ LLK L E + L +H++ + DR + ++ G Sbjct: 453 LDEPVSALDVSVQAQVLNLLKDLQEELGLTYLFISHDLAVVRYIADRVAVMYDGRIVEEG 512 Query: 229 LTSDIFNE 236 T +F Sbjct: 513 PTEKVFEN 520 >gnl|CDD|31331 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]. Length = 226 Score = 118 bits (298), Expect = 1e-27 Identities = 69/226 (30%), Positives = 111/226 (49%), Gaps = 27/226 (11%) Query: 12 LELKDISVTYPNGYC---ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGS 68 +ELK++S Y G AL+DVNL I A++G +G+GKSTL + GL G Sbjct: 2 IELKNVSKIYGLGGEKVEALKDVNLEIEAGEFVAIVGPSGSGKSTLLNLLGGLDKPTSGE 61 Query: 69 ISIFNQTVEN-------ALKADLIAYIPQTESIDWTFPIL----VEDVVMMGRYKHMNWR 117 + I + + L+ I ++ Q F +L V + V + + Sbjct: 62 VLINGKDLTKLSEKELAKLRRKKIGFVFQN------FNLLPDLTVLENVEL----PLLIA 111 Query: 118 RVASNNDYRIVTEALENVGMS-SMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFA 176 ++ R E LE +G+ + +++ ELS GQQ+RV +ARAL ++I+ DEP Sbjct: 112 GKSAGRRKRAAEELLEVLGLEDRLLKKKPSELSGGQQQRVAIARALINNPKIILADEPTG 171 Query: 177 AIDFKTEREMIFLLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLK 221 +D KT +E++ LL+ L E I++ TH+ + + DR I LK Sbjct: 172 NLDSKTAKEVLELLRELNKERGKTIIMVTHD-PELAKYADRVIELK 216 >gnl|CDD|72988 cd03229, ABC_Class3, This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 178 Score = 118 bits (298), Expect = 1e-27 Identities = 70/215 (32%), Positives = 102/215 (47%), Gaps = 45/215 (20%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 LELK++S Y L DV+L I I AL+G +G+GKSTL + I GL D GSI I Sbjct: 1 LELKNVSKRY-GQKTVLNDVSLNIEAGEIVALLGPSGSGKSTLLRCIAGLEEPDSGSILI 59 Query: 72 FNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMM----GRYKHMNWRRVASNNDYRI 127 + + DL +P + M+ + H+ Sbjct: 60 DGEDL-----TDLEDELPPLR----------RRIGMVFQDFALFPHLT------------ 92 Query: 128 VTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMI 187 LEN+ + LS GQQ+RV LARALA V+++DEP +A+D T RE+ Sbjct: 93 ---VLENIALG---------LSGGQQQRVALARALAMDPDVLLLDEPTSALDPITRREVR 140 Query: 188 FLLKSLLNED-IMILVSTHNINSIPSFCDRTIFLK 221 LLKSL + I +++ TH+++ DR + L+ Sbjct: 141 ALLKSLQAQLGITVVLVTHDLDEAARLADRVVVLR 175 >gnl|CDD|34593 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]. Length = 559 Score = 117 bits (294), Expect = 4e-27 Identities = 64/248 (25%), Positives = 118/248 (47%), Gaps = 31/248 (12%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 + L+++S YP+G AL D+NL I +TAL+G +GAGKSTL ++G + +G I + Sbjct: 321 ISLENLSFRYPDGKPALSDLNLTIKAGQLTALVGASGAGKSTLLNLLLGFLAPTQGEIRV 380 Query: 72 FNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIV 128 + + I+++ Q + F + + +++ R AS+ + + Sbjct: 381 NGIDLRDLSPEAWRKQISWVSQNPYL---FAGTIRENILLARPD-------ASDEE---I 427 Query: 129 TEALENVGMSSMRQR------QIGE----LSIGQQKRVFLARALAQKSQVIIMDEPFAAI 178 AL+ G+ + IGE LS GQ +R+ LARAL + ++++DEP A + Sbjct: 428 IAALDQAGLLEFVPKPDGLDTVIGEGGAGLSGGQAQRLALARALLSPASLLLLDEPTAHL 487 Query: 179 DFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKKTVLASGLTSDIFNEDN 238 D +TE+ ++ L+ L + ++++ TH + DR + L L E + Sbjct: 488 DAETEQIILQALQELAKQKTVLVI-THRLEDAAD-ADRIVVLDNGRLVE---QGTHEELS 542 Query: 239 IQKTFGAQ 246 ++ A Sbjct: 543 EKQGLYAN 550 >gnl|CDD|72987 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 171 Score = 115 bits (290), Expect = 1e-26 Identities = 57/215 (26%), Positives = 96/215 (44%), Gaps = 50/215 (23%) Query: 12 LELKDISVTYPNGY-CALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 +E K++S +YP L+DV+L I A++G +G+GKSTL + ++ L G I Sbjct: 1 IEFKNVSFSYPGRPKPVLKDVSLTIKPGEKVAIVGPSGSGKSTLLKLLLRLYDPTSGEIL 60 Query: 71 IFNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRI 127 I + + L IAY+PQ P L + Sbjct: 61 IDGVDLRDLDLESLRKNIAYVPQD-------PFLFSGTIR-------------------- 93 Query: 128 VTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMI 187 EN+ LS GQ++R+ +ARAL + ++I+DE +A+D +TE ++ Sbjct: 94 -----ENI------------LSGGQRQRIAIARALLRDPPILILDEATSALDPETEALIL 136 Query: 188 FLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 L++L +I++ H +++I DR I L Sbjct: 137 EALRALAKGKTVIVI-AHRLSTI-RDADRIIVLDD 169 >gnl|CDD|73019 cd03260, ABC_PstB_phosphate_transporter, Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient. The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).. Length = 227 Score = 115 bits (289), Expect = 2e-26 Identities = 70/237 (29%), Positives = 115/237 (48%), Gaps = 24/237 (10%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPL-----DK 66 +EL+D++V Y AL+D++L IP+ ITALIG +G GKSTL + + L L D+ Sbjct: 1 IELRDLNVYY-GDKHALKDISLDIPKGEITALIGPSGCGKSTLLRLLNRLNDLIPGAPDE 59 Query: 67 GSISIFNQTVENALKADL------IAYIPQTESIDWTFPILVEDVVMMG-RYKHMNWRRV 119 G + + + + L D+ + + Q + FP + D V G R + + Sbjct: 60 GEVLLDGKDI-YDLDVDVLELRRRVGMVFQKPNP---FPGSIYDNVAYGLRLHGIKLKEE 115 Query: 120 ASNNDYRIVTEALENVGM--SSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAA 177 V EAL + + LS GQQ+R+ LARALA + +V+++DEP +A Sbjct: 116 LD----ERVEEALRKAALWDEVKDRLHALGLSGGQQQRLCLARALANEPEVLLLDEPTSA 171 Query: 178 IDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKKTVLASGLTSDIF 234 +D + ++ L+ L ++ I++ THN+ DRT FL L ++ Sbjct: 172 LDPISTAKIEELIAE-LKKEYTIVIVTHNMQQAARVADRTAFLLNGRLVEFGPTEQI 227 >gnl|CDD|31332 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only]. Length = 243 Score = 114 bits (288), Expect = 2e-26 Identities = 72/238 (30%), Positives = 122/238 (51%), Gaps = 12/238 (5%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 L ++++ +Y + DV+L + I L+G NGAGK+T F I+GL+ D G I + Sbjct: 5 LVAENLAKSY-KKRKVVNDVSLEVNSGEIVGLLGPNGAGKTTTFYMIVGLVRPDSGKILL 63 Query: 72 FNQTVENA---LKADL-IAYIPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRVASNNDYR 126 ++ + +A L I Y+PQ SI F L VED +M + A + Sbjct: 64 DDEDITKLPMHKRARLGIGYLPQEASI---FRKLTVEDNIMAVLEIREKDLKKAERKEE- 119 Query: 127 IVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREM 186 + LE ++ +R + LS G+++RV +ARALA + I++DEPFA +D ++ Sbjct: 120 -LDALLEEFHITHLRDSKAYSLSGGERRRVEIARALAANPKFILLDEPFAGVDPIAVIDI 178 Query: 187 IFLLKSLLNEDIMILVSTHNINSIPSFCDRT-IFLKKTVLASGLTSDIFNEDNIQKTF 243 ++K L + I +L++ HN+ CDR I VLA G +I N +++++ + Sbjct: 179 QRIIKHLKDRGIGVLITDHNVRETLDICDRAYIISDGKVLAEGSPEEIVNNEDVRRVY 236 >gnl|CDD|72985 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.. Length = 205 Score = 114 bits (286), Expect = 4e-26 Identities = 55/209 (26%), Positives = 104/209 (49%), Gaps = 9/209 (4%) Query: 13 ELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIF 72 +++IS +Y G L+D++L + I AL G NGAGK+TL + + GLI GSI + Sbjct: 1 RIENISFSYKKGTEILDDLSLDLYAGEIIALTGKNGAGKTTLAKILAGLIKESSGSILLN 60 Query: 73 NQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEAL 132 + ++ + I Y+ Q + F V + +++G + L Sbjct: 61 GKPIKAKERRKSIGYVMQ-DVDYQLFTDSVREELLLGLK--------ELDAGNEQAETVL 111 Query: 133 ENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKS 192 +++ + ++++R LS GQ++R+ +A AL ++I DEP + +D+K + L++ Sbjct: 112 KDLDLYALKERHPLSLSGGQKQRLAIAAALLSGKDLLIFDEPTSGLDYKNMERVGELIRE 171 Query: 193 LLNEDIMILVSTHNINSIPSFCDRTIFLK 221 L + ++V TH+ + CDR + L Sbjct: 172 LAAQGKAVIVITHDYEFLAKVCDRVLLLA 200 >gnl|CDD|31330 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 339 Score = 113 bits (285), Expect = 5e-26 Identities = 72/235 (30%), Positives = 120/235 (51%), Gaps = 18/235 (7%) Query: 12 LELKDISVTYPNGYC----ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKG 67 +EL+++S T+ AL+DV+L IP+ I +IG +GAGKSTL + I L G Sbjct: 2 IELENVSKTFGQTGTGTVTALDDVSLEIPKGEIFGIIGYSGAGKSTLLRLINLLERPTSG 61 Query: 68 SISIFNQTVENALKADL------IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVAS 121 S+ + Q + +A+L I I Q ++ + V + V + V Sbjct: 62 SVFVDGQDLTALSEAELRQLRQKIGMIFQHFNLLSSRT--VFENVAFP----LELAGVPK 115 Query: 122 NNDYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFK 181 + V E LE VG+S R +LS GQ++RV +ARALA ++++ DE +A+D + Sbjct: 116 AEIKQRVAELLELVGLSDKADRYPAQLSGGQKQRVAIARALANNPKILLCDEATSALDPE 175 Query: 182 TEREMIFLLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIF 234 T + ++ LLK + E + I++ TH + + CDR L + ++ G S++F Sbjct: 176 TTQSILELLKDINRELGLTIVLITHEMEVVKRICDRVAVLDQGRLVEEGTVSEVF 230 >gnl|CDD|72977 cd03218, ABC_YhbG, The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids. The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis. YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein. Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli. The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.. Length = 232 Score = 112 bits (283), Expect = 7e-26 Identities = 73/241 (30%), Positives = 121/241 (50%), Gaps = 20/241 (8%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 L +++S Y + V+L + + I L+G NGAGK+T F I+GL+ D G I + Sbjct: 1 LRAENLSKRY-GKRKVVNGVSLSVKQGEIVGLLGPNGAGKTTTFYMIVGLVKPDSGKILL 59 Query: 72 FNQTVENA---LKADL-IAYIPQTESIDWTFPIL-VED---VVMMGRYKHMNWRRVASNN 123 Q + +A L I Y+PQ SI F L VE+ V+ R R Sbjct: 60 DGQDITKLPMHKRARLGIGYLPQEASI---FRKLTVEENILAVLEIRGLSKKERE----- 111 Query: 124 DYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTE 183 + E LE ++ +R+ + LS G+++RV +ARALA + +++DEPFA +D Sbjct: 112 --EKLEELLEEFHITHLRKSKASSLSGGERRRVEIARALATNPKFLLLDEPFAGVDPIAV 169 Query: 184 REMIFLLKSLLNEDIMILVSTHNINSIPSFCDRT-IFLKKTVLASGLTSDIFNEDNIQKT 242 +++ ++K L + I +L++ HN+ S DR I + VLA G +I + ++K Sbjct: 170 QDIQKIIKILKDRGIGVLITDHNVRETLSITDRAYIIYEGKVLAEGTPEEIAANELVRKV 229 Query: 243 F 243 + Sbjct: 230 Y 230 >gnl|CDD|72971 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 157 Score = 113 bits (283), Expect = 8e-26 Identities = 53/210 (25%), Positives = 87/210 (41%), Gaps = 55/210 (26%) Query: 13 ELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIF 72 E++++S Y AL++V+L + I AL+G NG+GKSTL +AI GL+ G I I Sbjct: 1 EIENLSFRYGGRT-ALDNVSLTLKAGEIVALVGPNGSGKSTLLRAIAGLLKPTSGEILID 59 Query: 73 NQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEAL 132 + + + E Sbjct: 60 GKDIAK-----------------------------------------------LPLEELR 72 Query: 133 ENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKS 192 +G + +LS GQ++RV LARAL ++++DEP + +D + ++ LL+ Sbjct: 73 RRIGY-------VPQLSGGQRQRVALARALLLNPDLLLLDEPTSGLDPASRERLLELLRE 125 Query: 193 LLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 L E +++ TH+ DR I LK Sbjct: 126 LAEEGRTVIIVTHDPELAELAADRVIVLKD 155 >gnl|CDD|31324 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 263 Score = 112 bits (282), Expect = 1e-25 Identities = 59/237 (24%), Positives = 121/237 (51%), Gaps = 17/237 (7%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +E++ ++ ++ L+ V+L +P I A++G +G+GKSTL + I+GL+ DKG I I Sbjct: 9 IEVRGVTKSF-GDRVILDGVDLDVPRGEILAILGGSGSGKSTLLRLILGLLRPDKGEILI 67 Query: 72 FNQTVENALKADL------IAYIPQTESIDWTFPILVEDV-VMMGRYKHMNWRRVASNND 124 + + + +L + + Q ++ ++ + E+V + + + + Sbjct: 68 DGEDIPQLSEEELYEIRKRMGVLFQQGAL-FSSLTVFENVAFPLREHTKLPESLI----- 121 Query: 125 YRIVTEALENVGMS-SMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTE 183 +V LE VG+ + ELS G +KRV LARA+A +++ +DEP + +D + Sbjct: 122 RELVLMKLELVGLRGAAADLYPSELSGGMRKRVALARAIALDPELLFLDEPTSGLDPISA 181 Query: 184 REMIFLLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLK-KTVLASGLTSDIFNEDN 238 + L++ L + + +++ TH+++S+ + DR L V+A G ++ D+ Sbjct: 182 GVIDELIRELNDALGLTVIMVTHDLDSLLTIADRVAVLADGKVIAEGTPEELLASDD 238 >gnl|CDD|73028 cd03269, ABC_putative_ATPase, This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity. In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs. Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 210 Score = 112 bits (281), Expect = 1e-25 Identities = 51/211 (24%), Positives = 107/211 (50%), Gaps = 8/211 (3%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 LE+++++ + AL+D++ + + I L+G NGAGK+T + I+G+I D G + Sbjct: 1 LEVENVTKRFGR-VTALDDISFSVEKGEIFGLLGPNGAGKTTTIRMILGIILPDSGEVLF 59 Query: 72 FNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEA 131 + ++ A + + I Y+P+ + ++ + +V + + K + D Sbjct: 60 DGKPLDIAAR-NRIGYLPEERGLYPKMKVI-DQLVYLAQLKGLKKEEARRRIDE-----W 112 Query: 132 LENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLK 191 LE + +S +++ ELS G Q++V A+ +++I+DEPF+ +D + +++ Sbjct: 113 LERLELSEYANKRVEELSKGNQQKVQFIAAVIHDPELLILDEPFSGLDPVNVELLKDVIR 172 Query: 192 SLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 L +++STH + + CDR + L K Sbjct: 173 ELARAGKTVILSTHQMELVEELCDRVLLLNK 203 >gnl|CDD|30759 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]. Length = 237 Score = 111 bits (280), Expect = 2e-25 Identities = 68/240 (28%), Positives = 117/240 (48%), Gaps = 17/240 (7%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 LE++++S Y AL V+L + I AL+G NGAGK+TL + IMGL+ G I Sbjct: 4 LEVENLSAGY-GKIQALRGVSLEVERGEIVALLGRNGAGKTTLLKTIMGLVRPRSGRIIF 62 Query: 72 FNQTVENALKADL----IAYIPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRVASNNDYR 126 + + + IAY+P+ I FP L VE+ +++G Y R R Sbjct: 63 DGEDITGLPPHERARLGIAYVPEGRRI---FPRLTVEENLLLGAY-----ARRDKEAQER 114 Query: 127 IVTEALENV-GMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTERE 185 + E E + R ++ G LS G+Q+ + +ARAL + +++++DEP + K E Sbjct: 115 DLEEVYELFPRLKERRNQRAGTLSGGEQQMLAIARALMSRPKLLLLDEPSEGLAPKIVEE 174 Query: 186 MIFLLKSLLNEDIM-ILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIFNEDNIQKTF 243 + +K L E M IL+ N DR L+ ++ SG +++ + ++++ + Sbjct: 175 IFEAIKELRKEGGMTILLVEQNARFALEIADRGYVLENGRIVLSGTAAELLADPDVREAY 234 >gnl|CDD|31316 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]. Length = 257 Score = 111 bits (278), Expect = 3e-25 Identities = 60/230 (26%), Positives = 104/230 (45%), Gaps = 15/230 (6%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +ELK++SV NG L D++ + A++G NGAGK+TL + G P G +++ Sbjct: 32 IELKNVSVRR-NGKKILGDLSWQVNPGEHWAIVGPNGAGKTTLLSLLTGEHPPSSGDVTL 90 Query: 72 FNQTVENALKADLIAYIPQT-----ESIDWTFP--ILVEDVVMMGRYKH-MNWRRVASNN 123 + K + I + + + F V DVV+ G + ++ + Sbjct: 91 LGRRF---GKGETIFELRKRIGLVSSELHERFRVRETVRDVVLSGFFASIGIYQEDLTAE 147 Query: 124 DYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTE 183 D LE +G + R G LS G+Q+RV +ARAL + +++I+DEP +D Sbjct: 148 DLAAAQWLLELLGAKHLADRPFGSLSQGEQRRVLIARALVKDPELLILDEPAQGLDLIAR 207 Query: 184 REMIFLLKSLL---NEDIMILVSTHNINSIPSFCDRTIFLKKTVLASGLT 230 +++ L+ L ++ V+ H P F R + + V+A G Sbjct: 208 EQLLNRLEELAASPGAPALLFVTHHAEEIPPCFTHRLLLKEGEVVAQGKL 257 >gnl|CDD|30793 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]. Length = 316 Score = 110 bits (277), Expect = 4e-25 Identities = 65/247 (26%), Positives = 112/247 (45%), Gaps = 26/247 (10%) Query: 12 LELKDISVTYPNGYC---ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGS 68 LE+K++SV++P A++ V+ + + I ++G +G+GKS L +AIMGL+P Sbjct: 2 LEVKNLSVSFPTDAGVVKAVDGVSFELKKGEILGIVGESGSGKSVLAKAIMGLLPKPNAR 61 Query: 69 IS----IFN--------QTVENALKADLIAYIPQ--TESIDWTFPILVEDVVMMGRYKHM 114 I +F+ + ++ IA I Q S++ I D + H Sbjct: 62 IVGGEILFDGKDLLSLSEKELRKIRGKEIAMIFQDPMTSLNPVMTI--GDQIAEVLRLHG 119 Query: 115 NWRRVASNNDYRIVTEALENVGMSSMRQRQI---GELSIGQQKRVFLARALAQKSQVIIM 171 E LE VG+ +R ELS G ++RV +A ALA +++I Sbjct: 120 KGLSKKE--AKERAIELLELVGIPDPERRLKSYPHELSGGMRQRVMIAMALALNPKLLIA 177 Query: 172 DEPFAAIDFKTEREMIFLLKSLLNEDIM-ILVSTHNINSIPSFCDRTIFLKK-TVLASGL 229 DEP A+D + +++ LLK L E +++ TH++ + DR + ++ G Sbjct: 178 DEPTTALDVTVQAQILDLLKELQREKGTALILITHDLGVVAEIADRVAVMYAGRIVEEGP 237 Query: 230 TSDIFNE 236 +IF Sbjct: 238 VEEIFKN 244 >gnl|CDD|33636 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only]. Length = 501 Score = 110 bits (277), Expect = 4e-25 Identities = 60/218 (27%), Positives = 112/218 (51%), Gaps = 12/218 (5%) Query: 11 GLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 LE++ I+ +P G A +DV+L + + I AL+G NGAGKSTL + + GL D G I Sbjct: 4 ALEMRGITKRFP-GVVANDDVSLSVKKGEIHALLGENGAGKSTLMKILFGLYQPDSGEIR 62 Query: 71 IFNQTVE-----NALKADLIAYIPQTESIDWTFPILVEDVVM-MGRYKHMNWRRVASNND 124 + + V +A++ I + Q + T + E++++ + K R + Sbjct: 63 VDGKEVRIKSPRDAIRLG-IGMVHQHFMLVPTLTVA-ENIILGLEPSKGGLIDRRQARAR 120 Query: 125 YRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTER 184 + E E G+ ++ +LS+G+Q+RV + +AL + ++++I+DEP A + + Sbjct: 121 ---IKELSERYGLPVDPDAKVADLSVGEQQRVEILKALYRGARLLILDEPTAVLTPQEAD 177 Query: 185 EMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 E+ +L+ L E I+ TH + + + DR L++ Sbjct: 178 ELFEILRRLAAEGKTIIFITHKLKEVMAIADRVTVLRR 215 Score = 67.5 bits (165), Expect = 4e-12 Identities = 51/217 (23%), Positives = 93/217 (42%), Gaps = 12/217 (5%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 LE++D+SV G A++DV+ + I + G+ G G+S L +AI GL G I + Sbjct: 258 LEVEDLSVKDRRGVTAVKDVSFEVRAGEIVGIAGVAGNGQSELVEAISGLRKPASGRILL 317 Query: 72 FNQTVENALKADL-----IAYIPQTESIDWTFPIL-VEDVVMMGRYK---HMNWRRVASN 122 + V L +AY+P+ L + + +++GR+ + Sbjct: 318 NGKDVLGRLSPRERRRLGLAYVPEDRHGHGLVLDLSLAENLVLGRHDKKPFSRGGFLDRR 377 Query: 123 NDYRIVTEALEN--VGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDF 180 + E +E V S LS G Q+++ LAR LA++ ++I +P +D Sbjct: 378 AIRKFARELIEEFDVRAPSPDAP-ARSLSGGNQQKLILARELARRPDLLIAAQPTRGLDV 436 Query: 181 KTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRT 217 + L L + +L+ + +++ I DR Sbjct: 437 GAIEFIHERLLELRDAGKAVLLISEDLDEILELSDRI 473 >gnl|CDD|73017 cd03258, ABC_MetN_methionine_transporter, MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport. Other members of this system include the MetP permease and the MetQ substrate binding protein. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 233 Score = 109 bits (273), Expect = 1e-24 Identities = 67/229 (29%), Positives = 112/229 (48%), Gaps = 5/229 (2%) Query: 12 LELKDISVTYPNGYC---ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGS 68 +ELK++S + + AL+DV+L +P+ I +IG +GAGKSTL + I GL GS Sbjct: 2 IELKNVSKVFGDTGGKVTALKDVSLSVPKGEIFGIIGRSGAGKSTLIRCINGLERPTSGS 61 Query: 69 ISIFNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIV 128 + + + +L + I F +L V + V V Sbjct: 62 VLVDGTDLTLLSGKELRKARRRIGMIFQHFNLLSSRTVFENVALPLEIAGVPKAEIEERV 121 Query: 129 TEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIF 188 E LE VG+ +LS GQ++RV +ARALA +V++ DE +A+D +T + ++ Sbjct: 122 LELLELVGLEDKADAYPAQLSGGQKQRVGIARALANNPKVLLCDEATSALDPETTQSILA 181 Query: 189 LLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIFN 235 LL+ + E + I++ TH + + CDR ++K V+ G ++F Sbjct: 182 LLRDINRELGLTIVLITHEMEVVKRICDRVAVMEKGEVVEEGTVEEVFA 230 >gnl|CDD|31323 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]. Length = 240 Score = 108 bits (272), Expect = 1e-24 Identities = 62/231 (26%), Positives = 117/231 (50%), Gaps = 13/231 (5%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +E+K++S ++ L+ ++L + + + +IG +G+GKSTL + + GL D GSI++ Sbjct: 3 IEIKNLSKSF-GDKEVLKGISLSVEKGEVVVIIGPSGSGKSTLLRCLNGLEEPDSGSITV 61 Query: 72 FNQTVENALKADL----IAYIPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRVASNNDYR 126 + V + + + Q ++ FP L V + V + K + + Sbjct: 62 DGEDVGDKKDILKLRRKVGMVFQQFNL---FPHLTVLENVTLAPVKVKKLSKAEAR---E 115 Query: 127 IVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREM 186 E LE VG++ +LS GQQ+RV +ARALA +V++ DEP +A+D + E+ Sbjct: 116 KALELLEKVGLADKADAYPAQLSGGQQQRVAIARALAMDPKVMLFDEPTSALDPELVGEV 175 Query: 187 IFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFL-KKTVLASGLTSDIFNE 236 + ++K L E + +++ TH + DR IF+ + ++ G + F+ Sbjct: 176 LDVMKDLAEEGMTMIIVTHEMGFAREVADRVIFMDQGKIIEEGPPEEFFDN 226 >gnl|CDD|34199 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]. Length = 245 Score = 107 bits (269), Expect = 3e-24 Identities = 65/246 (26%), Positives = 115/246 (46%), Gaps = 28/246 (11%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 LE+ D++ +Y + A+ DV+ E IT L+G NGAGK+TL + I L+ D G ++I Sbjct: 2 LEVTDLTKSYGSKVQAVRDVSFEAEEGEITGLLGENGAGKTTLLRMIATLLIPDSGKVTI 61 Query: 72 FNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHM----NWRRVASNNDY-R 126 D + + + +L + G Y + N + A N R Sbjct: 62 -----------DGVDTVRDPSFVRRKIGVLFGE---RGLYARLTARENLKYFARLNGLSR 107 Query: 127 IVTEA-----LENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFK 181 +A + + + R++GE S G +++V +ARAL ++++DEP + +D + Sbjct: 108 KEIKARIAELSKRLQLLEYLDRRVGEFSTGMKQKVAIARALVHDPSILVLDEPTSGLDIR 167 Query: 182 TEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIF---NED 237 T R+ +K L NE ++ S+H + + + CDR I L K V+ G + Sbjct: 168 TRRKFHDFIKQLKNEGRAVIFSSHIMQEVEALCDRVIVLHKGEVVLEGSIEALDARTVLR 227 Query: 238 NIQKTF 243 N+++ F Sbjct: 228 NLEEIF 233 >gnl|CDD|33900 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 352 Score = 107 bits (268), Expect = 4e-24 Identities = 64/223 (28%), Positives = 112/223 (50%), Gaps = 10/223 (4%) Query: 17 ISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTV 76 ++ G AL D N +P ITAL G +G+GK++L I GL D+G I + + + Sbjct: 4 LNFRQRLGNFAL-DANFTLPARGITALFGPSGSGKTSLINMIAGLTRPDEGRIELNGRVL 62 Query: 77 ENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYK-HMNWRRVASNNDYRIVTEALENV 135 +A K I P+ I + F +D + Y N R + + + + Sbjct: 63 VDAEKG--IFLPPEKRRIGYVF----QDARLFPHYTVRGNLRYGMWKSMRAQFDQLVALL 116 Query: 136 GMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLN 195 G+ + R G LS G+++RV + RAL ++++MDEP A++D +RE++ L+ L + Sbjct: 117 GIEHLLDRYPGTLSGGEKQRVAIGRALLTAPELLLMDEPLASLDLPRKREILPYLERLRD 176 Query: 196 E-DIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIFNE 236 E +I IL +H+++ + DR + L+ V ASG +++ Sbjct: 177 EINIPILYVSHSLDEVLRLADRVVVLENGKVKASGPLEEVWGS 219 >gnl|CDD|31322 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]. Length = 309 Score = 106 bits (266), Expect = 7e-24 Identities = 68/219 (31%), Positives = 107/219 (48%), Gaps = 17/219 (7%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +E +++S Y A++DVNL I E LIG +G+GK+T + I LI G I I Sbjct: 2 IEFENVSKRY-GNKKAVDDVNLTIEEGEFLVLIGPSGSGKTTTLKMINRLIEPTSGEILI 60 Query: 72 FNQTVENALKADL---IAYIPQTESIDWTFPILV--EDVVMMGRYKHMNWRRVASNNDYR 126 + + + +L I Y+ Q + FP L E++ + + + R+ + Sbjct: 61 DGEDISDLDPVELRRKIGYVIQQIGL---FPHLTVAENIATVPKLLGWDKERIK-----K 112 Query: 127 IVTEALENVGM--SSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTER 184 E L+ VG+ S R ELS GQQ+RV +ARALA +++MDEPF A+D T + Sbjct: 113 RADELLDLVGLDPSEYADRYPHELSGGQQQRVGVARALAADPPILLMDEPFGALDPITRK 172 Query: 185 EMIFLLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKK 222 ++ +K L E I+ TH+I+ DR + Sbjct: 173 QLQEEIKELQKELGKTIVFVTHDIDEALKLADRIAVMDA 211 >gnl|CDD|31315 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]. Length = 345 Score = 105 bits (264), Expect = 1e-23 Identities = 61/217 (28%), Positives = 107/217 (49%), Gaps = 12/217 (5%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 + + ++ + + AL+D++L I + AL+G +GAGKSTL + I GL D G I + Sbjct: 3 IRINNVKKRFGA-FGALDDISLDIKSGELVALLGPSGAGKSTLLRIIAGLETPDAGRIRL 61 Query: 72 FNQTVENALKADL----IAYIPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRVASNNDYR 126 + + + + + ++ Q ++ FP + V D + G R + Sbjct: 62 NGRVLFDVSNLAVRDRKVGFVFQHYAL---FPHMTVADNIAFGLKVR--KERPSEAEIRA 116 Query: 127 IVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREM 186 V E L V + + R +LS GQ++RV LARALA + +V+++DEPF A+D K +E+ Sbjct: 117 RVEELLRLVQLEGLADRYPAQLSGGQRQRVALARALAVEPKVLLLDEPFGALDAKVRKEL 176 Query: 187 IFLLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKK 222 L+ L + + + TH+ DR + L + Sbjct: 177 RRWLRKLHDRLGVTTVFVTHDQEEALELADRVVVLNQ 213 >gnl|CDD|31321 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]. Length = 252 Score = 105 bits (264), Expect = 1e-23 Identities = 57/222 (25%), Positives = 108/222 (48%), Gaps = 19/222 (8%) Query: 12 LELKDISVTYPNG---YCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGS 68 L ++++S+ Y G + AL +V+L I ++G +G+GKSTL + + GL GS Sbjct: 4 LSVRNLSIVYGGGKFAFHALNNVSLEIERGETLGIVGESGSGKSTLARLLAGLEKPSSGS 63 Query: 69 ISIFNQTVENALKADL----IAYIPQ--TESIDWTFPILVEDVVMMGRYKHMNWRRVASN 122 I + + + +A + + Q S++ V ++ R + Sbjct: 64 ILLDGKPLAPKKRAKAFYRPVQMVFQDPYSSLNPRRT--VGRILSEP------LRPHGLS 115 Query: 123 NDYRIVTEALENVGM-SSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFK 181 + + E L+ VG+ S R+ ELS GQ++R+ +ARAL + +++I+DEP +A+D Sbjct: 116 KSQQRIAELLDQVGLPPSFLDRRPHELSGGQRQRIAIARALIPEPKLLILDEPTSALDVS 175 Query: 182 TEREMIFLLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKK 222 + +++ LL L E + L +H++ + CDR + Sbjct: 176 VQAQILNLLLELKKERGLTYLFISHDLALVEHMCDRIAVMDN 217 >gnl|CDD|33903 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 300 Score = 103 bits (257), Expect = 8e-23 Identities = 56/217 (25%), Positives = 111/217 (51%), Gaps = 18/217 (8%) Query: 11 GLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 LE++ ++ ++ + A+++++ +P I L+G NGAGK+T F+ I+GL+ +G I+ Sbjct: 2 ALEIEGVTKSFGD-KKAVDNISFEVPPGEIFGLLGPNGAGKTTTFRMILGLLEPTEGEIT 60 Query: 71 IFNQTVENALKADLIAYIPQTESIDWTFP--ILVEDVVMMGRYKHMNWRRVASNNDYRIV 128 + +K + I Y+P+ + +P + + + + K M + Sbjct: 61 WNGGPLSQEIK-NRIGYLPEERGL---YPKMTVEDQLKYLAELKGMPKAEIQKKLQA--- 113 Query: 129 TEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAID-FKTE--RE 185 LE + + + ++I ELS G Q+++ A+ + +++I+DEPF+ +D E ++ Sbjct: 114 --WLERLEIVGKKTKKIKELSKGNQQKIQFISAVIHEPELLILDEPFSGLDPVNVELLKD 171 Query: 186 MIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 IF LK E I+ S+H + + CDR + LKK Sbjct: 172 AIFELK---EEGATIIFSSHRMEHVEELCDRLLMLKK 205 >gnl|CDD|73027 cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance. Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.. Length = 208 Score = 101 bits (254), Expect = 2e-22 Identities = 55/219 (25%), Positives = 106/219 (48%), Gaps = 20/219 (9%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 L+ D++ TY L+D++L + + I +G NGAGK+T + I+GLI D G I+ Sbjct: 1 LKTNDLTKTYGKKR-VLDDISLHVKKGEIYGFLGPNGAGKTTTMKIILGLIKPDSGEITF 59 Query: 72 FNQTVENALKA-----DLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYR 126 ++ + ++A LI P + + R +++ + Sbjct: 60 DGKSYQKNIEALRRIGALIEA-----------PGFYPN--LTAR-ENLRLLARLLGIRKK 105 Query: 127 IVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREM 186 + E L+ VG+ ++++ S+G ++R+ +A AL ++I+DEP +D +E+ Sbjct: 106 RIDEVLDVVGLKDSAKKKVKGFSLGMKQRLGIALALLGNPDLLILDEPTNGLDPDGIKEL 165 Query: 187 IFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKKTVL 225 L+ SL ++ I +L+S+H ++ I DR + K L Sbjct: 166 RELILSLRDQGITVLISSHLLSEIQKVADRIGIINKGKL 204 >gnl|CDD|73059 cd03300, ABC_PotA_N, PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D. PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 232 Score = 101 bits (253), Expect = 2e-22 Identities = 67/229 (29%), Positives = 112/229 (48%), Gaps = 12/229 (5%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +EL+++S Y G+ AL+ V+L I E L+G +G GK+TL + I G G I + Sbjct: 1 IELENVSKFY-GGFVALDGVSLDIKEGEFFTLLGPSGCGKTTLLRLIAGFETPTSGEILL 59 Query: 72 FNQTVENALKADL-IAYIPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRVASNNDYRIVT 129 + + N + + Q ++ FP L V + + G + +++ V Sbjct: 60 DGKDITNLPPHKRPVNTVFQNYAL---FPHLTVFENIAFG----LRLKKLPKAEIKERVA 112 Query: 130 EALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFL 189 EAL+ V + R+ +LS GQQ+RV +ARAL + +V+++DEP A+D K ++M Sbjct: 113 EALDLVQLEGYANRKPSQLSGGQQQRVAIARALVNEPKVLLLDEPLGALDLKLRKDMQLE 172 Query: 190 LKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIFNE 236 LK L E I + TH+ + DR + K + G +I+ E Sbjct: 173 LKRLQKELGITFVFVTHDQEEALTMSDRIAVMNKGKIQQIGTPEEIYEE 221 >gnl|CDD|73004 cd03245, ABCC_bacteriocin_exporters, ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2. A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.. Length = 220 Score = 101 bits (252), Expect = 3e-22 Identities = 70/228 (30%), Positives = 113/228 (49%), Gaps = 30/228 (13%) Query: 10 GGLELKDISVTYPNG-YCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGS 68 G +E +++S +YPN AL++V+L I A+IG G+GKSTL + + GL GS Sbjct: 1 GRIEFRNVSFSYPNQEIPALDNVSLTIRAGEKVAIIGRVGSGKSTLLKLLAGLYKPTSGS 60 Query: 69 ISIFNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDY 125 + + + ADL I Y+PQ ++ F + D + +G +D Sbjct: 61 VLLDGTDIRQLDPADLRRNIGYVPQDVTL---FYGTLRDNITLGA---------PLADDE 108 Query: 126 RIVTEALENVGMSSMRQR-------QIGE----LSIGQQKRVFLARALAQKSQVIIMDEP 174 RI+ A E G++ + QIGE LS GQ++ V LARAL ++++DEP Sbjct: 109 RIL-RAAELAGVTDFVNKHPNGLDLQIGERGRGLSGGQRQAVALARALLNDPPILLLDEP 167 Query: 175 FAAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 +A+D +E + L+ LL + +I++ TH S+ DR I + Sbjct: 168 TSAMDMNSEERLKERLRQLLGDKTLIII-THR-PSLLDLVDRIIVMDS 213 >gnl|CDD|73009 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.. Length = 204 Score = 100 bits (251), Expect = 4e-22 Identities = 63/228 (27%), Positives = 107/228 (46%), Gaps = 43/228 (18%) Query: 12 LELKDISVTYPNGYC----ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKG 67 + ++D S T+ +G L+D+NL +P+ + A++G G+GKS+L A++G + G Sbjct: 1 ISVEDASFTWDSGEQETSFTLKDINLEVPKGELVAIVGPVGSGKSSLLSALLGELEKLSG 60 Query: 68 SISIFNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRI 127 S+S+ IAY+ Q W + + ++ G+ Y Sbjct: 61 SVSVPGS----------IAYVSQEP---WIQNGTIRENILFGKPFDEER--------YEK 99 Query: 128 VTEA------LENVGMSSMRQRQIGE----LSIGQQKRVFLARALAQKSQVIIMDEPFAA 177 V +A LE + +IGE LS GQ++R+ LARA+ + + ++D+P +A Sbjct: 100 VIKACALEPDLEI--LPDGDLTEIGEKGINLSGGQKQRISLARAVYSDADIYLLDDPLSA 157 Query: 178 IDFKTEREMIF---LLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 +D R IF +L LLN ILV TH + +P D+ + L Sbjct: 158 VDAHVGRH-IFENCILGLLLNNKTRILV-THQLQLLPH-ADQIVVLDN 202 >gnl|CDD|73021 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively. Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP. HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM. The two HisP subunits form a homodimer within the complex. The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems. All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria. The best-studied member of the PAAT (polar amino acid transport) family is the HisJQMP system of S. typhimurium, where HisJ is the extracellular solute binding proteins and HisP is the ABC protein.. Length = 213 Score = 100 bits (251), Expect = 4e-22 Identities = 59/215 (27%), Positives = 108/215 (50%), Gaps = 13/215 (6%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +E+K++ ++ + L+ ++L + + + +IG +G+GKSTL + I L D G+I I Sbjct: 1 IEIKNLHKSF-GDFHVLKGIDLTVKKGEVVVIIGPSGSGKSTLLRCINLLEEPDSGTIII 59 Query: 72 FNQTVENALKADL-----IAYIPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRVASNNDY 125 + + K + + Q ++ FP L V + + + K + + Sbjct: 60 DGLKLTDDKKNINELRQKVGMVFQQFNL---FPHLTVLENITLAPIKVKGMSKAEAE--- 113 Query: 126 RIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTERE 185 E LE VG++ +LS GQQ+RV +ARALA +V++ DEP +A+D + E Sbjct: 114 ERALELLEKVGLADKADAYPAQLSGGQQQRVAIARALAMNPKVMLFDEPTSALDPELVGE 173 Query: 186 MIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFL 220 ++ ++K L E + ++V TH + DR IF+ Sbjct: 174 VLDVMKDLAEEGMTMVVVTHEMGFAREVADRVIFM 208 >gnl|CDD|73055 cd03296, ABC_CysA_sulfate_importer, Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 239 Score = 100 bits (250), Expect = 5e-22 Identities = 67/221 (30%), Positives = 113/221 (51%), Gaps = 19/221 (8%) Query: 11 GLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 +E++++S + + + AL+DV+L IP + AL+G +G+GK+TL + I GL D G+I Sbjct: 2 SIEVRNVSKRFGD-FVALDDVSLDIPSGELVALLGPSGSGKTTLLRLIAGLERPDSGTIL 60 Query: 71 IFNQTVENALKADLIAYIPQTESIDWTFP-------ILVEDVVMMG-RYKHMNWRRVASN 122 + D Q ++ + F + V D V G R K + R + Sbjct: 61 FGGE--------DATDVPVQERNVGFVFQHYALFRHMTVFDNVAFGLRVKPRSERPPEAE 112 Query: 123 NDYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKT 182 + V E L+ V + + R +LS GQ++RV LARALA + +V+++DEPF A+D K Sbjct: 113 IRAK-VHELLKLVQLDWLADRYPAQLSGGQRQRVALARALAVEPKVLLLDEPFGALDAKV 171 Query: 183 EREMIFLLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKK 222 +E+ L+ L +E + + TH+ DR + + K Sbjct: 172 RKELRRWLRRLHDELHVTTVFVTHDQEEALEVADRVVVMNK 212 >gnl|CDD|33915 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]. Length = 386 Score = 100 bits (249), Expect = 6e-22 Identities = 65/260 (25%), Positives = 111/260 (42%), Gaps = 34/260 (13%) Query: 27 ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADLIA 86 + D +L + E I ++GL+G+GKSTL + + LI +G I + + + A+L Sbjct: 43 GVNDASLDVEEGEIFVIMGLSGSGKSTLVRLLNRLIEPTRGEILVDGKDIAKLSAAELRE 102 Query: 87 YIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDY-------------RIVTEALE 133 + + I F + + R V N + EALE Sbjct: 103 L--RRKKISMVFQ----------SFALLPHRTVLENVAFGLEVQGVPKAEREERALEALE 150 Query: 134 NVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREM---IFLL 190 VG+ + ELS G Q+RV LARALA +++MDE F+A+D EM + L Sbjct: 151 LVGLEGYADKYPNELSGGMQQRVGLARALANDPDILLMDEAFSALDPLIRTEMQDELLEL 210 Query: 191 KSLLNEDIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIFNE--DNIQKTFGAQV 247 ++ L + I+ + TH+++ DR +K ++ G +I ++ + F V Sbjct: 211 QAKLKKTIVFI--THDLDEALRIGDRIAIMKDGEIVQVGTPEEILLNPANDYVRDFVRNV 268 Query: 248 SPQSSILNESNIQTTFKAEV 267 S +L +I + Sbjct: 269 DR-SRVLTAKDIMRRPDLLI 287 >gnl|CDD|73053 cd03294, ABC_Pro_Gly_Bertaine, This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 269 Score = 99.9 bits (249), Expect = 8e-22 Identities = 64/213 (30%), Positives = 100/213 (46%), Gaps = 3/213 (1%) Query: 27 ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADLIA 86 + DV+L + E I ++GL+G+GKSTL + I LI G + I Q + + +L Sbjct: 39 GVNDVSLDVREGEIFVIMGLSGSGKSTLLRCINRLIEPTSGKVLIDGQDIAAMSRKELRE 98 Query: 87 YIPQTESIDW-TFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSSMRQRQI 145 + S+ + +F +L V+ + + V EALE VG+ + Sbjct: 99 LRRKKISMVFQSFALLPHRTVLENVAFGLEVQGVPRAEREERAAEALELVGLEGWEHKYP 158 Query: 146 GELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNE-DIMILVST 204 ELS G Q+RV LARALA +++MDE F+A+D REM L L E I+ T Sbjct: 159 DELSGGMQQRVGLARALAVDPDILLMDEAFSALDPLIRREMQDELLRLQAELQKTIVFIT 218 Query: 205 HNINSIPSFCDRTIFLKK-TVLASGLTSDIFNE 236 H+++ DR +K ++ G +I Sbjct: 219 HDLDEALRLGDRIAIMKDGRLVQVGTPEEILTN 251 >gnl|CDD|72975 cd03216, ABC_Carb_Monos_I, This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos). The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. Pentoses include xylose, arabinose, and ribose. Important hexoses include glucose, galactose, and fructose. In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter.. Length = 163 Score = 99.0 bits (247), Expect = 1e-21 Identities = 47/211 (22%), Positives = 91/211 (43%), Gaps = 56/211 (26%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 LEL+ I+ + AL+ V+L + + AL+G NGAGKSTL + + GL D G I Sbjct: 1 LELRGITKRFGGVK-ALDGVSLSVRRGEVHALLGENGAGKSTLMKILSGLYKPDSGEI-- 57 Query: 72 FNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEA 131 ++ + V+ + +A Sbjct: 58 -----------------------------------------LVDGKEVSFAS----PRDA 72 Query: 132 LEN-VGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLL 190 + M + +LS+G+++ V +ARALA+ ++++I+DEP AA+ + ++ Sbjct: 73 RRAGIAM-------VYQLSVGERQMVEIARALARNARLLILDEPTAALTPAEVERLFKVI 125 Query: 191 KSLLNEDIMILVSTHNINSIPSFCDRTIFLK 221 + L + + ++ +H ++ + DR L+ Sbjct: 126 RRLRAQGVAVIFISHRLDEVFEIADRVTVLR 156 >gnl|CDD|30834 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]. Length = 530 Score = 99.2 bits (247), Expect = 1e-21 Identities = 53/216 (24%), Positives = 96/216 (44%), Gaps = 27/216 (12%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 LE +++S Y G L+D++ I A++G NGAGKSTL + + G + G++ + Sbjct: 322 LEFENVSKGYDGGRLLLKDLSFRIDRGDRIAIVGPNGAGKSTLLKLLAGELGPLSGTVKV 381 Query: 72 FNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEA 131 +TV+ I Y Q ++E++ + D + V Sbjct: 382 -GETVK-------IGYFDQHRDELDPDKTVLEEL-----------SEGFPDGDEQEVRAY 422 Query: 132 LENVGMSSMRQRQ-IGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLL 190 L G + Q + +G LS G++ R+ LA+ L Q ++++DEP +D E + L Sbjct: 423 LGRFGFTGEDQEKPVGVLSGGEKARLLLAKLLLQPPNLLLLDEPTNHLD----IESLEAL 478 Query: 191 KSLLNE--DIMILVSTHNINSIPSFCDRTIFLKKTV 224 + L + ++LVS H+ + R ++ V Sbjct: 479 EEALLDFEGTVLLVS-HDRYFLDRVATRIWLVEDKV 513 Score = 90.7 bits (225), Expect = 4e-19 Identities = 58/237 (24%), Positives = 99/237 (41%), Gaps = 45/237 (18%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 + L+++S+ Y LE+V+L + L+G NGAGKSTL + + G + D G ++ Sbjct: 4 ITLENLSLAYG-DRPLLENVSLTLNPGERIGLVGRNGAGKSTLLKILAGELEPDSGEVTR 62 Query: 72 FNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRR--------VASNN 123 K + Y+ Q +D +L D V+ G + +A + Sbjct: 63 --------PKGLRVGYLSQEPPLDPEKTVL--DYVIEGFGELRELLAELEEAYALLADPD 112 Query: 124 DYRI------------------VTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQK 165 D + EAL +G R + LS G ++RV LARAL ++ Sbjct: 113 DELLAELEALLEELDGWTLEARAEEALLGLGFPD-EDRPVSSLSGGWRRRVALARALLEE 171 Query: 166 SQVIIMDEPFAAIDFKTEREMIFLLKSLLN--EDIMILVSTHNINSIPSFCDRTIFL 220 ++++DEP +D E I L+ L +I+VS H+ + + + L Sbjct: 172 PDLLLLDEPTNHLD----LESIEWLEDYLKRYPGTVIVVS-HDRYFLDNVATHILEL 223 >gnl|CDD|33632 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]. Length = 231 Score = 98.1 bits (244), Expect = 3e-21 Identities = 66/232 (28%), Positives = 110/232 (47%), Gaps = 14/232 (6%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 L L D+ +Y G+ + +L +P I A++G +GAGKSTL I G G I I Sbjct: 2 LALDDVRFSY--GHLPMR-FDLTVPAGEIVAILGPSGAGKSTLLNLIAGFETPASGEILI 58 Query: 72 FNQTVENALKADL-IAYIPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRVASNNDYRIVT 129 + A+ ++ + Q ++ F L V + +G + V Sbjct: 59 NGVDHTASPPAERPVSMLFQENNL---FAHLTVAQNIGLGLSPGLKLNAE----QREKVE 111 Query: 130 EALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFL 189 A VG++ +R GELS GQ++RV LAR L ++ ++++DEPF+A+D EM+ L Sbjct: 112 AAAAQVGLAGFLKRLPGELSGGQRQRVALARCLVREQPILLLDEPFSALDPALRAEMLAL 171 Query: 190 LKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIFNEDNI 239 + L +E + +L+ TH+ DR +FL + A G T ++ + Sbjct: 172 VSQLCDERKMTLLMVTHHPEDAARIADRVVFLDNGRIAAQGSTQELLSGKAS 223 >gnl|CDD|32455 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]. Length = 709 Score = 97.6 bits (243), Expect = 3e-21 Identities = 61/228 (26%), Positives = 107/228 (46%), Gaps = 30/228 (13%) Query: 10 GGLELKDISVTY-PNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGS 68 G +E +++S Y P+ LED++L IP A++G +G+GKSTL + ++GL +G Sbjct: 470 GEIEFENVSFRYGPDDPPVLEDLSLEIPPGEKVAIVGRSGSGKSTLLKLLLGLYKPQQGR 529 Query: 69 ISIFNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDY 125 I + + + A L + Y+ Q D + N Sbjct: 530 ILLDGVDLNDIDLASLRRQVGYVLQ-------------DPFLFSGSIRENIALGNPEATD 576 Query: 126 RIVTEALENVG-------MSSMRQRQIGE----LSIGQQKRVFLARALAQKSQVIIMDEP 174 + EA + G + +GE LS GQ++R+ LARAL K +++++DE Sbjct: 577 EEIIEAAQLAGAHEFIENLPMGYDTPVGEGGANLSGGQRQRLALARALLSKPKILLLDEA 636 Query: 175 FAAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 +A+D +TE ++ L +L +I++ H +++I S DR I L + Sbjct: 637 TSALDPETEAIILQNLLQILQGRTVIII-AHRLSTIRS-ADRIIVLDQ 682 >gnl|CDD|32710 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning]. Length = 223 Score = 97.6 bits (243), Expect = 4e-21 Identities = 59/220 (26%), Positives = 103/220 (46%), Gaps = 18/220 (8%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 + +++S YP G AL DV+ IP+ L G +GAGKSTL + I G +G I + Sbjct: 2 IRFENVSKAYPGGREALRDVSFHIPKGEFVFLTGPSGAGKSTLLKLIYGEERPTRGKILV 61 Query: 72 FNQTVENALKADLIAYIPQTESIDWT-FPIL-----VEDVVMMGR---YKHMNWRRVASN 122 + LK I ++ + + + F +L E+V + R RR Sbjct: 62 NGHDLSR-LKGREIPFLRRQIGVVFQDFRLLPDRTVYENVALPLRVIGKPPREIRRR--- 117 Query: 123 NDYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKT 182 V+E L+ VG+ + +LS G+Q+RV +ARA+ + V++ DEP +D Sbjct: 118 -----VSEVLDLVGLKHKARALPSQLSGGEQQRVAIARAIVNQPAVLLADEPTGNLDPDL 172 Query: 183 EREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 E++ L + + +L++TH++ + R + L+ Sbjct: 173 SWEIMRLFEEINRLGTTVLMATHDLELVNRMRHRVLALED 212 >gnl|CDD|73054 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment. ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 242 Score = 97.2 bits (242), Expect = 4e-21 Identities = 63/225 (28%), Positives = 106/225 (47%), Gaps = 20/225 (8%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +E ++++ Y G A+ ++NL I + LIG +G+GK+T + I LI G I I Sbjct: 1 IEFENVTKRYGGGKKAVNNLNLEIAKGEFLVLIGPSGSGKTTTMKMINRLIEPTSGEIFI 60 Query: 72 FNQTVENALKADL---IAYIPQTESIDWTFP--ILVEDVVMMGRYKHMNWRRVASNNDYR 126 + + +L I Y+ Q + FP + E++ ++ + W + Sbjct: 61 DGEDIREQDPVELRRKIGYVIQQIGL---FPHMTVEENIALVPKLLK--WPKEKIR---E 112 Query: 127 IVTEALENVGM--SSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTER 184 E L VG+ + R ELS GQQ+RV +ARALA +++MDEPF A+D T Sbjct: 113 RADELLALVGLDPAEFADRYPHELSGGQQQRVGVARALAADPPLLLMDEPFGALDPITRD 172 Query: 185 EM---IFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKKTVLA 226 ++ L+ L + I+ + TH+I+ DR +K + Sbjct: 173 QLQEEFKRLQQELGKTIVFV--THDIDEAFRLADRIAIMKNGEIV 215 >gnl|CDD|35282 KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism, General function prediction only]. Length = 885 Score = 97.0 bits (241), Expect = 5e-21 Identities = 51/224 (22%), Positives = 95/224 (42%), Gaps = 11/224 (4%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 L L ++S Y A+ ++ +P L+G+NGAGK+T F+ + G G I Sbjct: 565 LVLNNLSKVYGGKDGAVRGLSFAVPPGECFGLLGVNGAGKTTTFKMLTGETKPTSGEALI 624 Query: 72 FNQTVENALKAD----LIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRI 127 + + + Y PQ +++ W E + R + + + S Sbjct: 625 KGHDITVSTDFQQVRKQLGYCPQFDAL-WEELTGREHLEFYARLRGLPRSDIGS-----A 678 Query: 128 VTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMI 187 + + L VG+ +Q+ S G ++R+ A AL VI++DEP +D K R + Sbjct: 679 IEKLLRLVGLGPYANKQVRTYSGGNKRRLSFAIALIGDPSVILLDEPSTGLDPKARRHLW 738 Query: 188 FLLKSLLNEDIMILVSTHNINSIPSFCDRT-IFLKKTVLASGLT 230 ++ L I++++H++ + C RT I + + G Sbjct: 739 DIIARLRKNGKAIILTSHSMEEAEALCTRTAIMVIGQLRCIGSP 782 >gnl|CDD|35277 KOG0054, KOG0054, KOG0054, Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1381 Score = 96.9 bits (241), Expect = 6e-21 Identities = 62/265 (23%), Positives = 114/265 (43%), Gaps = 35/265 (13%) Query: 27 ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADLIA 86 L+D+N I + + A++G G+GKS+L AI+G +P GS+++ +A Sbjct: 536 TLKDINFEIKKGQLVAVVGPVGSGKSSLLSAILGEMPKLSGSVAVNG----------SVA 585 Query: 87 YIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEAL----ENVGMSSMRQ 142 Y+PQ W V + ++ G + R Y V +A + + Sbjct: 586 YVPQQP---WIQNGTVRENILFG--SPYDEER------YDKVIKACALKKDLEILPFGDL 634 Query: 143 RQIGE----LSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIF--LLKSLLNE 196 +IGE LS GQ++R+ LARA+ Q + + ++D+P +A+D + IF ++ LL Sbjct: 635 TEIGERGINLSGGQKQRISLARAVYQDADIYLLDDPLSAVDAHVGKH-IFEECIRGLLRG 693 Query: 197 DIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIFNEDNIQKTFGAQVSPQSSILN 255 +ILV TH + +P D+ I LK ++ SG ++ + + Sbjct: 694 KTVILV-THQLQFLPH-ADQIIVLKDGKIVESGTYEELLKSGGDFAELAHEEESEQEEEA 751 Query: 256 ESNIQTTFKAEVYPQINSTMCIKKS 280 + ++ + S + Sbjct: 752 SEKDLESGESSRESESRSLESLSSE 776 Score = 88.4 bits (219), Expect = 2e-18 Identities = 63/237 (26%), Positives = 107/237 (45%), Gaps = 37/237 (15%) Query: 8 TKGGLELKDISVTY-PNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDK 66 +KG +E +D+S+ Y PN L+ ++ I ++G GAGKS+L A+ L+ + Sbjct: 1135 SKGEIEFEDLSLRYRPNLPLVLKGISFTIKPGEKVGIVGRTGAGKSSLILALFRLVEPAE 1194 Query: 67 GSISIFNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNN 123 G I I + DL ++ IPQ P+L V N + Sbjct: 1195 GEILIDGVDISKIGLHDLRSRLSIIPQD-------PVLFSGTV------RFNLDPFDEYS 1241 Query: 124 DYRIVTEALENVGMSSMRQRQIGEL-----------SIGQQKRVFLARALAQKSQVIIMD 172 D I EALE + + G L S+GQ++ + LARAL +KS+++++D Sbjct: 1242 DDEI-WEALERCQLKDVVSSLPGGLDSEVSEGGENFSVGQRQLLCLARALLRKSKILVLD 1300 Query: 173 EPFAAIDFKTEREMIFLLKSLLNE---DIMILVSTHNINSIPSFCDRTIFLKKTVLA 226 E A++D +T+ L++ + E D +L H +N++ DR + L + Sbjct: 1301 EATASVDPETDA----LIQKTIREEFKDCTVLTIAHRLNTVMD-SDRVLVLDAGRVV 1352 >gnl|CDD|31327 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]. Length = 567 Score = 95.9 bits (238), Expect = 1e-20 Identities = 58/235 (24%), Positives = 103/235 (43%), Gaps = 29/235 (12%) Query: 2 KTAVASTKGGLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGL 61 + T G +E +++S +YP L+D++ I A++G +G+GKSTL + ++ L Sbjct: 319 PDPLKDTIGSIEFENVSFSYPGKKPVLKDISFSIEPGEKVAIVGPSGSGKSTLIKLLLRL 378 Query: 62 IPLDKGSISIFNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRR 118 G I I + + L I + Q F + + + +GR + Sbjct: 379 YDPTSGEILIDGIDIRDISLDSLRKRIGIVSQD---PLLFSGTIRENIALGRPDATDEE- 434 Query: 119 VASNNDYRIVTEALENVGMSSMRQR-------QIGE----LSIGQQKRVFLARALAQKSQ 167 + EAL+ +GE LS GQ++R+ +ARAL + Sbjct: 435 ---------IEEALKLANAHEFIANLPDGYDTIVGERGVNLSGGQRQRLAIARALLRNPP 485 Query: 168 VIIMDEPFAAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 ++I+DE +A+D +TE + LK LL +++ H +++I DR I L Sbjct: 486 ILILDEATSALDTETEALIQDALKKLLKGRTTLII-AHRLSTI-KNADRIIVLDN 538 >gnl|CDD|73051 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane. The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.. Length = 214 Score = 96.1 bits (239), Expect = 1e-20 Identities = 65/220 (29%), Positives = 105/220 (47%), Gaps = 18/220 (8%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +E +++ TYPNG AL+ +N+ I L+G +GAGKSTL + I G+I + Sbjct: 1 IEFINVTKTYPNGTAALDGINISISAGEFVFLVGPSGAGKSTLLKLIYKEELPTSGTIRV 60 Query: 72 FNQTVENALKADLIAYIPQTESIDWT-FPIL----VEDVVMMG----RYKHMNWRRVASN 122 Q V + L+ I Y+ + + + F +L V + V R+ Sbjct: 61 NGQDVSD-LRGRAIPYLRRKIGVVFQDFRLLPDRNVYENVAFALEVTGVPPREIRKR--- 116 Query: 123 NDYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKT 182 V ALE VG+S + ELS G+Q+RV +ARA+ ++I DEP +D T Sbjct: 117 -----VPAALELVGLSHKHRALPAELSGGEQQRVAIARAIVNSPTILIADEPTGNLDPDT 171 Query: 183 EREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 E++ LLK + ++V+TH + + R I L++ Sbjct: 172 TWEIMNLLKKINKAGTTVVVATHAKELVDTTRHRVIALER 211 >gnl|CDD|73178 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]. Length = 268 Score = 96.1 bits (239), Expect = 1e-20 Identities = 59/236 (25%), Positives = 99/236 (41%), Gaps = 51/236 (21%) Query: 12 LELKDISVTYPNGY--------CALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIP 63 LE+K++ +P G A++ V+ I E L+G +G GKSTL + I+GL Sbjct: 5 LEVKNLKKYFPVGKGFGKKRYVKAVDGVSFSIKEGETLGLVGESGCGKSTLGRLILGLEE 64 Query: 64 LDKGSISIFNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNN 123 G I + + K + Sbjct: 65 PTSGEILFEGKDITKLSKEERR-------------------------------------- 86 Query: 124 DYRIVTEALENVGMS-SMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKT 182 V E LE VG+ R ELS GQ++R+ +ARALA ++I+ DEP +A+D Sbjct: 87 --ERVLELLEKVGLPEEFLYRYPHELSGGQRQRIGIARALALNPKLIVADEPVSALDVSV 144 Query: 183 EREMIFLLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIFNE 236 + +++ LLK L E + L +H+++ + DR + ++ G T ++F+ Sbjct: 145 QAQILNLLKDLQEELGLTYLFISHDLSVVRYISDRIAVMYLGKIVEIGPTEEVFSN 200 >gnl|CDD|73025 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.. Length = 218 Score = 95.3 bits (237), Expect = 1e-20 Identities = 49/207 (23%), Positives = 96/207 (46%), Gaps = 13/207 (6%) Query: 27 ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFN-QTVENALKADL- 84 A++ V+ + +T L+G NGAGK+T + + GL+ D G ++ V+ +A Sbjct: 20 AVDGVSFTVKPGEVTGLLGPNGAGKTTTLRMLAGLLEPDAGFATVDGFDVVKEPAEARRR 79 Query: 85 IAYIPQTESIDWTFPILV--EDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSSMRQ 142 + ++ + + + L E++ + + + + E + +GM + Sbjct: 80 LGFVSDSTGL---YDRLTARENLEYFAGLYGLKGDELTAR-----LEELADRLGMEELLD 131 Query: 143 RQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNEDIMILV 202 R++G S G +++V +ARAL V+++DEP +D R + ++ L IL Sbjct: 132 RRVGGFSTGMRQKVAIARALVHDPPVLLLDEPTTGLDVMATRALREFIRQLRALGKCILF 191 Query: 203 STHNINSIPSFCDRTIFLKK-TVLASG 228 STH + + CDR + L + V+ G Sbjct: 192 STHIMQEVERLCDRVVVLHRGRVVYEG 218 >gnl|CDD|34177 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 259 Score = 94.6 bits (235), Expect = 3e-20 Identities = 65/212 (30%), Positives = 104/212 (49%), Gaps = 12/212 (5%) Query: 12 LELKDISVTYPN-GYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 L + +S++Y ALEDV+L I + ++G +G GK+TL I G + +GSI Sbjct: 4 LNVSHLSLSYEGKPRSALEDVSLTIASGELVVVLGPSGCGKTTLLNLIAGFVTPSRGSIQ 63 Query: 71 IFNQTVENALKADLIAYIPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRVASNNDYRIVT 129 + + +E + + Q E++ P L V D V G + R + I Sbjct: 64 LNGRRIEGPGAERGVVF--QNEAL---LPWLNVIDNVAFG----LQLRGIEKAQRREIAH 114 Query: 130 EALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFL 189 + L VG+ + I +LS G ++RV +ARALA + Q++++DEPF A+D T +M L Sbjct: 115 QMLALVGLEGAEHKYIWQLSGGMRQRVGIARALAVEPQLLLLDEPFGALDALTREQMQEL 174 Query: 190 LKSLLNE-DIMILVSTHNINSIPSFCDRTIFL 220 L L E +L+ TH+I R + L Sbjct: 175 LLDLWQETGKQVLLITHDIEEALFLATRLVVL 206 >gnl|CDD|73056 cd03297, ABC_ModC_molybdenum_transporter, ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 214 Score = 94.5 bits (235), Expect = 3e-20 Identities = 61/216 (28%), Positives = 106/216 (49%), Gaps = 35/216 (16%) Query: 30 DVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTV--ENALKADL--- 84 ++ + E T + G +GAGKSTL + I GL D G+I N TV ++ K +L Sbjct: 16 KIDFDLNEEV-TGIFGASGAGKSTLLRCIAGLEKPDGGTIV-LNGTVLFDSRKKINLPPQ 73 Query: 85 ---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWR-------RVASNNDYRI-VTEALE 133 I + Q ++ FP H+N R + N + RI V E L+ Sbjct: 74 QRKIGLVFQQYAL---FP-------------HLNVRENLAFGLKRKRNREDRISVDELLD 117 Query: 134 NVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSL 193 +G+ + R +LS G+++RV LARALA + +++++DEPF+A+D +++ LK + Sbjct: 118 LLGLDHLLNRYPAQLSGGEKQRVALARALAAQPELLLLDEPFSALDRALRLQLLPELKQI 177 Query: 194 LNE-DIMILVSTHNINSIPSFCDRTIFLKKTVLASG 228 +I ++ TH+++ DR + ++ L Sbjct: 178 KKNLNIPVIFVTHDLSEAEYLADRIVVMEDGRLQYI 213 >gnl|CDD|73058 cd03299, ABC_ModC_like, Archeal protein closely related to ModC. ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 235 Score = 93.0 bits (231), Expect = 8e-20 Identities = 63/229 (27%), Positives = 117/229 (51%), Gaps = 15/229 (6%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 L+++++S + L++V+L + ++G G+GKS L + I G I D G I + Sbjct: 1 LKVENLSKDWKE--FKLKNVSLEVERGDYFVILGPTGSGKSVLLETIAGFIKPDSGKILL 58 Query: 72 FNQTVENALKADL--IAYIPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRVASNNDYRIV 128 + + N L + I+Y+PQ ++ FP + V + G + R+V R V Sbjct: 59 NGKDITN-LPPEKRDISYVPQNYAL---FPHMTVYKNIAYG----LKKRKVDKKEIERKV 110 Query: 129 TEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIF 188 E E +G+ + R+ LS G+Q+RV +ARAL +++++DEPF+A+D +T+ ++ Sbjct: 111 LEIAEMLGIDHLLNRKPETLSGGEQQRVAIARALVVNPKILLLDEPFSALDVRTKEKLRE 170 Query: 189 LLKSLLNE-DIMILVSTHNINSIPSFCDRT-IFLKKTVLASGLTSDIFN 235 LK + E + +L TH+ + D+ I L ++ G ++F Sbjct: 171 ELKKIRKEFGVTVLHVTHDFEEAWALADKVAIMLNGKLIQVGKPEEVFK 219 >gnl|CDD|31314 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 253 Score = 92.9 bits (231), Expect = 9e-20 Identities = 72/248 (29%), Positives = 121/248 (48%), Gaps = 28/248 (11%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLD-----K 66 +E++D+++ Y AL+D+NL IP+N +TALIG +G GKSTL + + + L + Sbjct: 8 IEVRDLNLYY-GDKHALKDINLDIPKNKVTALIGPSGCGKSTLLRCLNRMNDLIPGARVE 66 Query: 67 GSISIFNQTVENALKADLIA---YIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNN 123 G + + + + K D++ + FP+ + D V G H + Sbjct: 67 GEVLLDGKNI-YDPKVDVVELRRRVGMVFQKPNPFPMSIYDNVAYGLRLH----GIKDKE 121 Query: 124 DYRIVTEALENVGMSSMRQRQIGE----LSIGQQKRVFLARALAQKSQVIIMDEPFAAID 179 IV +L+ + + ++ + LS GQQ+R+ +ARALA K +V++MDEP +A+D Sbjct: 122 LDEIVESSLKKAALWDEVKDRLHKSALGLSGGQQQRLCIARALAVKPEVLLMDEPTSALD 181 Query: 180 ----FKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIF 234 K E E+I LK + I++ THN+ D T F ++ G T IF Sbjct: 182 PISTLKIE-ELITELK----KKYTIVIVTHNMQQAARVSDYTAFFYLGELVEFGPTDKIF 236 Query: 235 NEDNIQKT 242 ++T Sbjct: 237 TNPKHKRT 244 >gnl|CDD|34291 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only]. Length = 249 Score = 90.7 bits (225), Expect = 4e-19 Identities = 62/243 (25%), Positives = 108/243 (44%), Gaps = 16/243 (6%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 L L +SV++ G+ AL D++ + + LIG NGAGK+TL I G +G + Sbjct: 6 LYLDGVSVSF-GGFKALNDLSFSVDPGELRVLIGPNGAGKTTLMDVITGKTRPQEGEVLF 64 Query: 72 FNQTVENALKADLIAYIP-----QTESIDWTFPIL-VEDVVMMGRYKHMNWRRV----AS 121 T L IA Q ++ F L V + + + + + Sbjct: 65 DGDTDLTKLPEHRIARAGIGRKFQKPTV---FENLTVRENLELALNRDKSVFASLFARLR 121 Query: 122 NNDYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFK 181 + R + E L +G+ R R LS GQ++ + + LAQ +++++DEP A + Sbjct: 122 AEERRRIDELLATIGLGDERDRLAALLSHGQKQWLEIGMLLAQDPKLLLLDEPVAGMTDA 181 Query: 182 TEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDR-TIFLKKTVLASGLTSDIFNEDNIQ 240 + LLKS L ILV H++ + D+ T+ + +VLA G ++ N+ + Sbjct: 182 ETEKTAELLKS-LAGKHSILVVEHDMGFVREIADKVTVLHEGSVLAEGSLDEVQNDPKVI 240 Query: 241 KTF 243 + + Sbjct: 241 EVY 243 >gnl|CDD|34592 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]. Length = 573 Score = 90.7 bits (225), Expect = 4e-19 Identities = 65/231 (28%), Positives = 111/231 (48%), Gaps = 30/231 (12%) Query: 5 VASTKGGLELKDISVTYPNG-YCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIP 63 A+T LEL+++S TYP AL++ NL + + A++G +G+GKSTL Q + G Sbjct: 330 TATTGQALELRNVSFTYPGQQTKALKNFNLTLAQGEKVAILGRSGSGKSTLLQLLAGAWD 389 Query: 64 LDKGSISIFNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVA 120 +GSI++ + + + L I+ + Q + F + D N R Sbjct: 390 PQQGSITLNGVEIASLDEQALRETISVLTQRVHL---FSGTLRD----------NLRLAN 436 Query: 121 SNNDYRIVTEALENVGMSSMRQ-------RQIGE----LSIGQQKRVFLARALAQKSQVI 169 + + AL+ VG+ + + +GE LS G+++R+ LARAL + + Sbjct: 437 PDASDEELWAALQQVGLEKLLESAPDGLNTWLGEGGRRLSGGERRRLALARALLHDAPLW 496 Query: 170 IMDEPFAAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFL 220 ++DEP +D TER+++ LL E +L+ TH + + DR I L Sbjct: 497 LLDEPTEGLDPITERQVLALLFEHA-EGKTLLMVTHRLRGL-ERMDRIIVL 545 >gnl|CDD|73060 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK. ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles. ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP. In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.. Length = 213 Score = 90.2 bits (224), Expect = 5e-19 Identities = 59/220 (26%), Positives = 103/220 (46%), Gaps = 17/220 (7%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +EL++++ + N AL+D+NL I + L+G +G GK+T + I GL G I I Sbjct: 1 VELENVTKRFGNVT-ALDDLNLDIADGEFVVLLGPSGCGKTTTLRMIAGLEEPTSGRIYI 59 Query: 72 FNQTVENALKADL-IAYIPQTESIDWTFPILVEDVVMMGRYKHMNW----RRVASNNDYR 126 + V + D IA + Q ++ +P M Y ++ + R+V + Sbjct: 60 GGRDVTDLPPKDRDIAMVFQNYAL---YP-------HMTVYDNIAFGLKLRKVPKDEIDE 109 Query: 127 IVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREM 186 V E E + + + R+ +LS GQ++RV L RA+ ++ +V +MDEP + +D K +M Sbjct: 110 RVREVAELLQIEHLLDRKPKQLSGGQRQRVALGRAIVREPKVFLMDEPLSNLDAKLRVQM 169 Query: 187 IFLLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKKTVL 225 LK L + TH+ + DR + + Sbjct: 170 RAELKRLQQRLGTTTIYVTHDQVEAMTMADRIAVMNDGQI 209 >gnl|CDD|33913 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]. Length = 534 Score = 90.3 bits (224), Expect = 5e-19 Identities = 66/246 (26%), Positives = 124/246 (50%), Gaps = 28/246 (11%) Query: 12 LELKDISVTYP----------NGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGL 61 LE++D+ V +P + A++ ++L + L+G +G+GKSTL A++ L Sbjct: 277 LEVEDLRVWFPIKGGFLRRTVDHLRAVDGISLTLRRGQTLGLVGESGSGKSTLGLALLRL 336 Query: 62 IPLDKGSISIFNQTVENALKADLIAYIPQTE--------SIDWTFPIL-VEDVVMMGRYK 112 IP +G I Q ++ + ++ + + S+ P + V ++ G Sbjct: 337 IP-SQGEIRFDGQDIDGLSRKEMRPLRRRMQVVFQDPYGSLS---PRMTVGQIIEEGLRV 392 Query: 113 HMNWRRVASNNDYRIVTEALENVGM-SSMRQRQIGELSIGQQKRVFLARALAQKSQVIIM 171 H + A+ D R V EALE VG+ + R R E S GQ++R+ +ARAL K ++I++ Sbjct: 393 H-EPKLSAAERDQR-VIEALEEVGLDPATRNRYPHEFSGGQRQRIAIARALILKPELILL 450 Query: 172 DEPFAAIDFKTEREMIFLLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKK-TVLASGL 229 DEP +A+D + +++ LL+ L + + L +H++ + + C R I ++ ++ G Sbjct: 451 DEPTSALDRSVQAQVLDLLRDLQQKHGLSYLFISHDLAVVRALCHRVIVMRDGKIVEQGP 510 Query: 230 TSDIFN 235 T +F Sbjct: 511 TEAVFA 516 Score = 79.9 bits (197), Expect = 8e-16 Identities = 67/248 (27%), Positives = 114/248 (45%), Gaps = 33/248 (13%) Query: 12 LELKDISVTYPNGYC---ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLD--- 65 L ++++SV + A++ ++ I AL+G +G+GKS +I+GL+P Sbjct: 7 LSIRNLSVAFHQEGGTVEAVKGISFDIEAGETLALVGESGSGKSVTALSILGLLPSPAAA 66 Query: 66 --KGSISIFNQTVE-------NALKADLIAYIPQT--ESIDWTFPI---LVEDVVMMGRY 111 GSI + + ++ + I I Q S++ I L E + + Sbjct: 67 HPSGSILFDGEDLLAASERQLRGVRGNKIGMIFQEPMTSLNPLHTIGKQLAEVLRLHRGL 126 Query: 112 KHMNWRRVASNNDYRIVTEALENVGMSSMRQRQIG---ELSIGQQKRVFLARALAQKSQV 168 R R + E LE VG+ +R ELS GQ++RV +A ALA + + Sbjct: 127 SRAAARA-------RAL-ELLELVGIPEPEKRLDAYPHELSGGQRQRVMIAMALANEPDL 178 Query: 169 IIMDEPFAAIDFKTEREMIFLLKSLLNEDIM-ILVSTHNINSIPSFCDRTIFLKK-TVLA 226 +I DEP A+D + +++ LLK L E M IL TH++ + F DR ++ ++ Sbjct: 179 LIADEPTTALDVTVQAQILDLLKELQAELGMAILFITHDLGIVRKFADRVYVMQHGEIVE 238 Query: 227 SGLTSDIF 234 +G T +F Sbjct: 239 TGTTETLF 246 >gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1228 Score = 89.5 bits (222), Expect = 9e-19 Identities = 56/251 (22%), Positives = 111/251 (44%), Gaps = 26/251 (10%) Query: 7 STKGGLELKDISVTYPN--GYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPL 64 S KG +E +++ +YP+ L+ V+L IP AL+G +G+GKSTL Q + Sbjct: 346 SIKGEIEFRNVCFSYPSRPDVKILKGVSLKIPSGQTVALVGPSGSGKSTLIQLLARFYDP 405 Query: 65 DKGSISIFNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNND 124 G + I + + N L + I F + + + G+ A+ + Sbjct: 406 TSGEVLIDGEDIRNLNLKWLRSQIGLVSQEPVLFATTIRENIRYGKPD-------ATREE 458 Query: 125 YRIVTEALENVGMSSMRQR-------QIGE----LSIGQQKRVFLARALAQKSQVIIMDE 173 + EA + + +GE LS GQ++R+ +ARAL + +++++DE Sbjct: 459 ---IEEAAKAANAHDFILKLPDGYDTLVGERGVQLSGGQKQRIAIARALVRNPKILLLDE 515 Query: 174 PFAAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSD 232 +A+D ++ER + L I+V H +++I + D+ +++ ++ G + Sbjct: 516 ATSALDAESERVVQEALDKASKGRTTIVV-AHRLSTIRN-ADKIAVMEEGKIVEQGTHDE 573 Query: 233 IFNEDNIQKTF 243 + I + Sbjct: 574 LIALGGIYSSL 584 Score = 54.4 bits (131), Expect = 3e-08 Identities = 48/196 (24%), Positives = 90/196 (45%), Gaps = 37/196 (18%) Query: 9 KGGLELKDISVTYPN--GYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDK 66 KG +E +++S YP L +++L I AL+G +G+GKST+ + D Sbjct: 985 KGDIEFRNVSFAYPTRPDVPVLNNLSLSIRAGQTVALVGPSGSGKSTVISLLERFYDPDA 1044 Query: 67 GSISIFNQTVENALKADL---IAYIPQTESIDWTFPIL----VEDVVMMGRYKHMNWRRV 119 G + I +++ L I + Q P+L + + + G Sbjct: 1045 GKVKIDGVDIKDLNLKWLRKQIGLVSQE-------PVLFNGTIRENIAYG-------SEE 1090 Query: 120 ASNNDYRIVTEALENVGM----SSMRQ---RQIGE----LSIGQQKRVFLARALAQKSQV 168 S + + EA + SS+ Q ++GE LS GQ++R+ +ARA+ + ++ Sbjct: 1091 VSEEE---IIEAAKLANAHNFISSLPQGYDTRVGERGVQLSGGQKQRIAIARAILRNPKI 1147 Query: 169 IIMDEPFAAIDFKTER 184 +++DE +A+D ++ER Sbjct: 1148 LLLDEATSALDSESER 1163 >gnl|CDD|73057 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP. Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 211 Score = 88.9 bits (220), Expect = 1e-18 Identities = 69/221 (31%), Positives = 106/221 (47%), Gaps = 14/221 (6%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 + L I +Y G + +L + ITA++G +G+GKSTL I G G + I Sbjct: 1 VRLDKIRFSY--GEQPM-HFDLTFAQGEITAIVGPSGSGKSTLLNLIAGFETPQSGRVLI 57 Query: 72 FNQTVENALKADL-IAYIPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRVASNNDYRIVT 129 V A AD ++ + Q ++ F L VE V +G + D + + Sbjct: 58 NGVDVTAAPPADRPVSMLFQENNL---FAHLTVEQNVGLGLSPGLKLTAE----DRQAIE 110 Query: 130 EALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFL 189 AL VG++ + +R GELS G+++RV LAR L + V+++DEPFAA+D EM+ L Sbjct: 111 VALARVGLAGLEKRLPGELSGGERQRVALARVLVRDKPVLLLDEPFAALDPALRAEMLDL 170 Query: 190 LKSLLNEDIM-ILVSTHNINSIPSFCDRTIFLKK-TVLASG 228 + L E M +L+ TH R +FL + A G Sbjct: 171 VLDLHAETKMTVLMVTHQPEDAKRLAQRVVFLDNGRIAAQG 211 >gnl|CDD|73003 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.. Length = 221 Score = 89.0 bits (221), Expect = 1e-18 Identities = 62/232 (26%), Positives = 108/232 (46%), Gaps = 31/232 (13%) Query: 10 GGLELKDISVTY-PNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGS 68 G +E K++S+ Y PN L++++ I ++G G+GKS+L A+ L+ L GS Sbjct: 1 GDIEFKNVSLRYRPNLPPVLKNISFSIKPGEKVGIVGRTGSGKSSLLLALFRLVELSSGS 60 Query: 69 ISIFNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDY 125 I I + DL I+ IPQ P+L + N +D Sbjct: 61 ILIDGVDISKIGLHDLRSRISIIPQD-------PVLFSGTI------RSNLDPFGEYSDE 107 Query: 126 RIVTEALENVGMSSMRQRQIGEL-----------SIGQQKRVFLARALAQKSQVIIMDEP 174 + +ALE VG+ + G L S+GQ++ + LARAL +KS+++++DE Sbjct: 108 ELW-QALERVGLKEFVESLPGGLDTVVEEGGENLSVGQRQLLCLARALLRKSKILVLDEA 166 Query: 175 FAAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKKTVLA 226 A++D +T+ + ++ D +L H +++I DR + L K + Sbjct: 167 TASVDPETDALIQKTIREAFK-DCTVLTIAHRLDTIID-SDRILVLDKGRVV 216 >gnl|CDD|73024 cd03265, ABC_DrrA, DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin. In addition to DrrA, the complex includes an integral membrane protein called DrrB. DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called P-glycoprotein. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 220 Score = 87.6 bits (217), Expect = 3e-18 Identities = 51/221 (23%), Positives = 97/221 (43%), Gaps = 14/221 (6%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +E++++ Y + A+ V+ + I L+G NGAGK+T + + L+ G ++ Sbjct: 1 IEVENLVKKY-GDFEAVRGVSFRVRRGEIFGLLGPNGAGKTTTIKMLTTLLKPTSGRATV 59 Query: 72 FNQTV--ENALKADLIAYIPQTESIDWTFPILV--EDVVMMGRYKHMNWRRVASNNDYRI 127 V E I + Q S+D L E++ + R + D Sbjct: 60 AGHDVVREPREVRRRIGIVFQDLSVD---DELTGWENLYIHARLYGVPGAERRERID--- 113 Query: 128 VTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMI 187 E L+ VG+ R + S G ++R+ +AR+L + +V+ +DEP +D +T + Sbjct: 114 --ELLDFVGLLEAADRLVKTYSGGMRRRLEIARSLVHRPEVLFLDEPTIGLDPQTRAHVW 171 Query: 188 FLLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKKTVLAS 227 ++ L E + IL++TH + CDR + + + Sbjct: 172 EYIEKLKEEFGMTILLTTHYMEEAEQLCDRVAIIDHGRIIA 212 >gnl|CDD|35280 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]. Length = 591 Score = 86.8 bits (215), Expect = 6e-18 Identities = 56/232 (24%), Positives = 108/232 (46%), Gaps = 30/232 (12%) Query: 5 VASTKGGLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPL 64 + G +E D+ +Y L+ V+ IP+ A++G NG+GKST+ + ++ Sbjct: 345 IELFGGSIEFDDVHFSYGPKRKVLKGVSFTIPKGEKVAIVGSNGSGKSTILRLLLRFFD- 403 Query: 65 DKGSISIFNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVAS 121 GSI I Q ++ L I +PQ + F + + G S Sbjct: 404 YSGSILIDGQDIKEVSLESLRQSIGVVPQDSVL---FNDTILYNIKYGN---------PS 451 Query: 122 NNDYRIVTEALENVGMSSM-------RQRQIGE----LSIGQQKRVFLARALAQKSQVII 170 +D +V + G+ + Q +GE LS G+++RV LARA + + +++ Sbjct: 452 ASDEEVVEAC-KRAGLHDVISRLPDGYQTLVGERGLMLSGGEKQRVSLARAFLKDAPILL 510 Query: 171 MDEPFAAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 +DE +A+D +TERE++ ++ +++ +I++ H ++ + D+ I L Sbjct: 511 LDEATSALDSETEREILDMIMDVMSGRTVIMI-VHRLDLLK-DFDKIIVLDN 560 >gnl|CDD|33889 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones]. Length = 209 Score = 85.7 bits (212), Expect = 1e-17 Identities = 55/217 (25%), Positives = 99/217 (45%), Gaps = 12/217 (5%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 LE +++S D++ + + G NGAGK+TL + + GL+ D G + Sbjct: 3 LEAENLSCER-GERTLFSDLSFTLNAGEALQITGPNGAGKTTLLRILAGLLRPDAGEVYW 61 Query: 72 FNQTVENALK--ADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVT 129 + ++N + + Y+ I L E++ W+R + + + Sbjct: 62 QGEPIQNVRESYHQALLYLGHQPGIKTELTAL-ENLHF--------WQRFHGSGNAATIW 112 Query: 130 EALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFL 189 EAL VG++ + +G+LS GQQ+RV LAR + + I+DEPF A+D + + L Sbjct: 113 EALAQVGLAGLEDLPVGQLSAGQQRRVALARLWLSPAPLWILDEPFTALDKEGVALLTAL 172 Query: 190 LKSLLNEDIMILVSTHNINSIPSFCDRTIFLKKTVLA 226 + + + ++L++TH I S R + L T Sbjct: 173 MAAHAAQGGIVLLTTHQPLPIASAQIRRLDLTATKAT 209 >gnl|CDD|33919 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 228 Score = 84.6 bits (209), Expect = 3e-17 Identities = 59/220 (26%), Positives = 98/220 (44%), Gaps = 16/220 (7%) Query: 12 LELKDISVTYPNG---YCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGS 68 +E+ +S T G L+ V L + A++G +G+GKSTL + GL G Sbjct: 7 IEVHHLSKTVGQGEGELSILKGVELVVKRGETVAIVGPSGSGKSTLLAVLAGLDDPSSGE 66 Query: 69 ISIFNQTVEN-------ALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVAS 121 + + Q + AL+A + ++ Q+ + L E+V + + R +S Sbjct: 67 VRLLGQPLHKLDEDARAALRARHVGFVFQSFHLIPNLTAL-ENVAL-----PLELRGESS 120 Query: 122 NNDYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFK 181 + LE VG+ +LS G+Q+RV LARA A + V+ DEP +D Sbjct: 121 ADSRAGAKALLEAVGLGKRLTHYPAQLSGGEQQRVALARAFAGRPDVLFADEPTGNLDRA 180 Query: 182 TEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLK 221 T ++ LL +L E LV + + + CDR + L+ Sbjct: 181 TGDKIADLLFALNRERGTTLVLVTHDPQLAARCDRQLRLR 220 >gnl|CDD|31298 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 263 Score = 84.5 bits (209), Expect = 3e-17 Identities = 62/223 (27%), Positives = 101/223 (45%), Gaps = 14/223 (6%) Query: 12 LELKDISVTYPNGYC----ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKG 67 + L + + T+ G AL ++L I E +IG NGAGKSTL AI G + G Sbjct: 2 ISLSNATKTFFKGTPLEKRALNGLSLEIAEGDFVTVIGSNGAGKSTLLNAIAGDLKPTSG 61 Query: 68 SISIFNQTVEN---ALKADLIAYIPQTESIDWTFPILV--EDVVMMGRYKHMNWRRVASN 122 I I V A +A+L+A + Q + + T P L E++ + A N Sbjct: 62 QILIDGVDVTKKSVAKRANLLARVFQ-DPLAGTAPELTIEENLALAESRGKKRGLSSALN 120 Query: 123 NDYRIVTEAL---ENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAID 179 R +G+ + +IG LS GQ++ + L A +++++DE AA+D Sbjct: 121 ERRRSSFRERLARLGLGLENRLSDRIGLLSGGQRQALSLLMATLHPPKILLLDEHTAALD 180 Query: 180 FKTEREMIFLLKSLLNED-IMILVSTHNINSIPSFCDRTIFLK 221 KT ++ L ++ E + L+ THN+ + +R I L Sbjct: 181 PKTAEFVMELTAKIVEEHKLTTLMVTHNMEDALDYGNRLIMLH 223 >gnl|CDD|73013 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP-binding protein. In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 229 Score = 82.9 bits (205), Expect = 8e-17 Identities = 53/227 (23%), Positives = 102/227 (44%), Gaps = 29/227 (12%) Query: 10 GGLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSI 69 G +E ++++ +Y L+D+N I A++G GAGK+TL +M KG I Sbjct: 1 GEIEFENVNFSYDEKKPVLKDINFSIKPGETVAIVGPTGAGKTTLINLLMRFYDPQKGQI 60 Query: 70 SIFNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYR 126 I + + + L I + Q + F + + + +GR N Sbjct: 61 LIDGIDIRDISRKSLRSMIGVVLQD---TFLFSGTIMENIRLGR----------PNATDE 107 Query: 127 IVTEALENVGMSSMRQR-------QIGE----LSIGQQKRVFLARALAQKSQVIIMDEPF 175 V EA + G + +GE LS G+++ + +ARA+ + +++I+DE Sbjct: 108 EVIEAAKEAGAHDFIMKLPNGYDTVLGENGGNLSQGERQLLAIARAMLRDPKILILDEAT 167 Query: 176 AAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 + ID +TE+ + L+ L+ I+++ H +++I D+ + L Sbjct: 168 SNIDTETEKLIQEALEKLMKGRTSIIIA-HRLSTI-KNADKILVLDD 212 >gnl|CDD|72979 cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.. Length = 224 Score = 82.5 bits (204), Expect = 1e-16 Identities = 48/201 (23%), Positives = 88/201 (43%), Gaps = 25/201 (12%) Query: 27 ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTV-----ENALK 81 AL+DV+ +P LIG NGAGKSTL + + G+ P D G++++ + Sbjct: 37 ALKDVSFEVPRGERIGLIGRNGAGKSTLLRLLAGIYPPDSGTVTVRGRVSSLLGLGGGFN 96 Query: 82 ADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSSMR 141 +L E++ + GR ++ + + D I L + Sbjct: 97 PELTGR---------------ENIYLNGRLLGLSRKEIDEKIDEIIEFSELGDFI----- 136 Query: 142 QRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNEDIMIL 201 + S G + R+ A A A + ++++DE A D + + L+ LL + ++ Sbjct: 137 DLPVKTYSSGMKARLAFAIATALEPDILLIDEVLAVGDAAFQEKCQRRLRELLKQGKTVI 196 Query: 202 VSTHNINSIPSFCDRTIFLKK 222 + +H+ +SI CDR + L+K Sbjct: 197 LVSHDPSSIKRLCDRALVLEK 217 >gnl|CDD|33894 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism]. Length = 248 Score = 82.4 bits (203), Expect = 1e-16 Identities = 55/217 (25%), Positives = 97/217 (44%), Gaps = 31/217 (14%) Query: 43 LIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADLI---AYIPQTESIDWTFP 99 L+G NGAGKSTL + G+ GSI Q +E +L AY+ Q ++ + P Sbjct: 30 LVGPNGAGKSTLLARMAGMTSG-SGSIQFAGQPLEAWSATELARHRAYLSQQQTPPFAMP 88 Query: 100 ILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENV----GMSSMRQRQIGELSIGQQKR 155 + W + + + TE L +V + R +LS G+ +R Sbjct: 89 V---------------WHYLTLHQPDKTRTELLNDVAGALALDDKLGRSTNQLSGGEWQR 133 Query: 156 VFLARALAQ-------KSQVIIMDEPFAAIDFKTEREMIFLLKSLLNEDIMILVSTHNIN 208 V LA + Q Q++++DEP ++D + + LL +L + + I++S+H++N Sbjct: 134 VRLAAVVLQITPDANPAGQLLLLDEPMNSLDVAQQSALDRLLSALCQQGLAIVMSSHDLN 193 Query: 209 SIPSFCDRTIFLKK-TVLASGLTSDIFNEDNIQKTFG 244 R LK+ +LASG ++ + + +G Sbjct: 194 HTLRHAHRAWLLKRGKLLASGRREEVLTPPVLAQAYG 230 >gnl|CDD|31329 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane]. Length = 249 Score = 82.6 bits (204), Expect = 1e-16 Identities = 44/210 (20%), Positives = 90/210 (42%), Gaps = 16/210 (7%) Query: 27 ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADLIA 86 AL+D++ I + +IG NGAGKSTL + I G+ G + + + L Sbjct: 42 ALKDISFEIYKGERVGIIGHNGAGKSTLLKLIAGIYKPTSGKVKVTGKVA--PLIELGAG 99 Query: 87 YIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSSMRQRQIG 146 + P+ E++ + G + R + V E +E + + + Sbjct: 100 FDPELTGR--------ENIYLRGLI--LGLTRKEID---EKVDEIIEFAELGDFIDQPVK 146 Query: 147 ELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNEDIMILVSTHN 206 S G R+ + A + ++++DE A D + + + L L+ ++ I++ +H+ Sbjct: 147 TYSSGMYARLAFSVATHVEPDILLLDEVLAVGDAAFQEKCLERLNELVEKNKTIVLVSHD 206 Query: 207 INSIPSFCDRTIFLKK-TVLASGLTSDIFN 235 + +I +CDR I+L+ + G ++ Sbjct: 207 LGAIKQYCDRAIWLEHGQIRMEGSPEEVIP 236 >gnl|CDD|30745 COG0396, SufC, ABC-type transport system involved in Fe-S cluster assembly, ATPase component [Posttranslational modification, protein turnover, chaperones]. Length = 251 Score = 82.1 bits (203), Expect = 1e-16 Identities = 51/215 (23%), Positives = 93/215 (43%), Gaps = 35/215 (16%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGL--IPLDKGSI 69 LE+KD+ V L+ VNL + E + A++G NG+GKSTL IMG + +G I Sbjct: 4 LEIKDLHVEVEGKKEILKGVNLTVKEGEVHAIMGPNGSGKSTLAYTIMGHPKYEVTEGEI 63 Query: 70 SIFNQTVENALKADLIAYIPQTES------IDWTFPILVEDVVMMGRYKHMNWRRVASNN 123 + I + E + + +P+ + V + ++ R A N Sbjct: 64 ---------LFDGEDILELSPDERARAGIFLAFQYPVEIPGV------TNSDFLRAAMNA 108 Query: 124 ----------DYRIVTEALENVGMS-SMRQRQIGE-LSIGQQKRVFLARALAQKSQVIIM 171 + + E E +G+ +R + E S G++KR + + L + ++ I+ Sbjct: 109 RRGARGILPEFIKELKEKAELLGLDEEFLERYVNEGFSGGEKKRNEILQLLLLEPKLAIL 168 Query: 172 DEPFAAIDFKTEREMIFLLKSLLNEDIMILVSTHN 206 DEP + +D + + + +L E +L+ TH Sbjct: 169 DEPDSGLDIDALKIVAEGINALREEGRGVLIITHY 203 >gnl|CDD|72993 cd03234, ABCG_White, The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors. The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan. The pigment precursors are encoded by the white, brown, and scarlet genes, respectively. Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan. However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes. Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in macrophages, hepatocytes, and intestinal mucosa cells. ABCG1 (ABC8), the human homolog of the Drosophila white gene is induced in monocyte-derived macrophages during cholesterol influx mediated by acetylated low-density lipoprotein. It is possible that human ABCG1 forms heterodimers with several heterologous partners.. Length = 226 Score = 81.4 bits (201), Expect = 2e-16 Identities = 50/212 (23%), Positives = 95/212 (44%), Gaps = 19/212 (8%) Query: 28 LEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDK---GSISIFNQTVENALKADL 84 L DV+L + + A++G +G+GK+TL AI G + G I Q + Sbjct: 23 LNDVSLHVESGQVMAILGSSGSGKTTLLDAISGRVEGGGTTSGQILFNGQPRKPDQFQKC 82 Query: 85 IAYIPQTESIDWTFPIL-VED-----VVMMGRYKHMNWRRVASNNDYRIVTEALENVGMS 138 +AY+ Q D P L V + ++ K + R R+ L ++ ++ Sbjct: 83 VAYVRQD---DILLPGLTVRETLTYTAILRLPRKSSDAIRKK-----RVEDVLLRDLALT 134 Query: 139 SMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNEDI 198 + + +S G+++RV +A L +V+I+DEP + +D T ++ L L + Sbjct: 135 RIGGNLVKGISGGERRRVSIAVQLLWDPKVLILDEPTSGLDSFTALNLVSTLSQLARRNR 194 Query: 199 MILVSTHNINS-IPSFCDRTIFLKK-TVLASG 228 +++++ H S + DR + L ++ SG Sbjct: 195 IVILTIHQPRSDLFRLFDRILLLSSGEIVYSG 226 >gnl|CDD|72972 cd03213, ABCG_EPDR, ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR). DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.. Length = 194 Score = 79.8 bits (197), Expect = 7e-16 Identities = 49/219 (22%), Positives = 92/219 (42%), Gaps = 43/219 (19%) Query: 12 LELKDISVTYPNGY-----CALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLI--PL 64 L ++++VT + L++V+ +TA++G +GAGKSTL A+ G Sbjct: 4 LSFRNLTVTVKSSPSKSGKQLLKNVSGKAKPGELTAIMGPSGAGKSTLLNALAGRRTGLG 63 Query: 65 DKGSISIFNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNND 124 G + I + ++ +I Y+PQ +D++ Sbjct: 64 VSGEVLINGRPLDKRSFRKIIGYVPQ------------DDILH----------------P 95 Query: 125 YRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTER 184 V E L M ++ LS G++KRV +A L ++ +DEP + +D + Sbjct: 96 TLTVRETL-------MFAAKLRGLSGGERKRVSIALELVSNPSLLFLDEPTSGLDSSSAL 148 Query: 185 EMIFLLKSLLNEDIMILVSTHNI-NSIPSFCDRTIFLKK 222 +++ LL+ L + I+ S H + I D+ + L + Sbjct: 149 QVMSLLRRLADTGRTIICSIHQPSSEIFELFDKLLLLSQ 187 >gnl|CDD|143798 pfam00005, ABC_tran, ABC transporter. ABC transporters for a large family of proteins responsible for translocation of a variety of compounds across biological membranes. ABC transporters are the largest family of proteins in many completely sequenced bacteria. ABC transporters are composed of two copies of this domain and two copies of a transmembrane domain pfam00664. These four domains may belong to a single polypeptide or belong in different polypeptide chains. Length = 119 Score = 80.1 bits (198), Expect = 7e-16 Identities = 40/132 (30%), Positives = 63/132 (47%), Gaps = 20/132 (15%) Query: 52 STLFQAIMGLIPLDKGSISIFNQTVENALKADL----IAYIPQTESIDWTFPIL-VEDVV 106 STL + I GL+ G+I + + + I + Q FP L V + + Sbjct: 1 STLLKLITGLLQPTSGTILLDGEDGTDLSSRKALRKRIGVVFQD---PQLFPELTVRENL 57 Query: 107 MMG-RYKHMNWRRVASNNDYRIVTEALENVGMSS-MRQRQIGELSIGQQKRVFLARALAQ 164 G R K + R EALE VG+ + + +G LS GQ++RV +ARAL + Sbjct: 58 FFGLRDKEADAR----------AEEALERVGLPDFLDRSPVGTLSGGQKQRVAIARALLK 107 Query: 165 KSQVIIMDEPFA 176 K +++++DEP A Sbjct: 108 KPKLLLLDEPTA 119 >gnl|CDD|73005 cd03246, ABCC_Protease_Secretion, This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain. They export degradative enzymes by using a type I protein secretion system and lack an N-terminal signal peptide, but contain a C-terminal secretion signal. The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP). For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli. The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior. HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels. The spectrum of transport substrates ranges from inorganic ions, nutrients such as amino acids, sugars, or peptides, hydrophobic drugs, to large polypeptides, such as HlyA.. Length = 173 Score = 78.7 bits (194), Expect = 2e-15 Identities = 51/215 (23%), Positives = 91/215 (42%), Gaps = 49/215 (22%) Query: 12 LELKDISVTYPNGYCA-LEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 LE++++S YP L +V+ I A+IG +G+GKSTL + I+GL+ G + Sbjct: 1 LEVENVSFRYPGAEPPVLRNVSFSIEPGESLAIIGPSGSGKSTLARLILGLLRPTSGRVR 60 Query: 71 IFNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRI 127 + + +L + Y+PQ + L + Sbjct: 61 LDGADISQWDPNELGDHVGYLPQDD-------ELFSGSIA-------------------- 93 Query: 128 VTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMI 187 EN+ LS GQ++R+ LARAL +++++DEP + +D + ER + Sbjct: 94 -----ENI------------LSGGQRQRLGLARALYGNPRILVLDEPNSHLDVEGERALN 136 Query: 188 FLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 + +L +V H ++ S DR + L+ Sbjct: 137 QAIAALKAAGATRIVIAHRPETLAS-ADRILVLED 170 >gnl|CDD|73026 cd03267, ABC_NatA_like, Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.. Length = 236 Score = 78.7 bits (194), Expect = 2e-15 Identities = 42/200 (21%), Positives = 86/200 (43%), Gaps = 10/200 (5%) Query: 27 ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQ---TVENALKAD 83 AL+ ++ I + I IG NGAGK+T + + GL+ G + + Sbjct: 36 ALKGISFTIEKGEIVGFIGPNGAGKTTTLKILSGLLQPTSGEVRVAGLVPWKRRKKFLRR 95 Query: 84 LIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSSMRQR 143 + Q + W P +++ ++ + R D ++E L+ + + Sbjct: 96 IGVVFGQKTQLWWDLP-VIDSFYLLAAIYDLPPARFKKRLDE--LSELLD---LEELLDT 149 Query: 144 QIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNE-DIMILV 202 + +LS+GQ+ R +A AL + +++ +DEP +D + + LK E +L+ Sbjct: 150 PVRQLSLGQRMRAEIAAALLHEPEILFLDEPTIGLDVVAQENIRNFLKEYNRERGTTVLL 209 Query: 203 STHNINSIPSFCDRTIFLKK 222 ++H + I + R + + K Sbjct: 210 TSHYMKDIEALARRVLVIDK 229 >gnl|CDD|72974 cd03215, ABC_Carb_Monos_II, This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos). The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter.. Length = 182 Score = 78.2 bits (193), Expect = 2e-15 Identities = 55/209 (26%), Positives = 93/209 (44%), Gaps = 44/209 (21%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 LE++ +SV A+ DV+ + I + GL G G++ L +A+ GL P G I++ Sbjct: 5 LEVRGLSVKG-----AVRDVSFEVRAGEIVGIAGLVGNGQTELAEALFGLRPPASGEITL 59 Query: 72 FNQTVENALKADL----IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRI 127 + V D IAY+P ED G ++ Sbjct: 60 DGKPVTRRSPRDAIRAGIAYVP-------------EDRKREGLVLDLSVA---------- 96 Query: 128 VTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMI 187 EN+ +SS+ LS G Q++V LAR LA+ +V+I+DEP +D + E+ Sbjct: 97 -----ENIALSSL-------LSGGNQQKVVLARWLARDPRVLILDEPTRGVDVGAKAEIY 144 Query: 188 FLLKSLLNEDIMILVSTHNINSIPSFCDR 216 L++ L + +L+ + ++ + CDR Sbjct: 145 RLIRELADAGKAVLLISSELDELLGLCDR 173 >gnl|CDD|73006 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicated in cytochrome bd biogenesis. The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes. CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space. In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.. Length = 178 Score = 77.9 bits (192), Expect = 3e-15 Identities = 53/213 (24%), Positives = 98/213 (46%), Gaps = 46/213 (21%) Query: 12 LELKDISVTYP-NGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 L + ++S +YP L++++L + + AL+G +G+GKSTL Q + G + +G I+ Sbjct: 1 LSINNVSFSYPEQEQQVLKNLSLELKQGEKIALLGRSGSGKSTLLQLLTGDLKPQQGEIT 60 Query: 71 IFNQTVENALKA--DLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIV 128 + V + KA LI+ + Q Y Sbjct: 61 LDGVPVSDLEKALSSLISVLNQRP--------------------------------YLFD 88 Query: 129 TEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIF 188 T N+G S G+++R+ LAR L Q + ++++DEP +D TER+++ Sbjct: 89 TTLRNNLGR---------RFSGGERQRLALARILLQDAPIVLLDEPTVGLDPITERQLLS 139 Query: 189 LLKSLLNEDIMILVSTHNINSIPSFCDRTIFLK 221 L+ +L + +I + TH++ I D+ +FL+ Sbjct: 140 LIFEVLKDKTLIWI-THHLTGIEHM-DKILFLE 170 >gnl|CDD|34224 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 325 Score = 77.2 bits (190), Expect = 5e-15 Identities = 52/232 (22%), Positives = 94/232 (40%), Gaps = 11/232 (4%) Query: 27 ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI---FNQTVENALKAD 83 A++D++ IP+ I +G NGAGKST + + GL+ G + + Sbjct: 39 AVQDISFEIPKGEIVGFLGANGAGKSTTLKMLTGLLLPTSGKVRVNGKDPFRRREEYLRS 98 Query: 84 LIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSSMRQR 143 + + Q + W P L + + ++ + A D E + + + Sbjct: 99 IGLVMGQKLQLWWDLPAL-DSLEVLKLIYEIPDDEFAERLD-----FLTEILDLEGFLKW 152 Query: 144 QIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKT-EREMIFLLKSLLNEDIMILV 202 + +LS+GQ+ R LA AL +V+ +DEP +D FL + +L+ Sbjct: 153 PVRKLSLGQRMRAELAAALLHPPKVLFLDEPTVGLDVNAQANIREFLKEYNEERQATVLL 212 Query: 203 STHNINSIPSFCDRTIFLKKTVLASGLTSDIFNED-NIQKTFGAQVSPQSSI 253 +TH + I + CDR + + + L T E K F ++ S+ Sbjct: 213 TTHIFDDIATLCDRVLLIDQGQLVFDGTLAQLQEQFGPYKEFSVELKQAKSL 264 >gnl|CDD|72990 cd03231, ABC_CcmA_heme_exporter, CcmA, the ATP-binding component of the bacterial CcmAB transporter. The CCM family is involved in bacterial cytochrome c biogenesis. Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH). CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH. The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.. Length = 201 Score = 77.3 bits (190), Expect = 5e-15 Identities = 45/180 (25%), Positives = 76/180 (42%), Gaps = 14/180 (7%) Query: 28 LEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALK--ADLI 85 ++ + + G NG+GK+TL + + GL P G + + ++ A + Sbjct: 16 FSGLSFTLAAGEALQVTGPNGSGKTTLLRILAGLSPPLAGRVLLNGGPLDFQRDSIARGL 75 Query: 86 AYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSSMRQRQI 145 Y+ I T +L N R +++ V EAL VG++ R + Sbjct: 76 LYLGHAPGIKTTLSVL------------ENLRFWHADHSDEQVEEALARVGLNGFEDRPV 123 Query: 146 GELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNEDIMILVSTH 205 +LS GQQ+RV LAR L + I+DEP A+D + M++++TH Sbjct: 124 AQLSAGQQRRVALARLLLSGRPLWILDEPTTALDKAGVARFAEAMAGHCARGGMVVLTTH 183 >gnl|CDD|35279 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism]. Length = 790 Score = 76.2 bits (187), Expect = 8e-15 Identities = 54/217 (24%), Positives = 106/217 (48%), Gaps = 28/217 (12%) Query: 8 TKGGLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKG 67 T+G +E +++ Y G L D++ + AL+G +GAGKST+ + + ++ G Sbjct: 534 TQGKIEFSNVTFAYDPGKPVLSDISFTVQPGKTVALVGPSGAGKSTIMRLLFRFFDVNSG 593 Query: 68 SISIFNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNND 124 SI+I Q + N ++ L I +PQ +L D ++ ++ + + +++N+ Sbjct: 594 SITIDGQDIRNVTQSSLRSSIGVVPQDT-------VLFNDTILY----NIRYAKPSASNE 642 Query: 125 YRIVTEALENVGMSSM-------RQRQIGE----LSIGQQKRVFLARALAQKSQVIIMDE 173 V A + + ++GE LS G+++RV +AR + + +I++DE Sbjct: 643 E--VYAAAKAAQIHDRILQFPEGYNTRVGERGLKLSGGEKQRVAIARTILKAPSIILLDE 700 Query: 174 PFAAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSI 210 +A+D TER + L L I+V+ H +++I Sbjct: 701 ATSALDTNTERAIQAALARLCANRTTIVVA-HRLSTI 736 >gnl|CDD|34241 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]. Length = 580 Score = 75.3 bits (185), Expect = 2e-14 Identities = 58/263 (22%), Positives = 110/263 (41%), Gaps = 32/263 (12%) Query: 9 KGGLELKDISVTYPNGYCA-LEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKG 67 +G L ++ ++ P L+ ++ + +IG +G+GKSTL + ++G+ P G Sbjct: 332 QGALSVERLTAAPPGQKKPILKGISFALQAGEALGIIGPSGSGKSTLARLLVGIWPPTSG 391 Query: 68 SISIFNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNND 124 S+ + + + L I Y+PQ DV + N R D Sbjct: 392 SVRLDGADLRQWDREQLGRHIGYLPQ-------------DVELFDGTIAENIARFGEEAD 438 Query: 125 YRIVTEALENVGMSSMRQRQ-------IGE----LSIGQQKRVFLARALAQKSQVIIMDE 173 V EA G+ + R IGE LS GQ++R+ LARAL ++++DE Sbjct: 439 PEKVIEAARLAGVHELILRLPQGYDTRIGEGGATLSGGQRQRIALARALYGDPFLVVLDE 498 Query: 174 PFAAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSD 232 P + +D + E + + + ++V H +++ S D+ + L+ + A G + Sbjct: 499 PNSNLDSEGEAALAAAILAAKARGGTVVVIAHRPSALAS-VDKILVLQDGRIAAFGPREE 557 Query: 233 IFNEDNIQKTFGAQVSPQSSILN 255 + + + Q P + + Sbjct: 558 VLA--KVLRPPPRQAKPGTVVAP 578 >gnl|CDD|73012 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transporter that is expressed in the mitochondria. Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 236 Score = 74.4 bits (183), Expect = 3e-14 Identities = 56/223 (25%), Positives = 105/223 (47%), Gaps = 25/223 (11%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +E ++++ Y G L+DV+ IP A++G +G+GKST+ + + + GSI I Sbjct: 1 IEFENVTFAYDPGRPVLKDVSFTIPAGKKVAIVGPSGSGKSTILRLLFRFYDVSSGSILI 60 Query: 72 FNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMG-RYKHMNWRRVASNNDYRI 127 Q + L I +PQ +L D + RY + A++ + Sbjct: 61 DGQDIREVTLDSLRRAIGVVPQDT-------VLFNDTIGYNIRYGRPD----ATDEEVIE 109 Query: 128 VTEAL----ENVGMSSMRQRQIGE----LSIGQQKRVFLARALAQKSQVIIMDEPFAAID 179 +A + + +GE LS G+++RV +ARA+ + ++++DE +A+D Sbjct: 110 AAKAAQIHDKIMRFPDGYDTIVGERGLKLSGGEKQRVAIARAILKNPPILLLDEATSALD 169 Query: 180 FKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 TERE+ L+ + I++ H +++I + D+ I LK Sbjct: 170 THTEREIQAALRDVSKGRTTIVI-AHRLSTIVN-ADKIIVLKD 210 >gnl|CDD|35284 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism]. Length = 613 Score = 74.3 bits (182), Expect = 3e-14 Identities = 50/233 (21%), Positives = 97/233 (41%), Gaps = 23/233 (9%) Query: 12 LELKDISVTYPNGYCA----LEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIP---L 64 L ++++++ L+ V+ + A++G +G+GK+TL A+ G + Sbjct: 26 LSFRNLTLSSKEKSKKTKTILKGVSGTAKPGELLAIMGPSGSGKTTLLNALAGRLNGGLK 85 Query: 65 DKGSISIFNQTVENALKADLIAYIPQTESIDWTFPIL-VEDVVMMGRYKHMNWRRVASNN 123 G I + + ++ + Y+ Q D P L V + + + S Sbjct: 86 LSGEILLNGRPRDSRSFRKISGYVQQD---DVLLPTLTVRETLRF--SALLRLPSSLSKE 140 Query: 124 DYR-IVTEALENVGMSSMRQRQIGE-----LSIGQQKRVFLARALAQKSQVIIMDEPFAA 177 + R V E + +G+ IG LS G++KRV +A L ++ +DEP + Sbjct: 141 EKRERVEEVISELGLEKCADTLIGNPGIRGLSGGERKRVSIALELLTDPSILFLDEPTSG 200 Query: 178 IDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKKTVLASGLT 230 +D + +++ LLK L ++ + H PS +F K +L+ G Sbjct: 201 LDSFSALQVVQLLKRLARSGRTVICTIHQ----PSSELFELFDKLLLLSEGEV 249 >gnl|CDD|33918 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]. Length = 604 Score = 74.1 bits (182), Expect = 4e-14 Identities = 50/202 (24%), Positives = 90/202 (44%), Gaps = 27/202 (13%) Query: 9 KGGLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGS 68 G+ L+++S+ P+G L ++N + + G +GAGK++L +A+ GL P G Sbjct: 390 DHGITLENLSLRTPDGQTLLSELNFEVRPGERLLITGESGAGKTSLLRALAGLWPWGSGR 449 Query: 69 ISIFNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKH-MNWRRVASNNDYRI 127 IS+ + ++PQ + G + + + A + Sbjct: 450 ISMPAD--------SALLFLPQRPYLPQ------------GTLREALCYPNAAPDFSDAE 489 Query: 128 VTEALENVGMSSMRQRQIGE------LSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFK 181 + L VG+ + +R E LS G+Q+R+ AR L K + + +DE +A+D + Sbjct: 490 LVAVLHKVGLGDLAERLDEEDRWDRVLSGGEQQRLAFARLLLHKPKWVFLDEATSALDEE 549 Query: 182 TEREMIFLLKSLLNEDIMILVS 203 TE + LLK L + +I V Sbjct: 550 TEDRLYQLLKEELPDATVISVG 571 >gnl|CDD|73061 cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length MRP-type transporter 1). NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters. Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.. Length = 207 Score = 73.8 bits (181), Expect = 5e-14 Identities = 52/218 (23%), Positives = 98/218 (44%), Gaps = 29/218 (13%) Query: 10 GGLELKDISVTY-PNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGS 68 G +E++++SV Y P+ L++V+ + ++G GAGKSTL A+ + ++G Sbjct: 5 GEIEVENLSVRYAPDLPPVLKNVSFKVKAGEKIGIVGRTGAGKSTLILALFRFLEAEEGK 64 Query: 69 ISIFNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDY 125 I I + DL + IPQ + + G + N +D Sbjct: 65 IEIDGIDISTIPLEDLRSSLTIIPQ------------DPTLFSGTIR-SNLDPFDEYSDE 111 Query: 126 RIVTEALENVGMSSMRQRQIGE-LSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTER 184 I ++R + G LS GQ++ + LARAL ++ +V+++DE A+ID+ T+ Sbjct: 112 EI---------YGALRVSEGGLNLSQGQRQLLCLARALLKRPRVLVLDEATASIDYATDA 162 Query: 185 EMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 + ++ + IL H + +I D+ + + Sbjct: 163 LIQKTIREEFT-NSTILTIAHRLRTIID-YDKILVMDA 198 >gnl|CDD|36145 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC superfamily) [General function prediction only]. Length = 614 Score = 73.1 bits (179), Expect = 7e-14 Identities = 54/228 (23%), Positives = 104/228 (45%), Gaps = 18/228 (7%) Query: 11 GLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 ++++ +S+++ G ++DV L + LIG NG+GKST +AI G I Sbjct: 75 DVKIESLSLSFH-GVELIKDVTLELNRGRRYGLIGPNGSGKSTFLRAIAGREVPIPEHID 133 Query: 71 I--FNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMN-----WRRVASNN 123 ++ +E + K + A + +T+ L ED+ K + + R+ + Sbjct: 134 FYLLSREIEPSEKQAVQAVVMETDHERKRLEYLAEDLAQACDDKEKDELDELYERLDEMD 193 Query: 124 ----DYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAID 179 + + +S M+ +++ +LS G + R LARAL QK ++++DEP +D Sbjct: 194 NDTFEAKAAKILHGLGFLSEMQDKKVKDLSGGWRMRAALARALFQKPDLLLLDEPTNHLD 253 Query: 180 FKTEREMIFLLKSLLNE--DIMILVSTHNINSIPSFCDRTIFLKKTVL 225 E I L+ L + I++++ +H+ + + C I L L Sbjct: 254 L----EAIVWLEEYLAKYDRIILVIVSHSQDFLNGVCTNIIHLDNKKL 297 Score = 71.9 bits (176), Expect = 2e-13 Identities = 47/200 (23%), Positives = 85/200 (42%), Gaps = 40/200 (20%) Query: 15 KDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS---- 70 +++S Y + + +N I ++ AL+G NGAGKSTL + I G + G +S Sbjct: 393 QNVSFGYSDNPMIYKKLNFGIDLDSRVALVGPNGAGKSTLLKLITGDLQPTIGMVSRHSH 452 Query: 71 ----IFNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYR 126 +NQ + L D S+++ P + + Sbjct: 453 NKLPRYNQHLAEQLDLDK-------SSLEFMMPKFPD------------------EKELE 487 Query: 127 IVTEALENVGMSS-MRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTERE 185 + L G++ + + +LS GQ++RV AR ++ ++++DEP +D +T Sbjct: 488 EMRSILGRFGLTGDAQVVPMSQLSDGQRRRVLFARLAVKQPHLLLLDEPTNHLDIET--- 544 Query: 186 MIFLLKSLLNE--DIMILVS 203 I L +NE ++LVS Sbjct: 545 -IDALAEAINEFPGGVVLVS 563 >gnl|CDD|73007 cd03248, ABCC_TAP, TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules. Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells. Subsequently, virus-infected or malignantly transformed cells can be eliminated. TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.. Length = 226 Score = 71.9 bits (176), Expect = 2e-13 Identities = 52/234 (22%), Positives = 103/234 (44%), Gaps = 39/234 (16%) Query: 9 KGGLELKDISVTYPN--GYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDK 66 KG ++ ++++ YP L+DV+ + +TAL+G +G+GKST+ + Sbjct: 9 KGIVKFQNVTFAYPTRPDTLVLQDVSFTLHPGEVTALVGPSGSGKSTVVALLENFYQPQG 68 Query: 67 GSISIFNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYR 126 G + + + + + L V ++G+ + R + N Y Sbjct: 69 GQVLLDGKPIS-----------------QYEHKYLHSKVSLVGQEPVLFARSLQDNIAYG 111 Query: 127 IVTEALENV--------------GMSSMRQRQIGE----LSIGQQKRVFLARALAQKSQV 168 + + + E V ++S ++GE LS GQ++RV +ARAL + QV Sbjct: 112 LQSCSFECVKEAAQKAHAHSFISELASGYDTEVGEKGSQLSGGQKQRVAIARALIRNPQV 171 Query: 169 IIMDEPFAAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 +I+DE +A+D ++E + + E +LV H ++++ D+ + L Sbjct: 172 LILDEATSALDAESE-QQVQQALYDWPERRTVLVIAHRLSTVER-ADQILVLDG 223 >gnl|CDD|72982 cd03223, ABCD_peroxisomal_ALDP, Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome. The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation. To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes. X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family. The disease is characterized by a striking and unpredictable variation in phenotypic expression. Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asymptomatic).. Length = 166 Score = 70.6 bits (173), Expect = 4e-13 Identities = 55/214 (25%), Positives = 93/214 (43%), Gaps = 53/214 (24%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +EL+++S+ P+G L+D++ I + G +G GKS+LF+A+ GL P G I + Sbjct: 1 IELENLSLATPDGRVLLKDLSFEIKPGDRLLITGPSGTGKSSLFRALAGLWPWGSGRIGM 60 Query: 72 FNQTVENALKADLIAYIPQTESIDWTFPI--LVEDVVMMGRYKHMNWRRVASNNDYRIVT 129 DL+ ++PQ P+ L E ++ Y W V Sbjct: 61 -------PEGEDLL-FLPQRP----YLPLGTLREQLI----YP---WDDV---------- 91 Query: 130 EALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFL 189 LS G+Q+R+ AR L K + + +DE +A+D ++E + L Sbjct: 92 ------------------LSGGEQQRLAFARLLLHKPKFVFLDEATSALDEESEDRLYQL 133 Query: 190 LKSLLNEDIMILVSTHNINSIPSFCDRTIFLKKT 223 LK L + ++S + S+ F DR + L Sbjct: 134 LKELG----ITVISVGHRPSLWKFHDRVLDLDGE 163 >gnl|CDD|73010 cd03251, ABCC_MsbA, MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 234 Score = 70.6 bits (173), Expect = 5e-13 Identities = 60/211 (28%), Positives = 96/211 (45%), Gaps = 23/211 (10%) Query: 12 LELKDISVTYPN-GYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 +E K+++ YP G L D++L IP AL+G +G+GKSTL I +D G I Sbjct: 1 VEFKNVTFRYPGDGPPVLRDISLDIPAGETVALVGPSGSGKSTLVNLIPRFYDVDSGRIL 60 Query: 71 IFNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTE 130 I V + A L I + F V + + GR A+ + V E Sbjct: 61 IDGHDVRDYTLASLRRQIGLVSQDVFLFNDTVAENIAYGR-------PGATREE---VEE 110 Query: 131 ALENVGMSSMRQR-------QIGE----LSIGQQKRVFLARALAQKSQVIIMDEPFAAID 179 A IGE LS GQ++R+ +ARAL + ++I+DE +A+D Sbjct: 111 AARAANAHEFIMELPEGYDTVIGERGVKLSGGQRQRIAIARALLKDPPILILDEATSALD 170 Query: 180 FKTEREMIFLLKSLLNEDIMILVSTHNINSI 210 ++ER + L+ L+ ++ V H +++I Sbjct: 171 TESERLVQAALERLM-KNRTTFVIAHRLSTI 200 >gnl|CDD|33907 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism]. Length = 242 Score = 70.4 bits (172), Expect = 5e-13 Identities = 53/240 (22%), Positives = 103/240 (42%), Gaps = 17/240 (7%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 ++L I+ Y + AL D+ L PE L+G +GAGKS+L + + L G+++I Sbjct: 3 IQLNGINCFY-GAHQALFDITLDCPEGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNI 61 Query: 72 FNQTVE----------NALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVAS 121 + L+ ++ Q W + E+++ ++ Sbjct: 62 AGNHFDFSKTPSDKAIRDLRRNVGMVFQQYNL--WPHLTVQENLIE----APCRVLGLSK 115 Query: 122 NNDYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFK 181 + + L+ + + R LS GQQ+RV +ARAL + QV++ DEP AA+D + Sbjct: 116 DQALARAEKLLKRLRLKPYADRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPE 175 Query: 182 TEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKKTVLASGLTSDIFNEDNIQK 241 +++ ++K L I ++ TH + R ++++ + + F E + Sbjct: 176 ITAQIVSIIKELAETGITQVIVTHEVEVARKTASRVVYMENGHIVEQGDASCFTEPQTEA 235 >gnl|CDD|73049 cd03290, ABCC_SUR1_N, The SUR domain 1. The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.. Length = 218 Score = 68.6 bits (167), Expect = 2e-12 Identities = 55/209 (26%), Positives = 101/209 (48%), Gaps = 28/209 (13%) Query: 20 TYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENA 79 ++ +G L ++N+ IP +T ++G G GKS+L AI+G + +G + N+ Sbjct: 9 SWGSGLATLSNINIRIPTGQLTMIVGQVGCGKSSLLLAILGEMQTLEGKVHWSNKNESEP 68 Query: 80 LKADL-------IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEAL 132 +AY Q W VE+ + G N +R Y+ VT+A Sbjct: 69 SFEATRSRNRYSVAYAAQKP---WLLNATVEENITFG--SPFNKQR------YKAVTDAC 117 Query: 133 E---NVGMSSM-RQRQIGE----LSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTER 184 ++ + Q +IGE LS GQ++R+ +ARAL Q + ++ +D+PF+A+D Sbjct: 118 SLQPDIDLLPFGDQTEIGERGINLSGGQRQRICVARALYQNTNIVFLDDPFSALDIHLSD 177 Query: 185 EMI--FLLKSLLNEDIMILVSTHNINSIP 211 ++ +LK L ++ +++ TH + +P Sbjct: 178 HLMQEGILKFLQDDKRTLVLVTHKLQYLP 206 >gnl|CDD|34242 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 223 Score = 67.3 bits (164), Expect = 4e-12 Identities = 50/201 (24%), Positives = 95/201 (47%), Gaps = 20/201 (9%) Query: 28 LEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADL--- 84 L +++L + A+ G +G GKSTL + + LI G++ + V + LK + Sbjct: 19 LNNISLSVRAGEFIAITGPSGCGKSTLLKIVASLISPTSGTLLFEGEDV-STLKPEAYRQ 77 Query: 85 -IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGM-SSMRQ 142 ++Y QT ++ F VED ++ W+ D + L + S+ Sbjct: 78 QVSYCAQTPAL---FGDTVEDNLI------FPWQIRNRRPDRAAALDLLARFALPDSILT 128 Query: 143 RQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTER---EMIFLLKSLLNEDIM 199 + I ELS G+++R+ L R L +++++DE +A+D +R EMI + + +++ Sbjct: 129 KNITELSGGEKQRIALIRNLQFMPKILLLDEITSALDESNKRNIEEMIH--RYVREQNVA 186 Query: 200 ILVSTHNINSIPSFCDRTIFL 220 +L TH+ + D+ I L Sbjct: 187 VLWITHDKDQAIRHADKVITL 207 >gnl|CDD|35283 KOG0060, KOG0060, KOG0060, Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism, General function prediction only]. Length = 659 Score = 66.5 bits (162), Expect = 9e-12 Identities = 45/194 (23%), Positives = 87/194 (44%), Gaps = 23/194 (11%) Query: 12 LELKDISVTYPN-GYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 +E +++S++ P G +E+++L +P + G +G GK++L + + GL P G + Sbjct: 434 IEFEEVSLSTPTNGDLLIENLSLEVPSGQNLLITGPSGCGKTSLLRVLGGLWPSTGGKL- 492 Query: 71 IFNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTE 130 + DL ++PQ + T L + V+ + + AS+ D + Sbjct: 493 ---TKPTDGGPKDLF-FLPQRPYM--TLGTLRDQVIYPLK-AEDMDSKSASDED---ILR 542 Query: 131 ALENVGMSSMRQRQIG-----------ELSIGQQKRVFLARALAQKSQVIIMDEPFAAID 179 LENV + + +R+ G LS G+Q+R+ AR K + I+DE +A+ Sbjct: 543 ILENVQLGHLLEREGGLDQQVDWDWMDVLSPGEQQRLAFARLFYHKPKFAILDECTSAVT 602 Query: 180 FKTEREMIFLLKSL 193 E + + + Sbjct: 603 EDVEGALYRKCREM 616 >gnl|CDD|34233 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]. Length = 256 Score = 66.1 bits (161), Expect = 1e-11 Identities = 66/266 (24%), Positives = 116/266 (43%), Gaps = 42/266 (15%) Query: 7 STKGGLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDK 66 + + LE++D+ Y + L+ V+L + ++IG +G+GKST + I L Sbjct: 2 AAENALEVEDLHKRY-GEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSA 60 Query: 67 GSISIFNQTVENALKAD----LIAYIP-QTESID------------WTFPILVEDVV--- 106 GSI + + + LK D L Q + + W+ ++E+V+ Sbjct: 61 GSIRVNGEEI--RLKRDKDGQLKPADKRQLQRLRTRLGMVFQHFNLWSHMTVLENVIEAP 118 Query: 107 --MMGRYKHMNWRRVASNNDYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQ 164 ++G K + Y L VG++ LS GQQ+RV +ARALA Sbjct: 119 VHVLGVSKA---EAIERAEKY------LAKVGIAEKADAYPAHLSGGQQQRVAIARALAM 169 Query: 165 KSQVIIMDEPFAAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKKTV 224 + +V++ DEP +A+D + E++ +++ L E ++V TH + IFL + Sbjct: 170 EPEVMLFDEPTSALDPELVGEVLKVMQDLAEEGRTMVVVTHEMGFARDVSSHVIFLHQGK 229 Query: 225 LASGLTSDIFNEDNIQKTFGAQVSPQ 250 I E ++ FG SP+ Sbjct: 230 --------IEEEGPPEQVFGNPQSPR 247 >gnl|CDD|33892 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 213 Score = 65.8 bits (160), Expect = 1e-11 Identities = 57/215 (26%), Positives = 97/215 (45%), Gaps = 27/215 (12%) Query: 10 GGLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSI 69 G L LK++S+ P G C L +VN I + I L+G +G GKSTL ++G + Sbjct: 1 GMLCLKNVSLRLP-GSCLLANVNFTIAKGEIVTLMGPSGCGKSTLLSWMIGALAGQ---- 55 Query: 70 SIFNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMN-WRRVA-------- 120 F+ T E L + +P + IL +D ++ + H++ + + Sbjct: 56 --FSCTGELWLNEQRLDMLPAAQR---QIGILFQDALL---FPHLSVGQNLLFALPATLK 107 Query: 121 SNNDYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDF 180 N ALE G+ + LS GQ+ RV L RAL + + +++DEPF+ +D Sbjct: 108 GNARRNAANAALERSGLDGAFHQDPATLSGGQRARVALLRALLAQPKALLLDEPFSRLDV 167 Query: 181 KTE---REMIFLLKSLLNEDIMILVSTHNINSIPS 212 R+ +F + I + TH++ +P+ Sbjct: 168 ALRDQFRQWVF--SEVRAAGIPTVQVTHDLQDVPA 200 >gnl|CDD|35281 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]. Length = 716 Score = 65.0 bits (158), Expect = 2e-11 Identities = 51/217 (23%), Positives = 95/217 (43%), Gaps = 28/217 (12%) Query: 9 KGGLELKDISVTYPN--GYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDK 66 +G +E +D+S YP L++++ I + AL+G +G+GKST+ ++ Sbjct: 463 QGVIEFEDVSFAYPTRPDVPVLKNLSFTIRPGEVVALVGPSGSGKSTIASLLLRFYDPTS 522 Query: 67 GSISIFNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNN 123 G I + + + L I + Q E V+ G + + + Sbjct: 523 GRILLDGVPISDINHKYLRRKIGLVGQ------------EPVLFSGSIRENIAYGLDNAT 570 Query: 124 DYRIVTEA-LENV-----GMSSMRQRQIGE----LSIGQQKRVFLARALAQKSQVIIMDE 173 D I A + N +GE LS GQ++R+ +ARAL + +V+I+DE Sbjct: 571 DEEIEAAAKMANAHEFITNFPDGYNTVVGEKGSQLSGGQKQRIAIARALLRNPRVLILDE 630 Query: 174 PFAAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSI 210 +A+D ++E + L L+ +LV H ++++ Sbjct: 631 ATSALDAESEYLVQEALDRLMQ-GRTVLVIAHRLSTV 666 >gnl|CDD|72976 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component. Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems. The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions. The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.. Length = 200 Score = 64.3 bits (157), Expect = 3e-11 Identities = 54/204 (26%), Positives = 86/204 (42%), Gaps = 50/204 (24%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGL--IPLDKGSI 69 LE+KD+ V+ G L+ VNL I + + AL+G NG+GKSTL + IMG + +G I Sbjct: 1 LEIKDLHVSV-GGKEILKGVNLTIKKGEVHALMGPNGSGKSTLAKTIMGHPKYEVTEGEI 59 Query: 70 SIFNQTVENALKADLIAYIPQTES------IDWTFPILVEDVVMMGRYKHMNWRRVASNN 123 K + I +P E + + +P + V N Sbjct: 60 ---------LFKGEDITDLPPEERARLGIFLAFQYPPEIPGV---------------KNA 95 Query: 124 DY-RIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKT 182 D+ R V N G S G++KR + + L + + I+DEP + +D Sbjct: 96 DFLRYV-----NEGFSG-----------GEKKRNEILQLLLLEPDLAILDEPDSGLDIDA 139 Query: 183 EREMIFLLKSLLNEDIMILVSTHN 206 R + ++ L E +L+ TH Sbjct: 140 LRLVAEVINKLREEGKSVLIITHY 163 >gnl|CDD|73008 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.. Length = 238 Score = 63.6 bits (155), Expect = 5e-11 Identities = 47/219 (21%), Positives = 98/219 (44%), Gaps = 15/219 (6%) Query: 12 LELKDISVTYPN--GYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSI 69 +E K++S YP+ L+ ++L IP AL+G +G GKST+ + G I Sbjct: 1 IEFKNVSFRYPSRPDVPILKGLSLTIPPGKTVALVGSSGCGKSTVVSLLERFYDPTSGEI 60 Query: 70 SIFNQTVEN-ALKA--DLIAYIPQTESIDWTFPILVEDVVMMGRYK---HMNWRRVASNN 123 + + + L+ I + Q + F + + + G+ N Sbjct: 61 LLDGVDIRDLNLRWLRSQIGLVSQEPVL---FDGTIAENIRYGKPDATDEEVEEAAKKAN 117 Query: 124 DYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTE 183 + + L + G ++ + +LS GQ++R+ +ARAL + +++++DE +A+D ++E Sbjct: 118 IHDFIMS-LPD-GYDTLVGERGSQLSGGQKQRIAIARALLRNPKILLLDEATSALDAESE 175 Query: 184 REMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 + + L + + +V H +++I D L+ Sbjct: 176 KLVQEALDRAM-KGRTTIVIAHRLSTI-RNADLIAVLQN 212 >gnl|CDD|72996 cd03237, ABC_RNaseL_inhibitor_domain2, The ATPase domain 2 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.. Length = 246 Score = 63.4 bits (154), Expect = 7e-11 Identities = 49/189 (25%), Positives = 87/189 (46%), Gaps = 28/189 (14%) Query: 35 IPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADLIAYIPQTESI 94 I E+ + ++G NG GK+T + + G++ D+G I I TV +Y PQ Sbjct: 22 ISESEVIGILGPNGIGKTTFIKMLAGVLKPDEGDIEIELDTV---------SYKPQYIKA 72 Query: 95 DWTFPILVEDVVM---MGRYKHMNWRRVASNNDYRIVTEALENVGMSSMRQRQIGELSIG 151 D + V D++ Y H ++ TE + + + + R++ ELS G Sbjct: 73 D--YEGTVRDLLSSITKDFYTHPYFK-----------TEIAKPLQIEQILDREVPELSGG 119 Query: 152 QQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMI--FLLKSLLNEDIMILVSTHNINS 209 + +RV +A L++ + + ++DEP A +D + +R M + + N + V H+I Sbjct: 120 ELQRVAIAACLSKDADIYLLDEPSAYLDVE-QRLMASKVIRRFAENNEKTAFVVEHDIIM 178 Query: 210 IPSFCDRTI 218 I DR I Sbjct: 179 IDYLADRLI 187 >gnl|CDD|32537 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only]. Length = 593 Score = 63.1 bits (153), Expect = 8e-11 Identities = 48/183 (26%), Positives = 81/183 (44%), Gaps = 16/183 (8%) Query: 27 ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADLIA 86 L ++NL I + A++G +GAGK+TL + I+G + K + A Sbjct: 398 VLRNLNLEIKPGDVVAVVGQSGAGKTTLLRMILGAQKGRGEEKYRPDSGKVEVPKNTVSA 457 Query: 87 YIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSS--MRQRQ 144 IP ++ ++E + R D E L G+S + +R+ Sbjct: 458 LIPGEYEPEFGEVTILEHL-----------RSKTG--DLNAAVEILNRAGLSDAVLYRRK 504 Query: 145 IGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNE-DIMILVS 203 ELS GQ++R LA+ LA++ V+++DE A +D T + + L E I ++V Sbjct: 505 FSELSTGQKERAKLAKLLAERPNVLLIDEFAAHLDELTAVRVARKISELAREAGITLIVV 564 Query: 204 THN 206 TH Sbjct: 565 THR 567 >gnl|CDD|33909 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]. Length = 267 Score = 62.7 bits (152), Expect = 1e-10 Identities = 57/237 (24%), Positives = 107/237 (45%), Gaps = 17/237 (7%) Query: 12 LELKDISVTY--------PNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIP 63 LE++++S T+ A++ V+ + E A+IG NG+GKSTL + + G+I Sbjct: 5 LEVRNLSKTFRYRTGLFRRQTVEAVKPVSFTLREGQTLAIIGENGSGKSTLAKMLAGMIE 64 Query: 64 LDKGSISIFNQTVEN---ALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVA 120 G I I + + + ++ I I Q + + + ++ + + Sbjct: 65 PTSGEILINDHPLHFGDYSFRSKRIRMIFQDPNTSLNPRLRIGQILDFPLRLNTDLEPEQ 124 Query: 121 SNNDYRIVTEALENVGM-SSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAID 179 + + E L VG+ L+ GQ++RV LARAL + ++II DE A++D Sbjct: 125 RR---KQIFETLRMVGLLPDHANYYPHMLAPGQKQRVALARALILRPKIIIADEALASLD 181 Query: 180 FKTEREMIFLLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKK-TVLASGLTSDIF 234 ++I L+ L + I + T +I I D+ + + + V+ G T+D+ Sbjct: 182 MSMRSQLINLMLELQEKQGISYIYVTQHIGMIKHISDQVLVMHEGEVVERGSTADVL 238 >gnl|CDD|35288 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1391 Score = 62.6 bits (152), Expect = 1e-10 Identities = 48/211 (22%), Positives = 86/211 (40%), Gaps = 27/211 (12%) Query: 28 LEDVNLFIPENTITALIGLNGAGKSTLFQAI-----MGLIPLDKGSISIFNQTVENALKA 82 L +V+ +TAL+G +GAGK+TL + G I +G I I + A Sbjct: 807 LNNVSGAFKPGVLTALMGESGAGKTTLLDVLAGRKTGGYI---EGDILISGFPKDQETFA 863 Query: 83 DLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNND----YRIVTEALENVGMS 138 + Y+ Q I ++ + + R+ Y V E +E + + Sbjct: 864 RVSGYVEQQ-------DIHSPELTVRESLRFSAALRLPKEVSDEEKYEYVEEVIELLELK 916 Query: 139 SMRQRQIGE----LSIGQQKRVFLARALAQKSQVII-MDEPFAAIDFKTEREMIFLLKSL 193 +G LS Q+KR+ + L I+ +DEP + +D + ++ L+ L Sbjct: 917 EYADALVGLPGSGLSTEQRKRLTIGVELVANPSSILFLDEPTSGLDSQAAAIVMRFLRKL 976 Query: 194 LNEDIMILVSTH--NINSIPSFCDRTIFLKK 222 + IL + H +I+ +F D + LK+ Sbjct: 977 ADTGQTILCTIHQPSIDIFEAF-DELLLLKR 1006 Score = 47.6 bits (113), Expect = 4e-06 Identities = 45/217 (20%), Positives = 84/217 (38%), Gaps = 25/217 (11%) Query: 28 LEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIP---LDKGSISIFNQTVENALKADL 84 L+D++ I +T ++G G+GK+TL +A+ G + G I+ ++ + Sbjct: 131 LKDISGIIKPGEMTLVLGPPGSGKTTLLKALAGKLDNFLKSSGEITYNGHDLKEFVPKKT 190 Query: 85 IAYIPQTESIDWTFPILV--EDVVMMGRYKHMNWRRVAS----NNDYRIVTEALENVGMS 138 +AY + D FP L E + R K R + L+ +G+ Sbjct: 191 VAYNSEQ---DVHFPELTVRETLDFAARCK-GPGSRYDEVSRREKLAAMTDYLLKILGLD 246 Query: 139 SMRQRQIGE-----LSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSL 193 +G +S G++KRV + L + ++ DE +D T ++I L+ L Sbjct: 247 HCADTLVGNDMVRGVSGGERKRVSIGEMLVGPASILFWDEITRGLDSSTAFQIIKALRQL 306 Query: 194 LNEDIMILVSTHNINSIPSFCDRTIFL--KKTVLASG 228 + + + SI L +L+ G Sbjct: 307 AH-----ITGATALVSILQPSPEIYDLFDDVILLSEG 338 >gnl|CDD|73011 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli. The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane. HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB. This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport. Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.. Length = 237 Score = 61.1 bits (148), Expect = 3e-10 Identities = 51/221 (23%), Positives = 109/221 (49%), Gaps = 20/221 (9%) Query: 12 LELKDISVTY-PNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 + + + Y P+G L++++L I + ++G +G+GKSTL + I + G + Sbjct: 1 ITFEHVRFRYKPDGPVILDNISLRIKPGEVVGIVGRSGSGKSTLTKLIQRFYVPENGRVL 60 Query: 71 IFNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRV------AS 121 + + A A L + + Q + F + D + + M+ RV A Sbjct: 61 VDGHDLALADPAWLRRQVGVVLQENVL---FNRSIRDNIALAD-PGMSMERVIEAAKLAG 116 Query: 122 NNDYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFK 181 +D+ ++E E G ++ Q LS GQ++R+ +ARAL +++I DE +A+D++ Sbjct: 117 AHDF--ISELPE--GYDTIVGEQGAGLSGGQRQRIAIARALIHNPRILIFDEATSALDYE 172 Query: 182 TEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKK 222 +E ++ + + +I+++ H ++++ + DR I ++K Sbjct: 173 SEHAIMRNMHDICAGRTVIIIA-HRLSTVKN-ADRIIVMEK 211 >gnl|CDD|35285 KOG0062, KOG0062, KOG0062, ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism, Translation, ribosomal structure and biogenesis]. Length = 582 Score = 58.4 bits (141), Expect = 2e-09 Identities = 46/179 (25%), Positives = 74/179 (41%), Gaps = 22/179 (12%) Query: 43 LIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADLIAYIPQTESIDWTFPILV 102 L+G NG GKSTL +AI G +S F+ VE ++ D + D Sbjct: 111 LVGRNGIGKSTLLRAIA------NGQVSGFH--VEQEVRGDDTEALQSVLESD----TER 158 Query: 103 EDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSS-MRQRQIGELSIGQQKRVFLARA 161 D + + I + L +G + M+ + LS G + R+ LARA Sbjct: 159 LDFLAEEKELLAGLTLEE------IYDKILAGLGFTPEMQLQPTKSLSGGWRMRLALARA 212 Query: 162 LAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFL 220 L K ++++DEP +D + +L L I L+ +H+ N + + C I L Sbjct: 213 LFAKPDLLLLDEPTNHLDV---VAVAWLENYLQTWKITSLIVSHDRNFLNTVCTDIIHL 268 Score = 49.5 bits (118), Expect = 9e-07 Identities = 45/206 (21%), Positives = 84/206 (40%), Gaps = 23/206 (11%) Query: 12 LELKDISVTY-PNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 L + ++ Y P+ Y + + L ++ + +G NG GKSTL + + G + +G + Sbjct: 363 LRISYVAFEYTPSEYQWRKQLGLDRESDSRISRVGENGDGKSTLLKILKGDLTPTRGIVG 422 Query: 71 IFNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTE 130 + L+ I Y Q +D+ V V M + + R Sbjct: 423 RHPR-----LR---IKYFAQHH-VDF-LDKNVNAVDFM-----EKSFPGKTEEEIR---R 464 Query: 131 ALENVGMSS-MRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFL 189 L + G+S + + I LS GQ+ RV A ++++DEP +D + + Sbjct: 465 HLGSFGLSGELALQSIASLSGGQKSRVAFAACTWNNPHLLVLDEPTNHLDRDSLGALAKA 524 Query: 190 LKSLLNEDIMILVSTHNINSIPSFCD 215 LK+ +++ +H+ I S C Sbjct: 525 LKNFNGGVVLV---SHDEEFISSLCK 547 >gnl|CDD|33911 COG4170, SapD, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]. Length = 330 Score = 58.5 bits (141), Expect = 2e-09 Identities = 55/234 (23%), Positives = 104/234 (44%), Gaps = 50/234 (21%) Query: 17 ISVTYPNGYC-ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGL------IPLDK--- 66 I G+ A++ V++ + E I L+G +G+GKS + +AI G+ + D+ Sbjct: 11 IEFKTSQGWVKAVDRVSMTLNEGEIRGLVGESGSGKSLIAKAICGVNKDNWRVTADRMRF 70 Query: 67 GSISIFNQTVENALK-----ADLIAYIPQT-------------ESI-DWTFPILVEDVVM 107 I + + K +I PQ+ ++I WT+ Sbjct: 71 DDIDLLRLSPRERRKLVGHNVSMIFQEPQSCLDPSERVGRQLIQNIPAWTYK-------- 122 Query: 108 MGRY-KHMNWRRVASNNDYRIVTEALENVGMSSMR---QRQIGELSIGQQKRVFLARALA 163 GR+ + WR+ R E L VG+ + + EL+ G+ ++V +A ALA Sbjct: 123 -GRWWQRFGWRK-------RRAIELLHRVGIKDHKDIMRSYPYELTEGECQKVMIAIALA 174 Query: 164 QKSQVIIMDEPFAAIDFKTEREMIFLLKSL-LNEDIMILVSTHNINSIPSFCDR 216 + +++I DEP +++ T+ ++ LL L N + IL+ +H++ I + D+ Sbjct: 175 NQPRLLIADEPTNSMEPTTQAQIFRLLSRLNQNSNTTILLISHDLQMISQWADK 228 >gnl|CDD|34240 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism]. Length = 546 Score = 58.4 bits (141), Expect = 2e-09 Identities = 52/199 (26%), Positives = 80/199 (40%), Gaps = 15/199 (7%) Query: 11 GLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 LEL+++ Y + + +NL I + LIG NG+GKSTL + GL G I Sbjct: 322 TLELRNVRFAYQDNAFHVGPINLTIKRGELVFLIGGNGSGKSTLAMLLTGLYQPQSGEIL 381 Query: 71 IFNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTE 130 + + V D S F L+ AS + Sbjct: 382 LDGKPVSAEQLEDYRKLFSAVFSDYHLFDQLL------------GPEGKASPQLIEKWLQ 429 Query: 131 ALENVGMSSMRQRQIG--ELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIF 188 LE +S+ + +LS GQ+KR+ L AL ++ ++++DE A D RE Sbjct: 430 RLELAHKTSLNDGRFSNLKLSTGQKKRLALLLALLEERDILVLDEWAADQDPAFRREFYQ 489 Query: 189 LLKSLLNE-DIMILVSTHN 206 +L LL E I +H+ Sbjct: 490 VLLPLLKEQGKTIFAISHD 508 >gnl|CDD|73048 cd03289, ABCC_CFTR2, The CFTR subfamily domain 2. The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.. Length = 275 Score = 57.7 bits (139), Expect = 4e-09 Identities = 66/287 (22%), Positives = 130/287 (45%), Gaps = 48/287 (16%) Query: 10 GGLELKDISVTYPN-GYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGS 68 G + +KD++ Y G LE+++ I L+G G+GKSTL A + L+ + G Sbjct: 1 GQMTVKDLTAKYTEGGNAVLENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNTE-GD 59 Query: 69 ISIFNQTVENALKADLIAY--IPQTESIDW--TFPILVEDVVMMGRYKHMNWRRVASNND 124 I I D +++ +P + W F ++ + V + N +D Sbjct: 60 IQI-----------DGVSWNSVPLQK---WRKAFGVIPQKVFIFSGTFRKNLDPYGKWSD 105 Query: 125 YRIVTEALENVGMSSMRQRQIGE-----------LSIGQQKRVFLARALAQKSQVIIMDE 173 I A E VG+ S+ ++ G+ LS G ++ + LAR++ K++++++DE Sbjct: 106 EEIWKVA-EEVGLKSVIEQFPGQLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDE 164 Query: 174 PFAAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKKTVLASGLTSDI 233 P A +D T + + LK D +++S H I ++ C R + +++ + + Sbjct: 165 PSAHLDPITYQVIRKTLKQAF-ADCTVILSEHRIEAMLE-CQRFLVIEE--------NKV 214 Query: 234 FNEDNIQKTFGAQVSPQSSILNESNIQTTFKAEVYPQINSTMCIKKS 280 D+IQK + S ++ I + + +++P+ NS+ +K Sbjct: 215 RQYDSIQKLLN-----EKSHFKQA-ISPSDRLKLFPRRNSSKSKRKP 255 >gnl|CDD|72980 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth. EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site. The reaction requires ATP hydrolysis. EF-3 contains two ATP nucleotide binding sequence (NBS) motifs. NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.. Length = 144 Score = 57.4 bits (139), Expect = 4e-09 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 9/79 (11%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71 +EL+++S TY L+D++L I L+G NGAGKSTL + I G + D+G ++ Sbjct: 1 IELENLSKTYGGKLL-LKDISLTINPGDRIGLVGRNGAGKSTLLKLIAGELEPDEGIVTW 59 Query: 72 FNQTVENALKADLIAYIPQ 90 + I Y Q Sbjct: 60 GSTVK--------IGYFEQ 70 Score = 45.1 bits (107), Expect = 2e-05 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 3/75 (4%) Query: 148 LSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNEDIMILVSTHNI 207 LS G++ R+ LA+ L + ++++DEP +D ++ + LK +ILVS H+ Sbjct: 71 LSGGEKMRLALAKLLLENPNLLLLDEPTNHLDLESIEALEEALKEY--PGTVILVS-HDR 127 Query: 208 NSIPSFCDRTIFLKK 222 + + I L+ Sbjct: 128 YFLDQVATKIIELED 142 >gnl|CDD|31438 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]. Length = 591 Score = 56.0 bits (135), Expect = 1e-08 Identities = 56/210 (26%), Positives = 100/210 (47%), Gaps = 29/210 (13%) Query: 16 DISVTYPNGYCALEDVNL-----FIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 D V YP+ D L I + + ++G NG GK+T + + G+I D+GS Sbjct: 340 DTLVEYPDLKKTYGDFKLEVEEGEIYDGEVIGILGPNGIGKTTFVKLLAGVIKPDEGSEE 399 Query: 71 IFNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTE 130 ++Y PQ S D + VED++ + R A + Y TE Sbjct: 400 DLK-----------VSYKPQYISPD--YDGTVEDLLR-------SAIRSAFGSSY-FKTE 438 Query: 131 ALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMI--F 188 ++ + + + +R + ELS G+ +RV +A AL++++ + ++DEP A +D + +R ++ Sbjct: 439 IVKPLNLEDLLERPVDELSGGELQRVAIAAALSREADLYLLDEPSAYLDVE-QRIIVAKV 497 Query: 189 LLKSLLNEDIMILVSTHNINSIPSFCDRTI 218 + + + N + LV H+I I DR I Sbjct: 498 IRRFIENNEKTALVVDHDIYMIDYVSDRLI 527 Score = 51.4 bits (123), Expect = 3e-07 Identities = 42/189 (22%), Positives = 81/189 (42%), Gaps = 21/189 (11%) Query: 32 NLFIPE-NTITALIGLNGAGKSTLFQAIMG-LIPLDKGSISIFNQTVENALKADLIAYIP 89 L P + ++G NG GKST + + G L P ++ + ++I Sbjct: 93 RLPTPRPGKVVGILGPNGIGKSTALKILAGELKP----NLGRYEDPPS---WDEVIKRFR 145 Query: 90 QTESIDWTFPILVED---VVMMGRYKHMNWRRVA--------SNNDYRIVTEALENVGMS 138 TE ++ F L E V +Y + + V ++ E +E +G+ Sbjct: 146 GTELQNY-FKKLYEGELRAVHKPQYVDLIPKVVKGKVGELLKKVDERGKFDEVVERLGLE 204 Query: 139 SMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNEDI 198 ++ R + ELS G+ +RV +A AL + + V DEP + +D + +++ L + Sbjct: 205 NVLDRDVSELSGGELQRVAIAAALLRDADVYFFDEPSSYLDIRQRLNAARVIRELAEDGK 264 Query: 199 MILVSTHNI 207 ++V H++ Sbjct: 265 YVIVVEHDL 273 >gnl|CDD|73050 cd03291, ABCC_CFTR1, The CFTR subfamily domain 1. The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.. Length = 282 Score = 56.2 bits (135), Expect = 1e-08 Identities = 38/160 (23%), Positives = 74/160 (46%), Gaps = 15/160 (9%) Query: 28 LEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADLIAY 87 L+++NL I + + A+ G G+GK++L I+G + +G I + I++ Sbjct: 53 LKNINLKIEKGEMLAITGSTGSGKTSLLMLILGELEPSEGKIK----------HSGRISF 102 Query: 88 IPQTESIDWTFPILVEDVVMMG-RYKHMNWRRVASNNDYRIVTEALENVGMSSMRQRQIG 146 Q W P +++ ++ G Y ++ V + + + I Sbjct: 103 SSQFS---WIMPGTIKENIIFGVSYDEYRYKSVVKACQLEEDITKFPEKDNTVLGEGGI- 158 Query: 147 ELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREM 186 LS GQ+ R+ LARA+ + + + ++D PF +D TE+E+ Sbjct: 159 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEKEI 198 >gnl|CDD|33864 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 258 Score = 55.7 bits (134), Expect = 1e-08 Identities = 57/255 (22%), Positives = 110/255 (43%), Gaps = 37/255 (14%) Query: 6 ASTKGGLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLD 65 K L + +S Y DV+ + + ++G +G+GK+TL + I G + D Sbjct: 1 MMDKPLLSVSGLSKLY-GPGKGCRDVSFDLYPGEVLGIVGESGSGKTTLLKCISGRLTPD 59 Query: 66 KGSISIFNQTVENALKADLIAYIPQTES-----IDWTF----PI------------LVED 104 G+++ + + DL + + E +W F P + E Sbjct: 60 AGTVTYRMRDGQPR---DLYT-MSEAERRRLLRTEWGFVHQNPRDGLRMQVSAGGNIGER 115 Query: 105 VVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSSMR-QRQIGELSIGQQKRVFLARALA 163 ++ +G + N R A + LE V + R S G Q+R+ +AR L Sbjct: 116 LMAIGARHYGNIRAEAQ--------DWLEEVEIDLDRIDDLPRTFSGGMQQRLQIARNLV 167 Query: 164 QKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNE-DIMILVSTHNINSIPSFCDRTIFLKK 222 + +++ MDEP +D + ++ LL+ L+ E + +++ TH++ DR + +K+ Sbjct: 168 TRPRLVFMDEPTGGLDVSVQARLLDLLRGLVRELGLAVVIVTHDLAVARLLADRLMVMKQ 227 Query: 223 -TVLASGLTSDIFNE 236 V+ SGLT + ++ Sbjct: 228 GQVVESGLTDRVLDD 242 >gnl|CDD|72991 cd03232, ABC_PDR_domain2, The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 192 Score = 54.8 bits (132), Expect = 2e-08 Identities = 51/201 (25%), Positives = 86/201 (42%), Gaps = 45/201 (22%) Query: 28 LEDVNLFIPENTITALIGLNGAGKSTLFQAI-----MGLIPLDKGSISIFNQTVENALKA 82 L +++ ++ T+TAL+G +GAGK+TL + G+I G I I + ++ Sbjct: 23 LNNISGYVKPGTLTALMGESGAGKTTLLDVLAGRKTAGVI---TGEILINGRPLDKNF-Q 78 Query: 83 DLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSSMRQ 142 Y+ Q D P L V EAL S++ Sbjct: 79 RSTGYVEQ---QDVHSPNLT-------------------------VREALR---FSAL-- 105 Query: 143 RQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNEDIMILV 202 + LS+ Q+KR+ + LA K ++ +DEP + +D + ++ LK L + IL Sbjct: 106 --LRGLSVEQRKRLTIGVELAAKPSILFLDEPTSGLDSQAAYNIVRFLKKLADSGQAILC 163 Query: 203 STHNIN-SIPSFCDRTIFLKK 222 + H + SI DR + LK+ Sbjct: 164 TIHQPSASIFEKFDRLLLLKR 184 >gnl|CDD|34862 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones]. Length = 497 Score = 54.5 bits (131), Expect = 3e-08 Identities = 49/208 (23%), Positives = 89/208 (42%), Gaps = 29/208 (13%) Query: 28 LEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADL--- 84 L ++ IP A++G +GAGKST+ + + ++ GSI+I Q + + + L Sbjct: 279 LNGISFTIPLGKTVAIVGESGAGKSTILRLLFRFYDVNSGSITIDGQDIRDVTQQSLRRA 338 Query: 85 IAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALEN---------- 134 I +PQ D V+ N + + V A E Sbjct: 339 IGIVPQ-------------DTVLFNDTIAYNIKYGRPDATAEEVGAAAEAAQIHDFIQSL 385 Query: 135 -VGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSL 193 G + + +LS G+++RV +AR + + ++I+DE +A+D TE+ + L+ Sbjct: 386 PEGYDTGVGERGLKLSGGEKQRVAIARTILKNPPILILDEATSALDTHTEQAIQAALR-E 444 Query: 194 LNEDIMILVSTHNINSIPSFCDRTIFLK 221 ++ LV H +++I D I L Sbjct: 445 VSAGRTTLVIAHRLSTIID-ADEIIVLD 471 >gnl|CDD|35287 KOG0064, KOG0064, KOG0064, Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism]. Length = 728 Score = 53.0 bits (127), Expect = 1e-07 Identities = 50/204 (24%), Positives = 90/204 (44%), Gaps = 26/204 (12%) Query: 11 GLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 G+ L++I V P G + + I + G NG GKS+LF+ + GL P+ G +S Sbjct: 481 GIILENIPVITPAGDVLVPKLTFQIEPGMHLLITGPNGCGKSSLFRILGGLWPVYNGLLS 540 Query: 71 IFNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTE 130 I I YIPQ + + L + ++ + M R+ ++ D + Sbjct: 541 IPRPNN--------IFYIPQRPYM--SGGTLRDQIIYPDSSEQMK-RKGYTDQDLEAI-- 587 Query: 131 ALENVGMSSMRQRQIG---------ELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFK 181 L+ V + + QR+ G LS G+++R+ +AR + + ++DE +A+ Sbjct: 588 -LDIVHLEHILQREGGWDAVRDWKDVLSGGEKQRMGMARMFYHRPKYALLDECTSAVSID 646 Query: 182 TEREMIFLLKSLLNEDIMILVSTH 205 E ++ K + I +L TH Sbjct: 647 VEGKIFQAAK---DAGISLLSITH 667 >gnl|CDD|73047 cd03288, ABCC_SUR2, The SUR domain 2. The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.. Length = 257 Score = 50.8 bits (121), Expect = 5e-07 Identities = 58/236 (24%), Positives = 101/236 (42%), Gaps = 42/236 (17%) Query: 10 GGLELKDISVTYPNGY-CALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGS 68 G +++ D+ V Y N L+ V +I + G G+GKS+L A ++ + G Sbjct: 18 GEIKIHDLCVRYENNLKPVLKHVKAYIKPGQKVGICGRTGSGKSSLSLAFFRMVDIFDGK 77 Query: 69 ISIFNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIV 128 I I I+ +P ++ I+++D ++ N D R+ Sbjct: 78 IVI---------DGIDISKLP-LHTLRSRLSIILQDPILFSGSIRFNLDPECKCTDDRL- 126 Query: 129 TEALENVGMSSMRQRQIGEL-----------SIGQQKRVFLARALAQKSQVIIMDEPFAA 177 EALE + +M + G L S+GQ++ LARA +KS ++IMDE A+ Sbjct: 127 WEALEIAQLKNMVKSLPGGLDAVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATAS 186 Query: 178 IDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLKKTVLASGLTSDI 233 ID TE ++L + +M +F DRT+ +++ L +D+ Sbjct: 187 IDMATE--------NILQKVVMT-----------AFADRTVVTIAHRVSTILDADL 223 >gnl|CDD|35286 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC superfamily [RNA processing and modification]. Length = 592 Score = 48.4 bits (115), Expect = 2e-06 Identities = 46/187 (24%), Positives = 83/187 (44%), Gaps = 34/187 (18%) Query: 40 ITALIGLNGAGKSTLFQAIMGLI---------PLDKGSI----------SIFNQTVENAL 80 + L+G NG GKST + + G P D I + F + +E+ L Sbjct: 102 VLGLVGTNGIGKSTALKILAGKQKPNLGRYDNPPDWQEILTYFRGSELQNYFTKILEDNL 161 Query: 81 KADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSSM 140 KA I + + +D P V+ V R ++ V + L+ ++++ Sbjct: 162 KA-----IIKPQYVD-QIPRAVKGTV------GSLLDRKDERDNKEEVCDQLD---LNNL 206 Query: 141 RQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNEDIMI 200 R++ +LS G+ +R +A QK+ V + DEP + +D K + ++SL+N D I Sbjct: 207 LDREVEQLSGGELQRFAIAMVCVQKADVYMFDEPSSYLDVKQRLKAAITIRSLINPDRYI 266 Query: 201 LVSTHNI 207 +V H++ Sbjct: 267 IVVEHDL 273 Score = 43.0 bits (101), Expect = 8e-05 Identities = 32/141 (22%), Positives = 63/141 (44%), Gaps = 22/141 (15%) Query: 40 ITALIGLNGAGKSTLFQAIMGLIPLDKGS-ISIFNQTVENALKADLIAYIPQTESIDWTF 98 I ++G NG GK+T + + G + D+G I + N ++Y PQ I Sbjct: 369 IIVMLGENGTGKTTFIRMLAGRLKPDEGGEIPVLN-----------VSYKPQK--ISPKR 415 Query: 99 PILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFL 158 V ++ + + V + ++ + + ++ +++ LS G+ +RV L Sbjct: 416 EGTVRQLLH-----TKIR---DAYMHPQFVNDVMKPLQIENIIDQEVQGLSGGELQRVAL 467 Query: 159 ARALAQKSQVIIMDEPFAAID 179 A L + + V ++DEP A +D Sbjct: 468 ALCLGKPADVYLIDEPSAYLD 488 >gnl|CDD|72995 cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domain 1 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.. Length = 255 Score = 46.8 bits (111), Expect = 7e-06 Identities = 41/180 (22%), Positives = 81/180 (45%), Gaps = 20/180 (11%) Query: 40 ITALIGLNGAGKSTLFQAIMG-LIPLDKGSISIFNQTVENALKADLIAYIPQTESIDWTF 98 + L+G NG GKST + + G L P + + +++ +E ++ F Sbjct: 28 VLGLVGPNGIGKSTALKILAGKLKP-------NLGKFDDPPDWDEILDEFRGSELQNY-F 79 Query: 99 PILVED---VVMMGRYKHMNWRRVASN--------NDYRIVTEALENVGMSSMRQRQIGE 147 L+E V++ +Y + + V ++ + E ++ + + + R I + Sbjct: 80 TKLLEGDVKVIVKPQYVDLIPKAVKGKVGELLKKKDERGKLDELVDQLELRHVLDRNIDQ 139 Query: 148 LSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNEDIMILVSTHNI 207 LS G+ +RV +A ALA+ + DEP + +D K L++ L +D +LV H++ Sbjct: 140 LSGGELQRVAIAAALARDADFYFFDEPSSYLDIKQRLNAARLIRELAEDDNYVLVVEHDL 199 >gnl|CDD|35289 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis]. Length = 807 Score = 46.2 bits (109), Expect = 1e-05 Identities = 44/180 (24%), Positives = 73/180 (40%), Gaps = 36/180 (20%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGS--- 68 L L D++ YP + ++ I ++ A++G NG GKSTL + ++G + + G Sbjct: 587 LGLHDVTFGYPGQKPLFKKLDFGIDMDSRIAIVGPNGVGKSTLLKLLIGKLDPNDGELRK 646 Query: 69 -----ISIFNQTVENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNN 123 I F+Q AL + E + F N Sbjct: 647 NHRLRIGWFDQHANEALNGEETP----VEYLQRKF-----------------------NL 679 Query: 124 DYRIVTEALENVGMSSMRQR-QIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKT 182 Y+ + L G++S +I +LS GQ+ RV LA V+I+DEP +D ++ Sbjct: 680 PYQEARKQLGTFGLASHAHTIKIKDLSGGQKARVALAELALGGPDVLILDEPTNNLDIES 739 Score = 33.9 bits (77), Expect = 0.046 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 4/90 (4%) Query: 132 LENVGMS-SMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLL 190 L +G S M++R + S G + RV LARAL + ++++DEP +D +I+L Sbjct: 396 LAGLGFSKEMQERPTTKFSGGWRMRVSLARALFLEPTLLMLDEPTNHLDLNA---VIWLD 452 Query: 191 KSLLNEDIMILVSTHNINSIPSFCDRTIFL 220 L +L+ +H+ + S C I L Sbjct: 453 NYLQGWKKTLLIVSHDQGFLDSVCTDIIHL 482 >gnl|CDD|37566 KOG2355, KOG2355, KOG2355, Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only, Transcription]. Length = 291 Score = 45.0 bits (106), Expect = 2e-05 Identities = 19/59 (32%), Positives = 29/59 (49%) Query: 2 KTAVASTKGGLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMG 60 K A A + +E+ + Y D NL +P + L+G NGAGK+TL + + G Sbjct: 4 KEAEAVSDFAIEVSGLQFKYKVSDPIFFDFNLDLPAGSRCLLVGANGAGKTTLLKILSG 62 >gnl|CDD|72997 cd03238, ABC_UvrA, The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.. Length = 176 Score = 44.9 bits (106), Expect = 3e-05 Identities = 35/197 (17%), Positives = 80/197 (40%), Gaps = 48/197 (24%) Query: 27 ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADLIA 86 L+++++ IP N + + G++G+GKSTL + + L + L Sbjct: 10 NLQNLDVSIPLNVLVVVTGVSGSGKSTLVNEG-------------LYASGKARLISFLPK 56 Query: 87 YIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSSMR-QRQI 145 + ++ + + + L +VG+ + +++ Sbjct: 57 FSRNK-------------LIFIDQLQ------------------FLIDVGLGYLTLGQKL 85 Query: 146 GELSIGQQKRVFLARALAQKSQ--VIIMDEPFAAIDFKTEREMIFLLKSLLNEDIMILVS 203 LS G+ +RV LA L + + I+DEP + + +++ ++K L++ +++ Sbjct: 86 STLSGGELQRVKLASELFSEPPGTLFILDEPSTGLHQQDINQLLEVIKGLIDLGNTVILI 145 Query: 204 THNINSIPSFCDRTIFL 220 HN++ + S D I Sbjct: 146 EHNLDVL-SSADWIIDF 161 >gnl|CDD|177053 CHL00131, ycf16, sulfate ABC transporter protein; Validated. Length = 252 Score = 44.6 bits (106), Expect = 3e-05 Identities = 52/208 (25%), Positives = 96/208 (46%), Gaps = 20/208 (9%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMG--LIPLDKGSI 69 LE+K++ + N L+ +NL I + I A++G NG+GKSTL + I G + +G I Sbjct: 8 LEIKNLHASV-NENEILKGLNLSINKGEIHAIMGPNGSGKSTLSKVIAGHPAYKILEGDI 66 Query: 70 SIFNQTVENALKADLIAYIPQTESIDWTF--PILV-----EDVVMMG---RYKHMNWRRV 119 +++ L+ + A++ I F PI + D + + + K + Sbjct: 67 LFKGESI-LDLEPEERAHL----GIFLAFQYPIEIPGVSNADFLRLAYNSKRKFQGLPEL 121 Query: 120 ASNNDYRIVTEALENVGMS-SMRQRQIGE-LSIGQQKRVFLARALAQKSQVIIMDEPFAA 177 I+ E L+ VGM S R + E S G++KR + + S++ I+DE + Sbjct: 122 DPLEFLEIINEKLKLVGMDPSFLSRNVNEGFSGGEKKRNEILQMALLDSELAILDETDSG 181 Query: 178 IDFKTEREMIFLLKSLLNEDIMILVSTH 205 +D + + + L+ + I++ TH Sbjct: 182 LDIDALKIIAEGINKLMTSENSIILITH 209 >gnl|CDD|34390 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 235 Score = 43.4 bits (102), Expect = 8e-05 Identities = 43/204 (21%), Positives = 81/204 (39%), Gaps = 33/204 (16%) Query: 2 KTAVASTKGGLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGL 61 KT +GG+ L L +V+L + L G +G+GKSTL +++ Sbjct: 12 KTFTLHQQGGVRLP-----------VLRNVSLSVNAGECVVLHGPSGSGKSTLLRSLYAN 60 Query: 62 IPLDKGSISIFNQTVENALKADLIAYIPQT------ESIDW------TFP-ILVEDVVMM 108 D+G I + ++ DL+ P+ +I + P + DVV Sbjct: 61 YLPDEGQILVRHE----GEWVDLVTAEPREVLEVRRTTIGYVSQFLRVIPRVSALDVVA- 115 Query: 109 GRYKHMNWRRVASNNDYRIVTEALENVGMSS-MRQRQIGELSIGQQKRVFLARALAQKSQ 167 + + R V + L + + + S G+Q+RV +AR Sbjct: 116 ---EPLLARGVPREVARAKAADLLTRLNLPERLWSLAPATFSGGEQQRVNIARGFIVDYP 172 Query: 168 VIIMDEPFAAIDFKTEREMIFLLK 191 ++++DEP A++D ++ L++ Sbjct: 173 ILLLDEPTASLDATNRAVVVELIR 196 >gnl|CDD|72992 cd03233, ABC_PDR_domain1, The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 202 Score = 43.3 bits (102), Expect = 8e-05 Identities = 34/172 (19%), Positives = 68/172 (39%), Gaps = 36/172 (20%) Query: 28 LEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADLIAY 87 L+D + + + ++G G+G STL +A+ G++S+ N + A Sbjct: 23 LKDFSGVVKPGEMVLVLGRPGSGCSTLLKALANRTE---GNVSVEGDIHYNGIPYKEFAE 79 Query: 88 IPQTESI-----DWTFPIL-VEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSSMR 141 E I D FP L V + +++ N++ Sbjct: 80 KYPGEIIYVSEEDVHFPTLTVRET--------LDFALRCKGNEF---------------- 115 Query: 142 QRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSL 193 + +S G++KRV +A AL ++ V+ D +D T E++ ++++ Sbjct: 116 ---VRGISGGERKRVSIAEALVSRASVLCWDNSTRGLDSSTALEILKCIRTM 164 >gnl|CDD|73030 cd03271, ABC_UvrA_II, The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases.. Length = 261 Score = 42.1 bits (99), Expect = 2e-04 Identities = 48/226 (21%), Positives = 101/226 (44%), Gaps = 44/226 (19%) Query: 28 LEDVNLFIPENTITALIGLNGAGKST-----LFQAIMGLIPLDKGSISIFNQTVENALKA 82 L+++++ IP +T + G++G+GKS+ L+ A+ + L K +E Sbjct: 11 LKNIDVDIPLGVLTCVTGVSGSGKSSLINDTLYPALARRLHLKKEQPGNH-DRIEGLEHI 69 Query: 83 DLIAYIPQT------ESIDWTFPILVEDV----------------VMMGRYKHMNWRRVA 120 D + I Q+ S T+ + +++ + RYK + V Sbjct: 70 DKVIVIDQSPIGRTPRSNPATYTGVFDEIRELFCEVCKGKRYNRETLEVRYKGKSIADVL 129 Query: 121 S----------NNDYRIVT--EALENVGMSSMRQRQIG-ELSIGQQKRVFLARALAQKSQ 167 N +I + L +VG+ ++ Q LS G+ +R+ LA+ L+++S Sbjct: 130 DMTVEEALEFFENIPKIARKLQTLCDVGLGYIKLGQPATTLSGGEAQRIKLAKELSKRST 189 Query: 168 ---VIIMDEPFAAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSI 210 + I+DEP + F ++++ +L+ L+++ ++V HN++ I Sbjct: 190 GKTLYILDEPTTGLHFHDVKKLLEVLQRLVDKGNTVVVIEHNLDVI 235 >gnl|CDD|73029 cd03270, ABC_UvrA_I, The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.. Length = 226 Score = 42.1 bits (99), Expect = 2e-04 Identities = 48/203 (23%), Positives = 86/203 (42%), Gaps = 31/203 (15%) Query: 28 LEDVNLFIPENTITALIGLNGAGKSTL-FQAIMGLIPLDKG------SISIFNQTVENAL 80 L++V++ IP N + + G++G+GKS+L F I +G S+S + + + Sbjct: 11 LKNVDVDIPRNKLVVITGVSGSGKSSLAFDTIYA-----EGQRRYVESLSAYARQFLGQM 65 Query: 81 KADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEA--------- 131 P +SI+ P + D R V DY + A Sbjct: 66 DK------PDVDSIEGLSPAIAIDQKTTSRNPRSTVGTVTEIYDYLRLLFARVGIRERLG 119 Query: 132 -LENVGMSSMR-QRQIGELSIGQQKRVFLARALAQK-SQVI-IMDEPFAAIDFKTEREMI 187 L +VG+ + R LS G+ +R+ LA + + V+ ++DEP + + +I Sbjct: 120 FLVDVGLGYLTLSRSAPTLSGGEAQRIRLATQIGSGLTGVLYVLDEPSIGLHPRDNDRLI 179 Query: 188 FLLKSLLNEDIMILVSTHNINSI 210 LK L + +LV H+ ++I Sbjct: 180 ETLKRLRDLGNTVLVVEHDEDTI 202 >gnl|CDD|72999 cd03240, ABC_Rad50, The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains. The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence. This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.. Length = 204 Score = 41.0 bits (96), Expect = 3e-04 Identities = 32/169 (18%), Positives = 62/169 (36%), Gaps = 14/169 (8%) Query: 40 ITALIGLNGAGKSTLFQAI-MGLIPLDKGSISIFNQTVENALKADLIAYIPQTESIDWTF 98 +T ++G NGAGK+T+ +A+ L + + A LI + F Sbjct: 24 LTLIVGQNGAGKTTIIEALKYALTG------ELPPNSKGGAHDPKLIREGEVRAQVKLAF 77 Query: 99 PILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFL 158 + R + V + L+ G S ++ + L I R+ L Sbjct: 78 ENANGKKYTITRSLAI-LENVIFCHQGESNWPLLDMRGRCSGGEKVLASLII----RLAL 132 Query: 159 ARALAQKSQVIIMDEPFAAID-FKTEREMIFLLKSLLNEDIM-ILVSTH 205 A ++ +DEP +D E + +++ ++ ++V TH Sbjct: 133 AETFGSNCGILALDEPTTNLDEENIEESLAEIIEERKSQKNFQLIVITH 181 >gnl|CDD|73038 cd03279, ABC_sbcCD, SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.. Length = 213 Score = 40.2 bits (94), Expect = 6e-04 Identities = 37/182 (20%), Positives = 65/182 (35%), Gaps = 30/182 (16%) Query: 37 ENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTV---ENALKADLIAYIPQTES 93 N + + G GAGKST+ AI + +++ +T + A T Sbjct: 27 NNGLFLICGPTGAGKSTILDAI---------TYALYGKTPRYGRQENLRSVFAPGEDTAE 77 Query: 94 IDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSSMRQRQIGELSIGQQ 153 + +TF +G K+ R + D L R + LS G+ Sbjct: 78 VSFTF--------QLGGKKYRVERSRGLDYDQFTRIVLLPQGEFDRFLARPVSTLSGGET 129 Query: 154 KRVFLARALAQKSQV----------IIMDEPFAAIDFKTEREMIFLLKSLLNEDIMILVS 203 L+ ALA + + +DE F +D + + L+ + E+ M+ V Sbjct: 130 FLASLSLALALSEVLQNRGGARLEALFIDEGFGTLDPEALEAVATALELIRTENRMVGVI 189 Query: 204 TH 205 +H Sbjct: 190 SH 191 >gnl|CDD|33697 COG3910, COG3910, Predicted ATPase [General function prediction only]. Length = 233 Score = 39.5 bits (92), Expect = 0.001 Identities = 39/172 (22%), Positives = 65/172 (37%), Gaps = 28/172 (16%) Query: 40 ITALIGLNGAGKSTLFQAI---MGLIPLDKGSISIFNQTVENALKADLIAYIPQTESIDW 96 IT + G NG+GKSTL +AI MG G ++ D + + Sbjct: 39 ITFITGENGSGKSTLLEAIAAGMGFNAAGGGKNFKGELDASHSALVDYAKLHKRKKPPIG 98 Query: 97 TFPILVEDVVMMGRY--KHMNWRRVASNNDYRIVTEALENVGMSSMRQRQIGELSIGQQK 154 F + E + Y + N G S+ GE + Sbjct: 99 FF-LRAESFYNVASYLDEADGEA----------------NYGGRSLHHMSHGESFL---- 137 Query: 155 RVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNEDIMILVSTHN 206 +F R Q + I+DEP AA+ + E++ +L+ L + I+++TH+ Sbjct: 138 AIFHNRFNGQG--IYILDEPEAALSPSRQLELLAILRDLADSGAQIIIATHS 187 >gnl|CDD|30768 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]. Length = 908 Score = 36.6 bits (84), Expect = 0.007 Identities = 23/89 (25%), Positives = 44/89 (49%), Gaps = 9/89 (10%) Query: 143 RQIGELSIGQQKRVFLARALA--------QKSQVIIMDEPFAAIDFKTEREMIFLLKSLL 194 R I LS G++ LA LA + +++ +DEPF +D + ++ +L+ LL Sbjct: 811 RPIKTLSGGERFLASLALRLALSDLLQGRARLELLFLDEPFGTLDEERLEKLAEILEELL 870 Query: 195 NEDIMILVSTHNINSIPSFCDRTIFLKKT 223 ++ I++ +H + + D I +KK Sbjct: 871 SDGRQIIIISH-VEELKERADVRIRVKKD 898 Score = 32.3 bits (73), Expect = 0.13 Identities = 10/19 (52%), Positives = 14/19 (73%) Query: 40 ITALIGLNGAGKSTLFQAI 58 I ++G NGAGKS++ AI Sbjct: 27 IFLIVGPNGAGKSSILDAI 45 >gnl|CDD|30527 COG0178, UvrA, Excinuclease ATPase subunit [DNA replication, recombination, and repair]. Length = 935 Score = 35.9 bits (83), Expect = 0.012 Identities = 24/85 (28%), Positives = 50/85 (58%), Gaps = 4/85 (4%) Query: 130 EALENVGMSSMRQRQ-IGELSIGQQKRVFLARALAQKSQ---VIIMDEPFAAIDFKTERE 185 + L +VG+ ++ Q LS G+ +RV LA+ L+++S + I+DEP + F ++ Sbjct: 804 QTLVDVGLGYIKLGQPATTLSGGEAQRVKLAKELSKRSTGKTLYILDEPTTGLHFDDIKK 863 Query: 186 MIFLLKSLLNEDIMILVSTHNINSI 210 ++ +L L+++ ++V HN++ I Sbjct: 864 LLEVLHRLVDKGNTVIVIEHNLDVI 888 Score = 33.2 bits (76), Expect = 0.071 Identities = 16/58 (27%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Query: 28 LEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADLI 85 L+++++ IP T + G++G+GKSTL L N T E I Sbjct: 617 LKNIDVEIPLGVFTCVTGVSGSGKSTLINDT-----LVPALARHLNGTKEEPGPYKKI 669 Score = 32.5 bits (74), Expect = 0.15 Identities = 12/27 (44%), Positives = 21/27 (77%) Query: 28 LEDVNLFIPENTITALIGLNGAGKSTL 54 L++++L IP N + + GL+G+GKS+L Sbjct: 16 LKNIDLEIPRNKLVVITGLSGSGKSSL 42 >gnl|CDD|34256 COG4637, COG4637, Predicted ATPase [General function prediction only]. Length = 373 Score = 33.0 bits (75), Expect = 0.082 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Query: 24 GYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQ 74 Y + ++L I + +IG NGAGKS + A+ L +G++ Q Sbjct: 10 NYRSFRSLDLEIR--RVNVIIGANGAGKSNFYDALRLLADAVRGNLQQALQ 58 >gnl|CDD|72986 cd03227, ABC_Class2, ABC-type Class 2 contains systems involved in cellular processes other than transport. These families are characterised by the fact that the ABC subunit is made up of duplicated, fused ABC modules (ABC2). No known transmembrane proteins or domains are associated with these proteins.. Length = 162 Score = 33.0 bits (75), Expect = 0.086 Identities = 15/66 (22%), Positives = 30/66 (45%), Gaps = 4/66 (6%) Query: 145 IGELSIGQQKRVFLARALA----QKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNEDIMI 200 +LS G+++ LA LA + + I+DE +D + + + + L + + Sbjct: 75 RLQLSGGEKELSALALILALASLKPRPLYILDEIDRGLDPRDGQALAEAILEHLVKGAQV 134 Query: 201 LVSTHN 206 +V TH Sbjct: 135 IVITHL 140 Score = 33.0 bits (75), Expect = 0.090 Identities = 11/33 (33%), Positives = 18/33 (54%) Query: 26 CALEDVNLFIPENTITALIGLNGAGKSTLFQAI 58 ++ E ++T + G NG+GKST+ AI Sbjct: 9 SYFVPNDVTFGEGSLTIITGPNGSGKSTILDAI 41 >gnl|CDD|57925 cd01854, YjeQ_engC, YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) represents a protein family whose members are broadly conserved in bacteria and have been shown to be essential to the growth of E. coli and B. subtilis. Proteins of the YjeQ family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. All YjeQ family proteins display a unique domain architecture, which includes an N-terminal OB-fold RNA-binding domain, the central permuted GTPase domain, and a zinc knuckle-like C-terminal cysteine domain. This domain architecture suggests a role for YjeQ as a regulator of translation.. Length = 287 Score = 32.5 bits (74), Expect = 0.13 Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 37 ENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 + + L+G +G GKSTL A++ + L G IS Sbjct: 160 KGKTSVLVGQSGVGKSTLINALLPDLDLATGEIS 193 >gnl|CDD|31356 COG1162, COG1162, Predicted GTPases [General function prediction only]. Length = 301 Score = 32.2 bits (73), Expect = 0.18 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 4/60 (6%) Query: 11 GLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 G + +S +G L ++ IT L+G +G GKSTL A++ + G IS Sbjct: 141 GYPVLFVSAKNGDGLEELAELL----AGKITVLLGQSGVGKSTLINALLPELNQKTGEIS 196 >gnl|CDD|133443 cd01065, NAD_bind_Shikimate_DH, NAD(P) binding domain of Shikimate dehydrogenase. Shikimate dehydrogenase (DH) is an amino acid DH family member. Shikimate pathway links metabolism of carbohydrates to de novo biosynthesis of aromatic amino acids, quinones and folate. It is essential in plants, bacteria, and fungi but absent in mammals, thus making enzymes involved in this pathway ideal targets for broad spectrum antibiotics and herbicides. Shikimate DH catalyzes the reduction of 3-hydroshikimate to shikimate using the cofactor NADH. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DHs, amino acid DHs, repressor rex, NAD-binding potassium channel domain, CoA-binding, and ornithine cyclodeaminase-like domains. These domains have an alpha-beta-alpha configuration. NAD binding involves numerous hydrogen and van der Waals contacts. Length = 155 Score = 31.1 bits (71), Expect = 0.31 Identities = 17/84 (20%), Positives = 32/84 (38%), Gaps = 11/84 (13%) Query: 27 ALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADLIA 86 ALE+ + + + ++G GA ++ L L I I N+T+E A L Sbjct: 9 ALEEAGIELKGKKV-LILGAGGAARA----VAYALAELGAAKIVIVNRTLEKA--KALAE 61 Query: 87 YIPQT----ESIDWTFPILVEDVV 106 + +D + D++ Sbjct: 62 RFGELGIAIAYLDLEELLAEADLI 85 >gnl|CDD|35241 KOG0018, KOG0018, KOG0018, Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]. Length = 1141 Score = 30.7 bits (69), Expect = 0.45 Identities = 13/29 (44%), Positives = 17/29 (58%) Query: 31 VNLFIPENTITALIGLNGAGKSTLFQAIM 59 + P + TA+IG NG+GKS L AI Sbjct: 18 HQVIGPFDRFTAIIGPNGSGKSNLMDAIS 46 >gnl|CDD|146027 pfam03193, DUF258, Protein of unknown function, DUF258. Length = 161 Score = 30.6 bits (70), Expect = 0.53 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Query: 17 ISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSIS 70 +S G L+ L + + L G +G GKSTL A++ + L G IS Sbjct: 18 VSAKTGEGIEELKP-LL---KGKTSVLAGQSGVGKSTLLNALLPELDLRTGEIS 67 >gnl|CDD|73033 cd03274, ABC_SMC4_euk, Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).. Length = 212 Score = 30.2 bits (68), Expect = 0.57 Identities = 31/153 (20%), Positives = 67/153 (43%), Gaps = 27/153 (17%) Query: 41 TALIGLNGAGKSTLFQAIMGL-------IPLDKGSISIFNQTVENALKADLIAYIPQTES 93 +A++G NG+GKS + +++ + + K S I N L + S Sbjct: 28 SAIVGPNGSGKSNVIDSMLFVFGFRASKMRQKKLSDLIHNSAGHPNL---------DSCS 78 Query: 94 IDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSSMRQ-RQIGELSIGQ 152 ++ F +++ ++ + ++ +N + I+ +E + + + I LS G+ Sbjct: 79 VEVHFQEIIDKPLLKSKGIDLD------HNRFLILQGEVEQIAQMPKKSWKNISNLSGGE 132 Query: 153 QKRVFLARALA----QKSQVIIMDEPFAAIDFK 181 + LA A + + + +MDE AA+DF+ Sbjct: 133 KTLSSLALVFALHHYKPTPLYVMDEIDAALDFR 165 >gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored to the plasma membrane. The resulting downstream signals occur bidirectionally in both EphR-expressing cells (forward signaling) and ephrin-expressing cells (reverse signaling). EphA10, which contains an inactive tyr kinase domain, may function to attenuate signals of co-clustered active receptors. EphA10 is mainly expressed in the testis. Ephrin/EphR interaction results in cell-cell repulsion or adhesion, making it important in neural development and plasticity, cell morphogenesis, cell-fate determination, embryonic development, tissue patterning, and angiogenesis. Length = 266 Score = 30.3 bits (68), Expect = 0.69 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Query: 104 DVVMMGRYKHMNWRR----VASNNDYRIVTEALENVGMSSMRQRQIGELSIGQ 152 + + +G++ H N R + N IVTE + N + S ++ G+L GQ Sbjct: 56 EALTLGQFDHSNIVRLEGVITRGNTMMIVTEYMSNGALDSFLRKHEGQLVAGQ 108 >gnl|CDD|145545 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain. This domain is found at the N terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination. Length = 1162 Score = 29.9 bits (67), Expect = 0.71 Identities = 10/19 (52%), Positives = 14/19 (73%) Query: 40 ITALIGLNGAGKSTLFQAI 58 TA++G NG+GKS + AI Sbjct: 25 FTAIVGPNGSGKSNILDAI 43 >gnl|CDD|133361 cd04161, Arl2l1_Arl13_like, Arl2l1/Arl13 subfamily. Arl2l1 (Arl2-like protein 1) and Arl13 form a subfamily of the Arf family of small GTPases. Arl2l1 was identified in human cells during a search for the gene(s) responsible for Bardet-Biedl syndrome (BBS). Like Arl6, the identified BBS gene, Arl2l1 is proposed to have cilia-specific functions. Arl13 is found on the X chromosome, but its expression has not been confirmed; it may be a pseudogene. Length = 167 Score = 30.1 bits (68), Expect = 0.77 Identities = 13/34 (38%), Positives = 17/34 (50%) Query: 42 ALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQT 75 +GL+ AGK+TL A+ G IP F T Sbjct: 3 LTVGLDNAGKTTLVSALQGEIPKKVAPTVGFTPT 36 >gnl|CDD|32443 COG2262, HflX, GTPases [General function prediction only]. Length = 411 Score = 29.9 bits (67), Expect = 0.82 Identities = 22/67 (32%), Positives = 29/67 (43%), Gaps = 16/67 (23%) Query: 42 ALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADLIAYIPQTESIDW--TFP 99 AL+G AGKSTLF A+ G + V + L A L P T I+ Sbjct: 196 ALVGYTNAGKSTLFNALTGA-----------DVYVADQLFATL---DPTTRRIELGDGRK 241 Query: 100 ILVEDVV 106 +L+ D V Sbjct: 242 VLLTDTV 248 >gnl|CDD|72981 cd03222, ABC_RNaseL_inhibitor, The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.. Length = 177 Score = 29.6 bits (66), Expect = 1.1 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 1/76 (1%) Query: 144 QIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSLLNEDI-MILV 202 Q +LS G+ +RV +A AL + + + DEP A +D + ++ L E LV Sbjct: 68 QYIDLSGGELQRVAIAAALLRNATFYLFDEPSAYLDIEQRLNAARAIRRLSEEGKKTALV 127 Query: 203 STHNINSIPSFCDRTI 218 H++ + DR Sbjct: 128 VEHDLAVLDYLSDRIH 143 >gnl|CDD|29996 cd01130, VirB11-like_ATPase, Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB. This alignment contains the C-terminal domain, which is the ATPase.. Length = 186 Score = 29.4 bits (66), Expect = 1.1 Identities = 12/27 (44%), Positives = 18/27 (66%) Query: 45 GLNGAGKSTLFQAIMGLIPLDKGSISI 71 G G+GK+TL A++ IP D+ I+I Sbjct: 32 GGTGSGKTTLLNALLAFIPPDERIITI 58 >gnl|CDD|113093 pfam04310, MukB, MukB N-terminal. This family represents the N-terminal region of MukB, one of a group of bacterial proteins essential for the movement of nucleoids from mid-cell towards the cell quarters (i.e. chromosome partitioning). The structure of the N-terminal domain consists of an antiparallel six-stranded beta sheet surrounded by one helix on one side and by five helices on the other side. It contains an exposed Walker A loop in an unexpected helix-loop-helix motif (in other proteins, Walker A motifs generally adopt a P loop conformation as part of a strand-loop-helix motif embedded in a conserved topology of alternating helices and (parallel) beta strands). Length = 227 Score = 29.2 bits (65), Expect = 1.4 Identities = 19/42 (45%), Positives = 22/42 (52%), Gaps = 5/42 (11%) Query: 23 NGYCALEDVNLFIPENTITALIGLNGAGKSTLFQA-IMGLIP 63 NG+ A F + +T L G NGAGKST A I LIP Sbjct: 16 NGFFA----RTFDIDELVTTLSGGNGAGKSTTMAAFITALIP 53 >gnl|CDD|73034 cd03275, ABC_SMC1_euk, Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).. Length = 247 Score = 29.0 bits (65), Expect = 1.4 Identities = 11/19 (57%), Positives = 13/19 (68%) Query: 41 TALIGLNGAGKSTLFQAIM 59 T +IG NG+GKS L AI Sbjct: 25 TCIIGPNGSGKSNLMDAIS 43 >gnl|CDD|30909 COG0563, Adk, Adenylate kinase and related kinases [Nucleotide transport and metabolism]. Length = 178 Score = 28.7 bits (64), Expect = 1.9 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Query: 42 ALIGLNGAGKSTLFQAI---MGLIPLDKGSI 69 ++G GAGKSTL + + +GL LD G I Sbjct: 4 LILGPPGAGKSTLAKKLAKKLGLPHLDTGDI 34 >gnl|CDD|132765 cd07303, Porin3, Eukaryotic porin family that forms channels in the mitochondrial outer membrane. The porin family 3 contains two sub-families that play vital roles in the mitochondrial outer membrane, a translocase for unfolded pre-proteins (Tom40) and the voltage-dependent anion channel (VDAC) that regulates the flux of mostly anionic metabolites through the outer mitochondrial membrane. Length = 274 Score = 28.4 bits (63), Expect = 2.3 Identities = 12/61 (19%), Positives = 21/61 (34%), Gaps = 5/61 (8%) Query: 221 KKTVLASGLTSDIFNEDN-IQKTFGAQVSP----QSSILNESNIQTTFKAEVYPQINSTM 275 K + L + N + QV P +S+ N S + + + P I T+ Sbjct: 195 DKLEVGVNLAATAGNSNTRFGIAAKYQVDPDACFSASVNNSSLVGLGYTQTLKPGIKLTL 254 Query: 276 C 276 Sbjct: 255 S 255 >gnl|CDD|33731 COG3950, COG3950, Predicted ATP-binding protein involved in virulence [General function prediction only]. Length = 440 Score = 28.1 bits (62), Expect = 2.5 Identities = 16/66 (24%), Positives = 32/66 (48%), Gaps = 4/66 (6%) Query: 12 LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAI-MGLIPLDKGSIS 70 + L+ IS+ + L+ + E+ T ++G NG+GK+T+ AI L I Sbjct: 1 MRLRKISLNNFRCFLNLD---ITFGESETTIIVGPNGSGKTTVLDAIRNALNKFIDFFIY 57 Query: 71 IFNQTV 76 + +++ Sbjct: 58 LRFKSL 63 >gnl|CDD|37559 KOG2348, KOG2348, KOG2348, Urea transporter [Amino acid transport and metabolism]. Length = 667 Score = 28.4 bits (63), Expect = 2.5 Identities = 14/54 (25%), Positives = 22/54 (40%) Query: 1 MKTAVASTKGGLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTL 54 M T + + LE + TYP+ + + + AL+G NGA L Sbjct: 303 MATTMGLSCLALENNPVFPTYPDPVSSKQVSEGLVLPYAAIALMGKNGAAAGLL 356 >gnl|CDD|37404 KOG2193, KOG2193, KOG2193, IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification, General function prediction only]. Length = 584 Score = 28.2 bits (62), Expect = 2.6 Identities = 9/25 (36%), Positives = 12/25 (48%) Query: 25 YCALEDVNLFIPENTITALIGLNGA 49 E V +FIP + A+IG G Sbjct: 407 NPEQEQVRMFIPAQAVGAIIGKKGQ 431 >gnl|CDD|31389 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]. Length = 1163 Score = 28.1 bits (62), Expect = 2.8 Identities = 10/26 (38%), Positives = 14/26 (53%) Query: 34 FIPENTITALIGLNGAGKSTLFQAIM 59 TA++G NG+GKS + AI Sbjct: 20 INFSPGFTAIVGPNGSGKSNIVDAIR 45 >gnl|CDD|32910 COG3096, MukB, Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 1480 Score = 28.1 bits (62), Expect = 3.0 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 5/42 (11%) Query: 23 NGYCALEDVNLFIPENTITALIGLNGAGKSTLFQA-IMGLIP 63 NG+ A F + +T L G NGAGKST A + LIP Sbjct: 16 NGFFA----RTFDLDELVTTLSGGNGAGKSTTMAAFVTALIP 53 >gnl|CDD|72998 cd03239, ABC_SMC_head, The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms. SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes. The proteins range in size from approximately 110 to 170 kDa, and each has five distinct domains: amino- and carboxy-terminal globular domains, which contain sequences characteristic of ATPases, two coiled-coil regions separating the terminal domains , and a central flexible hinge. SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair, and epigenetic silencing of gene expression.. Length = 178 Score = 27.9 bits (62), Expect = 3.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 36 PENTITALIGLNGAGKSTLFQAI 58 N+ A++G NG+GKS + AI Sbjct: 20 GSNSFNAIVGPNGSGKSNIVDAI 42 >gnl|CDD|73036 cd03277, ABC_SMC5_euk, Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).. Length = 213 Score = 27.8 bits (62), Expect = 3.2 Identities = 11/25 (44%), Positives = 17/25 (68%) Query: 34 FIPENTITALIGLNGAGKSTLFQAI 58 F P ++ +IG NG+GKS++ AI Sbjct: 19 FRPGPSLNMIIGPNGSGKSSIVCAI 43 >gnl|CDD|73001 cd03242, ABC_RecF, RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage. When replication is prematurely disrupted by DNA damage, several recF pathway gene products play critical roles processing the arrested replication fork, allowing it to resume and complete its task. This CD represents the nucleotide binding domain of RecF. RecF belongs to a large superfamily of ABC transporters involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases with a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 270 Score = 27.9 bits (62), Expect = 3.3 Identities = 11/28 (39%), Positives = 15/28 (53%) Query: 37 ENTITALIGLNGAGKSTLFQAIMGLIPL 64 E +T L+G N GK+ L +AI L Sbjct: 20 EPGVTVLVGENAQGKTNLLEAISLLATG 47 >gnl|CDD|30362 COG0012, COG0012, Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis]. Length = 372 Score = 27.8 bits (62), Expect = 3.5 Identities = 9/17 (52%), Positives = 12/17 (70%) Query: 42 ALIGLNGAGKSTLFQAI 58 ++GL GKSTLF A+ Sbjct: 6 GIVGLPNVGKSTLFNAL 22 >gnl|CDD|133300 cd01900, YchF, YchF subfamily. YchF is a member of the Obg family, which includes four other subfamilies of GTPases: Obg, DRG, Ygr210, and NOG1. Obg is an essential gene that is involved in DNA replication in C. crescentus and Streptomyces griseus and is associated with the ribosome. Several members of the family, including YchF, possess the TGS domain related to the RNA-binding proteins. Experimental data and genomic analysis suggest that YchF may be part of a nucleoprotein complex and may function as a GTP-dependent translational factor. Length = 274 Score = 27.8 bits (63), Expect = 3.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 44 IGLNGAGKSTLFQAI 58 +GL GKSTLF A+ Sbjct: 4 VGLPNVGKSTLFNAL 18 >gnl|CDD|31388 COG1195, RecF, Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair]. Length = 363 Score = 27.5 bits (61), Expect = 3.9 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 36 PENTITALIGLNGAGKSTLFQAI 58 + L+G NG GK+ L +AI Sbjct: 21 LSPGVNVLVGENGQGKTNLLEAI 43 >gnl|CDD|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI. Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. Due to this, it is thought that Mg-chelatase has an important role in channelling inter- mediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weight between 38-42 kDa. Length = 207 Score = 27.5 bits (62), Expect = 4.1 Identities = 8/21 (38%), Positives = 15/21 (71%) Query: 43 LIGLNGAGKSTLFQAIMGLIP 63 +IG G+GK+ L + + G++P Sbjct: 27 MIGPPGSGKTMLAKRLPGILP 47 >gnl|CDD|133370 cd04170, EF-G_bact, Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group contains only bacterial members. Length = 268 Score = 27.5 bits (62), Expect = 4.1 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 3/25 (12%) Query: 42 ALIGLNGAGKSTLFQAI---MGLIP 63 AL+G +G+GK+TL +A+ G I Sbjct: 3 ALVGHSGSGKTTLAEALLYATGAID 27 >gnl|CDD|133279 cd01878, HflX, HflX subfamily. A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily. The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear. HflX is widespread, but not universally represented in all three superkingdoms. Length = 204 Score = 27.4 bits (62), Expect = 4.3 Identities = 12/19 (63%), Positives = 14/19 (73%) Query: 42 ALIGLNGAGKSTLFQAIMG 60 AL+G AGKSTLF A+ G Sbjct: 45 ALVGYTNAGKSTLFNALTG 63 >gnl|CDD|133281 cd01881, Obg_like, The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1. Four of these groups (Obg, DRG, YyaF/YchF, and Ygr210) are characterized by a distinct glycine-rich motif immediately following the Walker B motif (G3 box). Obg/CgtA is an essential gene that is involved in the initiation of sporulation and DNA replication in the bacteria Caulobacter and Bacillus, but its exact molecular role is unknown. Furthermore, several OBG family members possess a C-terminal RNA-binding domain, the TGS domain, which is also present in threonyl-tRNA synthetase and in bacterial guanosine polyphosphatase SpoT. Nog1 is a nucleolar protein that might function in ribosome assembly. The DRG and Nog1 subfamilies are ubiquitous in archaea and eukaryotes, the Ygr210 subfamily is present in archaea and fungi, and the Obg and YyaF/YchF subfamilies are ubiquitous in bacteria and eukaryotes. The Obg/Nog1 and DRG subfamilies appear to form one major branch of the Obg family and the Ygr210 and YchF subfamilies form another branch. No GEFs, GAPs, or GDIs for Obg have been identified. Length = 176 Score = 27.5 bits (62), Expect = 4.5 Identities = 9/16 (56%), Positives = 11/16 (68%) Query: 43 LIGLNGAGKSTLFQAI 58 L+GL GKSTL A+ Sbjct: 1 LVGLPNVGKSTLLNAL 16 >gnl|CDD|34546 COG4938, COG4938, Uncharacterized conserved protein [Function unknown]. Length = 374 Score = 27.3 bits (60), Expect = 4.8 Identities = 23/111 (20%), Positives = 44/111 (39%), Gaps = 4/111 (3%) Query: 134 NVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSL 193 M R +G + + L + +K +II++ P A + + + ++ LL L Sbjct: 230 RFDGLEMDIRNVG-FGLSYVLPIGLMLLIVKKKYLIIIENPEAHLHPEGQSKLGDLLAEL 288 Query: 194 LNEDIMILVSTHN---INSIPSFCDRTIFLKKTVLASGLTSDIFNEDNIQK 241 + ++V TH+ IN + L + LA L N ++K Sbjct: 289 AARGVQVVVETHSDHIINGLRLIVLEGKILTRNKLAVYLFKREGNGTIVKK 339 >gnl|CDD|144508 pfam00931, NB-ARC, NB-ARC domain. Length = 285 Score = 27.3 bits (61), Expect = 5.0 Identities = 7/23 (30%), Positives = 13/23 (56%) Query: 36 PENTITALIGLNGAGKSTLFQAI 58 + ++G+ G GK+TL + I Sbjct: 17 ENLGVVGIVGMGGVGKTTLAKQI 39 >gnl|CDD|31297 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only]. Length = 219 Score = 27.3 bits (59), Expect = 5.2 Identities = 9/37 (24%), Positives = 16/37 (43%) Query: 42 ALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVEN 78 ++G G GK+TL ++G + +I N Sbjct: 9 VVLGDGGVGKTTLLNRLVGDEFPEGYPPTIGNLDPAK 45 >gnl|CDD|73032 cd03273, ABC_SMC2_euk, Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).. Length = 251 Score = 27.1 bits (60), Expect = 5.2 Identities = 43/202 (21%), Positives = 77/202 (38%), Gaps = 42/202 (20%) Query: 41 TALIGLNGAGKSTLFQAI---MGLIPLD-------------KGSISIFNQTVENALKADL 84 A+ GLNG+GKS + AI +G+ L +G I +V Sbjct: 28 NAITGLNGSGKSNILDAICFVLGITNLSTVRASNLQDLIYKRGQAGITKASVTIVFDNSD 87 Query: 85 IAYIPQTESIDWTFPILV--EDVVMMGRYKHMNWRRVASNND----YRIVTEALEN---- 134 + P +P + +V+ G K++ A ++ V + N Sbjct: 88 KSQSPIGFE---NYPEITVTRQIVLGGTNKYLINGHRAQQQRVQDLFQSVQLNVNNPHFL 144 Query: 135 ---------VGMSSMRQRQIGELSIGQQKRVFLARALA----QKSQVIIMDEPFAAIDFK 181 + M + + + ELS GQ+ V L+ LA + + + I+DE AA+D Sbjct: 145 IMQGRITKVLNMGGVWKESLTELSGGQRSLVALSLILALLLFKPAPMYILDEVDAALDLS 204 Query: 182 TEREMIFLLKSLLNEDIMILVS 203 + + ++K+ I+VS Sbjct: 205 HTQNIGRMIKTHFKGSQFIVVS 226 >gnl|CDD|30188 cd00464, SK, Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.. Length = 154 Score = 27.1 bits (60), Expect = 5.3 Identities = 8/13 (61%), Positives = 11/13 (84%) Query: 42 ALIGLNGAGKSTL 54 LIG+ GAGK+T+ Sbjct: 3 VLIGMMGAGKTTV 15 >gnl|CDD|145705 pfam02689, Herpes_Helicase, Helicase. This family consists of Helicases from the Herpes viruses. Helicases are responsible for the unwinding of DNA and are essential for replication and completion of the viral life cycle. Length = 801 Score = 26.9 bits (60), Expect = 5.6 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Query: 45 GLNGAGKSTLFQAI-MGLIPLDKGSISIFNQTVENALKADLIAYIP 89 G GAGKST Q + L L G+ + Q + L AY P Sbjct: 67 GTAGAGKSTSIQTLNENLDCLITGATRVAAQNLSAKLSRAYSAYCP 112 >gnl|CDD|34333 COG4717, COG4717, Uncharacterized conserved protein [Function unknown]. Length = 984 Score = 26.9 bits (59), Expect = 5.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Query: 37 ENTITALIGLNGAGKSTLFQAIMGLI 62 E+ + G N AGKSTLF I ++ Sbjct: 23 ESKFQVIYGENEAGKSTLFSFIHSML 48 >gnl|CDD|34310 COG4694, COG4694, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 758 Score = 27.0 bits (59), Expect = 5.7 Identities = 19/79 (24%), Positives = 37/79 (46%), Gaps = 13/79 (16%) Query: 141 RQRQIGE-----LSIGQQKRVFLARALAQ--------KSQVIIMDEPFAAIDFKTEREMI 187 QR+ G+ LS G++ + LA+ K++V+++D+P ++ D + Sbjct: 518 IQREDGQLVGNTLSEGEKTFIAFLYFLAKLKENPDISKNKVVVIDDPISSFDSNILFRVS 577 Query: 188 FLLKSLLNEDIMILVSTHN 206 L+K ++V THN Sbjct: 578 VLVKEEKTNIKQVIVLTHN 596 >gnl|CDD|133256 cd00880, Era_like, Era (E. coli Ras-like protein)-like. This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons. FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control. Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain. EngA and its orthologs are composed of two GTPase domains and, since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Length = 163 Score = 26.9 bits (60), Expect = 5.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Query: 43 LIGLNGAGKSTLFQAIMG 60 L G AGKS+L A++G Sbjct: 1 LFGRTNAGKSSLLNALLG 18 >gnl|CDD|31353 COG1159, Era, GTPase [General function prediction only]. Length = 298 Score = 27.1 bits (60), Expect = 5.7 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 5/41 (12%) Query: 42 ALIGLNGAGKSTLFQAIMGLIPLDKGSI-SIFNQTVENALK 81 A+IG GKSTL A++G K SI S QT N ++ Sbjct: 10 AIIGRPNVGKSTLLNALVG----QKISIVSPKPQTTRNRIR 46 >gnl|CDD|39282 KOG4079, KOG4079, KOG4079, Putative mitochondrial ribosomal protein mRpS25 [Translation, ribosomal structure and biogenesis]. Length = 169 Score = 26.9 bits (59), Expect = 6.1 Identities = 19/75 (25%), Positives = 29/75 (38%), Gaps = 8/75 (10%) Query: 133 ENVGMSSMRQRQIGELSIGQQKRVFLARALAQ----KSQVIIMDE----PFAAIDFKTER 184 +NV + S+ G G + VF Q K Q++ PFA R Sbjct: 26 DNVNVFSVNYNTNGPEQSGARDFVFWNIPQIQYKNPKVQLVKHKNMTPSPFARAYLDDGR 85 Query: 185 EMIFLLKSLLNEDIM 199 E++F L + E+I Sbjct: 86 EVLFDLDGMKREEIE 100 >gnl|CDD|34526 COG4917, EutP, Ethanolamine utilization protein [Amino acid transport and metabolism]. Length = 148 Score = 26.5 bits (58), Expect = 8.5 Identities = 10/19 (52%), Positives = 14/19 (73%) Query: 42 ALIGLNGAGKSTLFQAIMG 60 A +G G GK+TLFQ++ G Sbjct: 5 AFVGQVGCGKTTLFQSLYG 23 >gnl|CDD|73037 cd03278, ABC_SMC_barmotin, Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function. Barmotin belongs to the SMC protein family. SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).. Length = 197 Score = 26.2 bits (58), Expect = 9.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Query: 40 ITALIGLNGAGKSTLFQAI 58 +TA++G NG+GKS + AI Sbjct: 24 LTAIVGPNGSGKSNIIDAI 42 >gnl|CDD|109493 pfam00437, GSPII_E, Type II/IV secretion system protein. This family contains both type II and type IV pathway secretion proteins from bacteria. VirB11 ATPase is a subunit of the Agrobacterium tumefaciens transfer DNA (T-DNA) transfer system, a type IV secretion pathway required for delivery of T-DNA and effector proteins to plant cells during infection. Length = 283 Score = 26.5 bits (59), Expect = 9.6 Identities = 19/75 (25%), Positives = 31/75 (41%), Gaps = 10/75 (13%) Query: 43 LIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKA-DLIAYIPQTESIDWTFPIL 101 + G G+GK+TL A++ I D I VE L+ + + + TF L Sbjct: 144 VSGGTGSGKTTLLYALLNEINTDDERIVTIEDPVEIQLEGPNQVQLNTR--LAGVTFADL 201 Query: 102 VE-------DVVMMG 109 + D +M+G Sbjct: 202 LRAALRQRPDRIMVG 216 >gnl|CDD|31145 COG0802, COG0802, Predicted ATPase or kinase [General function prediction only]. Length = 149 Score = 26.4 bits (58), Expect = 9.8 Identities = 10/30 (33%), Positives = 15/30 (50%) Query: 29 EDVNLFIPENTITALIGLNGAGKSTLFQAI 58 E + + + L G GAGK+TL + I Sbjct: 16 ERLAEALKAGDVVLLSGDLGAGKTTLVRGI 45 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0590 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,111,932 Number of extensions: 159762 Number of successful extensions: 960 Number of sequences better than 10.0: 1 Number of HSP's gapped: 806 Number of HSP's successfully gapped: 284 Length of query: 280 Length of database: 6,263,737 Length adjustment: 93 Effective length of query: 187 Effective length of database: 4,254,100 Effective search space: 795516700 Effective search space used: 795516700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 57 (26.0 bits)