HHsearch alignment for GI: 254780539 and conserved domain: PRK10441

>PRK10441 iron-enterobactin transporter membrane protein; Provisional.
Probab=99.92  E-value=5.2e-22  Score=142.94  Aligned_cols=247  Identities=15%  Similarity=0.073  Sum_probs=188.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HHHHHC-C----CCHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             9999999998777999999658996324899999999--------999831-4----41456899999999999986310
Q gi|254780539|r   19 WMSTLIGCVCGLLSAYLILKGWSSIGNGISHAIFPGI--------VVCHRL-N----IPLSVGATISGMLATGIMVKIKE   85 (273)
Q Consensus        19 l~~~li~~~~~~lG~~~v~r~~s~~~~alsH~~l~Gi--------ala~~l-~----~~~~~ga~~~~ll~~~li~~l~~   85 (273)
T Consensus        65 l~A~lvGaaLalsG~l~----Q~l~rNPLA~P~ilGissGA~l~~vl~~~~~~~~~~~~~~~~a~~ga~~~~~~v~~l~~  140 (335)
T PRK10441         65 LAGLLAGGALGLAGALM----QTLTRNPLADPGILGVNAGASFAIVLGAALFGYSSAQEQLAMAFAGALVASLIVAFTGS  140 (335)
T ss_pred             HHHHHHHHHHHHHHHHH----HHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999----99947988784164588889999999999998777899999999999999999999999


Q ss_pred             CCC--CCHH--HHHHHHHHHHHHHHH-HHHHHHCC-CCCCCHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             246--5115--689999999999999-97521102-22421121153100270001357887679999999988878887
Q gi|254780539|r   86 TTK--LRED--VAIAVVYIIFYSFAM-FMLSLSPS-AVYVENIFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLL  159 (273)
Q Consensus        86 ~~~--~~~d--~~igi~~~~~~algv-llis~~~~-~~~l~~~LfG~il~i~~~di~~~~~~~~i~~~~~~~~~r~l~~~  159 (273)
T Consensus       141 ~~~~~~~~~~liL~Giai~~~~~a~~~~l~~~~~~~~~~~~~Wl~Gsl~~~~w~~~~~~~~~~~~~~~~~~~~~~~L~~l  220 (335)
T PRK10441        141 QGGGQLSPVRLTLAGVALAAVLEGLTSGIALLNPDVYDQLRFWQAGSLDIRNLHTLKVVLIPVLIAGATALLLSRALNSL  220 (335)
T ss_pred             HCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             74898754999999999999999999999992979999999997777557778999999999999999999999999999


Q ss_pred             HCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             24688998717871046779999999999999999899999999999999998520898999999999999999999999
Q gi|254780539|r  160 FFDERHAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYI  239 (273)
Q Consensus       160 sfD~~~A~~~Gi~v~~~~~l~l~l~al~v~~~v~~vG~llv~allv~Paa~A~~~~~~~~~~~~~s~~~g~~~~~~G~~l  239 (273)
T Consensus       221 ~lGd~~A~sLGv~v~~~r~~~l~~a~ll~a~~Va~~G~IgFVGL-i~PHiaR~l~g~~~~~~lp~sal~Ga~lll~aD~~  299 (335)
T PRK10441        221 SLGSDTATALGSRVARTQLIGLLAITVLCGSATAVVGPIAFIGL-MMPHMARWLVGADHRWSLPVTLLATPALLLFADII  299 (335)
T ss_pred             HCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHH-HHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             77969998689969999999999999999999993753867996-29999999818885408999999999999999999


Q ss_pred             HHHH---CCCCHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             9995---7981899999999999999998042445
Q gi|254780539|r  240 SYFL---DCSPGGIIVIIETSLFLLCLFFFSKQYR  271 (273)
Q Consensus       240 S~~~---~lp~g~~Iv~~~~~~f~~~~~~~~~~~r  271 (273)
T Consensus       300 ~R~~~p~eiPvG-iitaliG~P~fl~Ll~r~~rgg  333 (335)
T PRK10441        300 GRLLVPGELRVS-VVSAFIGAPVLIFLVRRKTRGG  333 (335)
T ss_pred             HHHCCCCCCHHH-HHHHHHHHHHHHHHHHHCCCCC
T ss_conf             987566561099-9999998999999998264678