HHsearch alignment for GI: 254780539 and conserved domain: PRK10577

>PRK10577 iron-hydroxamate transporter permease subunit; Provisional.
Probab=99.93  E-value=3.1e-22  Score=144.18  Aligned_cols=244  Identities=15%  Similarity=0.212  Sum_probs=161.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHHHHHHHCC-----CCHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             9999999998777999999658996324--------8999999999998314-----41456899999999999986310
Q gi|254780539|r   19 WMSTLIGCVCGLLSAYLILKGWSSIGNG--------ISHAIFPGIVVCHRLN-----IPLSVGATISGMLATGIMVKIKE   85 (273)
Q Consensus        19 l~~~li~~~~~~lG~~~v~r~~s~~~~a--------lsH~~l~Giala~~l~-----~~~~~ga~~~~ll~~~li~~l~~   85 (273)
T Consensus       401 l~A~l~Ga~La~aG~ll----Q~l~rNPLAsP~iLGissGA~lg~v~~~~~~~~~~~~~~~~~a~~Gal~~~~lv~~l~~  476 (666)
T PRK10577        401 LAALLAGALLAVAGVLL----QRLTRNPLASPEVLGVSSGAALGVVLALFLVPGAGFGWLLAAALLGAAAALLLILLLAR  476 (666)
T ss_pred             HHHHHHHHHHHHHHHHH----HHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999----99847988897354148649999999999988887899999999999999999999982


Q ss_pred             CCCCCHHH--HHHHHHHHHHHHHH-HHHHHHC-CCCCCCHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             24651156--89999999999999-9752110-22242112115310027000135788767999999998887888724
Q gi|254780539|r   86 TTKLREDV--AIAVVYIIFYSFAM-FMLSLSP-SAVYVENIFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLLFF  161 (273)
Q Consensus        86 ~~~~~~d~--~igi~~~~~~algv-llis~~~-~~~~l~~~LfG~il~i~~~di~~~~~~~~i~~~~~~~~~r~l~~~sf  161 (273)
T Consensus       477 ~~~~~~~~liL~Giaisa~~~Al~~~l~~~~~~~~~~~~~Wl~Gs~~~~~~~~~~~~~~~~~~~~~~~~~~~r~L~lL~L  556 (666)
T PRK10577        477 RHGFAPERLLLTGIALSALFTALLQILLASGDPRAAQLLTWLSGSTYGVTWAQALLLLIVAVILLAVALLLRRWLDLLPL  556 (666)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHC
T ss_conf             57998189999999999999999999998088879999999967624688889999999999999999999875723526


Q ss_pred             CHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             68899871787104677999999999999999989999999999999999852089899999999999999999999999
Q gi|254780539|r  162 DERHAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYISY  241 (273)
Q Consensus       162 D~~~A~~~Gi~v~~~~~l~l~l~al~v~~~v~~vG~llv~allv~Paa~A~~~~~~~~~~~~~s~~~g~~~~~~G~~lS~  241 (273)
T Consensus       557 Gd~~A~sLGv~v~~~r~~~l~~a~llta~ava~~G~I~FVGL-iaPHiaR~l~g~~~~~~l~~sal~Ga~lll~aD~l~R  635 (666)
T PRK10577        557 GDDTARALGLPLTRARLALLLLAALLTAAATATVGPLSFVGL-MAPHLARMLGFRRARPQLLIAALLGALLMVLADWLGR  635 (666)
T ss_pred             CHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             989998789978999999999999999999997059999999-7999999982888633899999999999999999884


Q ss_pred             H----HCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             9----57981899999999999999998042
Q gi|254780539|r  242 F----LDCSPGGIIVIIETSLFLLCLFFFSK  268 (273)
Q Consensus       242 ~----~~lp~g~~Iv~~~~~~f~~~~~~~~~  268 (273)
T Consensus       636 ~~~~P~eiPvG-ivtaliG~P~fl~Ll~r~~  665 (666)
T PRK10577        636 TLLFPYQIPAG-LLAALIGAPYFLWLLRKQS  665 (666)
T ss_pred             HCCCCCCCCHH-HHHHHHHHHHHHHHHHCCC
T ss_conf             33886560299-9999999999999862057