HHsearch alignment for GI: 254780539 and conserved domain: cd06550

>cd06550 TM_ABC_iron-siderophores_like Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP which delivers it to a gated translocation pathway formed by the two TMs. The TMs are bundles of alpha helices that transverse the cytoplasmic membrane multiple times. The two ABCs bind and hydrolyze ATP and drive the transport reaction. Each TM has a prominent cytoplasmic loop which contacts an ABC and represents a conserved motif. The two TMs form either a homodimer (e.g. in the case of the BtuC subunits of the Escherichia coli BtuCD vitamin B12 transporter), a heterodimer (e.g. the TroC and TroD subunits of the Treponema pallidum general transition metal
Probab=100.00  E-value=3.9e-34  Score=211.67  Aligned_cols=246  Identities=26%  Similarity=0.370  Sum_probs=215.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-----HHHHHHHHHHHHHHHHHHHHC--CC
Q ss_conf             99999999999998777999999658996324899999999999831441-----456899999999999986310--24
Q gi|254780539|r   15 NTAIWMSTLIGCVCGLLSAYLILKGWSSIGNGISHAIFPGIVVCHRLNIP-----LSVGATISGMLATGIMVKIKE--TT   87 (273)
Q Consensus        15 ~~all~~~li~~~~~~lG~~~v~r~~s~~~~alsH~~l~Giala~~l~~~-----~~~ga~~~~ll~~~li~~l~~--~~   87 (273)
T Consensus         2 l~a~l~G~~L~~aG~~~Q~~~rN~la~p~~lGis~gA~lg~~l~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (261)
T cd06550           2 LAALLVGAALAVSGAILQSLTRNRLASPSILGISHGALLGVVLALLLGIGLSNYALGAFAFAGALAIALLVLLLASRGGL   81 (261)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999999999999998089887960858999999999999999877778999999999999999999999973798


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHC--CCCCCCHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHH
Q ss_conf             651156899999999999999752110--222421121153100270001357887679999999988878887246889
Q gi|254780539|r   88 KLREDVAIAVVYIIFYSFAMFMLSLSP--SAVYVENIFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLLFFDERH  165 (273)
Q Consensus        88 ~~~~d~~igi~~~~~~algvllis~~~--~~~~l~~~LfG~il~i~~~di~~~~~~~~i~~~~~~~~~r~l~~~sfD~~~  165 (273)
T Consensus        82 ~~~~liL~Gi~is~~~~a~~~~l~~~~~~~~~~~~~wl~Gs~~~~~~~~~~~~~~~~~i~~~~~~~~~~~l~~l~~~~~~  161 (261)
T cd06550          82 SPSKLILIGIVLSAFFSAGVILISLLSDDSLQDLNIWLFGSILGVTWEDLLILLIILLLVLLLLLLLSRKLNLLTFDEDL  161 (261)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHH
T ss_conf             73999999999999999999999874767689999998356457879999999999999999999999999999789899


Q ss_pred             HHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH--
Q ss_conf             987178710467799999999999999998999999999999999985208989999999999999999999999995--
Q gi|254780539|r  166 AHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYISYFL--  243 (273)
Q Consensus       166 A~~~Gi~v~~~~~l~l~l~al~v~~~v~~vG~llv~allv~Paa~A~~~~~~~~~~~~~s~~~g~~~~~~G~~lS~~~--  243 (273)
T Consensus       162 A~~lGi~v~~~~~~~l~l~~~~~~~~v~~vG~i~fvGL-i~P~iar~l~~~~~~~~l~~s~l~G~~l~~~~d~i~r~~~~  240 (261)
T cd06550         162 AKSLGINVNLLRLLLLLLVALLVVAAVALVGVILFVGL-IAPHLARRLFGRSHRYLLPLSALLGAILLLLGDLLSRTLLP  240 (261)
T ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             88769969999999999999999999998479999999-99999999848884439999999999999999999988366


Q ss_pred             -CCCCHHHHHHHHHHHHHH
Q ss_conf             -798189999999999999
Q gi|254780539|r  244 -DCSPGGIIVIIETSLFLL  261 (273)
Q Consensus       244 -~lp~g~~Iv~~~~~~f~~  261 (273)
T Consensus       241 ~~~p~g~v~~liG~p~fl~  259 (261)
T cd06550         241 SELPVGPVTALLGAPYFLY  259 (261)
T ss_pred             CCCCHHHHHHHHHHHHHHH
T ss_conf             5640999999999999998