Query         gi|254780539|ref|YP_003064952.1| ABC transporter, membrane spanning protein (iron) [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 273
No_of_seqs    134 out of 2518
Neff          7.1 
Searched_HMMs 23785
Date          Tue May 31 19:51:09 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780539.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 2nq2_A Hypothetical ABC transp  99.9 3.1E-21 1.3E-25  137.3  21.8  248   18-271    66-334 (337)
  2 2qi9_A Vitamin B12 import syst  99.9 3.9E-20 1.6E-24  131.1  20.0  244   18-269    60-326 (326)
  3 2jo1_A Phospholemman; FXYD1, N  43.7      12  0.0005   14.9   4.0   33    6-39      6-38  (72)
  4 2zxe_G FXYD10, phospholemman-l  41.2      13 0.00055   14.7   3.7   31    6-37      9-39  (74)
  5 2jp3_A FXYD domain-containing   38.8      14  0.0006   14.5   3.9   31    7-38      8-38  (67)
  6 3gia_A Uncharacterized protein  17.5      36  0.0015   12.2  10.0   84  188-272   342-426 (444)
  7 3io5_A Recombination and repai   9.7      62  0.0026   10.8   1.5   17  160-176    69-85  (333)
  8 1afo_A Glycophorin A; integral   9.4      64  0.0027   10.8   1.7   11  227-237    16-26  (40)
  9 2zr9_A Protein RECA, recombina   9.0      67  0.0028   10.7   1.6   17  160-176   100-116 (349)
 10 1tba_A TAFII230, transcription   8.4      68  0.0029   10.6   0.2   13  116-128     7-19  (67)

No 1  
>2nq2_A Hypothetical ABC transporter permease protein HI1471; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae}
Probab=99.90  E-value=3.1e-21  Score=137.27  Aligned_cols=248  Identities=15%  Similarity=0.145  Sum_probs=182.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHHHHHHHHCCCCH---HHHHHHHHHHHHHHHHHHHC-
Q ss_conf             9999999999877799999965899632--------48999999999998314414---56899999999999986310-
Q gi|254780539|r   18 IWMSTLIGCVCGLLSAYLILKGWSSIGN--------GISHAIFPGIVVCHRLNIPL---SVGATISGMLATGIMVKIKE-   85 (273)
Q Consensus        18 ll~~~li~~~~~~lG~~~v~r~~s~~~~--------alsH~~l~Giala~~l~~~~---~~ga~~~~ll~~~li~~l~~-   85 (273)
                      .+++.++|...+.-|...    |+...+        +++..+-.|++++.+++.+.   ......++.........+.. 
T Consensus        66 ~l~a~l~Ga~LavaG~ll----Q~~~rNpLA~P~iLGissGA~lg~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  141 (337)
T 2nq2_A           66 ILTALCVGAGLALSGVVL----QGIFRNPLVNPHIIGVTSGSAFGGTLAIFFGFSLYGLFTSTILFGFGTLALVFLFSFK  141 (337)
T ss_dssp             HHHHHHHHHHHHHHHHHH----HHHTTCTTCCTTTTSHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHHHHH----HHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999----9865799999066548999999999999984002257899999999999999999996


Q ss_pred             CCCCCHH--HHHHHHHHHHHHHHHHHH-HHHCC---CCCCCHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2465115--689999999999999975-21102---22421121153100270001357887679999999988878887
Q gi|254780539|r   86 TTKLRED--VAIAVVYIIFYSFAMFML-SLSPS---AVYVENIFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVLL  159 (273)
Q Consensus        86 ~~~~~~d--~~igi~~~~~~algvlli-s~~~~---~~~l~~~LfG~il~i~~~di~~~~~~~~i~~~~~~~~~r~l~~~  159 (273)
                      +++.+..  ..+|+..+..++....+. ....+   ..+...|++||....+|+|++...+...+......+..|+++..
T Consensus       142 ~~~~~~~~liL~gi~~~~~~~a~~~~~~~l~~~~~~~~~~~~W~~Gs~~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~~l  221 (337)
T 2nq2_A          142 FNQRSLLMLILIGMILSGLFSALVSLLQYISDTEEKLPSIVFWLMGSFATSNWEKLLFFFVPFLLCSSILLSLSWRLNLL  221 (337)
T ss_dssp             ----CHHHHHHHHHHHHHHHHHHHHHHHHSSCTTTHHHHHHHHTTCCSTTCCHHHHHHHHHHHHHHHHHHHHTTTGGGGG
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHCCCCHH
T ss_conf             47787217787679999999999999999722488999999985014356884321331121147888888863005621


Q ss_pred             HCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             24688998717871046779999999999999999899999999999999998520898999999999999999999999
Q gi|254780539|r  160 FFDERHAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYI  239 (273)
Q Consensus       160 sfD~~~A~~~Gi~v~~~~~l~l~l~al~v~~~v~~vG~llv~allv~Paa~A~~~~~~~~~~~~~s~~~g~~~~~~G~~l  239 (273)
                      .+|||.|++.|+|+++.+...+.+.++.++.++..+|.+-+.++ +.|+.+.+...+++++.++.|.+.|..-......+
T Consensus       222 ~lG~~~A~sLGv~v~~~r~~~l~l~~llta~~vs~~G~I~FvGL-i~Phiar~l~g~~~~~~l~~s~l~Ga~lll~aD~i  300 (337)
T 2nq2_A          222 SLDEKEAKALGVKMAPLRWLVIFLSGSLVACQVAISGSIGWVGL-IIPHLSRMLVGANHQSLLPCTMLVGATYMLLVDNV  300 (337)
T ss_dssp             GSCHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHCCCCSSTT-HHHHHHHHHHCSCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEHHH-HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             07938898789979999999999999999999963776303874-09999999818885339999999999999999999


Q ss_pred             HHHH---CCCCHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             9995---7981899999999999999998042445
Q gi|254780539|r  240 SYFL---DCSPGGIIVIIETSLFLLCLFFFSKQYR  271 (273)
Q Consensus       240 S~~~---~lp~g~~Iv~~~~~~f~~~~~~~~~~~r  271 (273)
                      +...   ++|.|-. ..+.+..|++.++..+||++
T Consensus       301 ~r~l~p~elPvG~v-taliG~p~fl~ll~r~~r~g  334 (337)
T 2nq2_A          301 ARSLSDAEIPISIL-TALIGAPLFGVLVYKLKRGG  334 (337)
T ss_dssp             HHHSCSSCCCHHHH-HHHHHHHHHHHHHHCC----
T ss_pred             HHHCCCCCEEHHHH-HHHHHHHHHHHHHHHHHCCC
T ss_conf             86656777319999-99999999999999852077


No 2  
>2qi9_A Vitamin B12 import system permease protein BTUC; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_A*
Probab=99.87  E-value=3.9e-20  Score=131.08  Aligned_cols=244  Identities=14%  Similarity=0.168  Sum_probs=172.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHHHHHHHHCCCC------HHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999877799999965899632--------4899999999999831441------4568999999999999863
Q gi|254780539|r   18 IWMSTLIGCVCGLLSAYLILKGWSSIGN--------GISHAIFPGIVVCHRLNIP------LSVGATISGMLATGIMVKI   83 (273)
Q Consensus        18 ll~~~li~~~~~~lG~~~v~r~~s~~~~--------alsH~~l~Giala~~l~~~------~~~ga~~~~ll~~~li~~l   83 (273)
                      .+++.++|...+.-|...    |+...+        ++++.+-.|++++..++..      ....++.++..........
T Consensus        60 ~l~a~l~Ga~LavsG~~l----Q~~~rNpLA~P~iLGissGA~lg~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~  135 (326)
T 2qi9_A           60 TLAVLLVGAALAISGAVM----QALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWALGLSAIAGALIITLILLRF  135 (326)
T ss_dssp             HHHHHHHHHHHHHHHHHH----HHHTTCSSCCGGGGTHHHHHHHHHHHHHHHHTTCSCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHH----HHHHCCCCCCCCHHCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999----9995798878402222016999999999963026789999999999999999999988


Q ss_pred             HCCCCCCHH--HHHHHHHHHHHHHHHHH-HHHH-CC-CCCCCHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             102465115--68999999999999997-5211-02-2242112115310027000135788767999999998887888
Q gi|254780539|r   84 KETTKLRED--VAIAVVYIIFYSFAMFM-LSLS-PS-AVYVENIFLGNTLSMSRSDTIQVLIITFSVACIVYMKWKDFVL  158 (273)
Q Consensus        84 ~~~~~~~~d--~~igi~~~~~~algvll-is~~-~~-~~~l~~~LfG~il~i~~~di~~~~~~~~i~~~~~~~~~r~l~~  158 (273)
                      .++ +.+..  ...|+..+..++....+ .... +. ..++..|+.|+....+|+|++...+..... .......|+++.
T Consensus       136 ~~~-~~~~~~liL~Gi~i~~~~~a~~~~l~~~~~~~~~~~~~~w~~Gs~~~~~~~~~~~~~~~~~~~-~~~~~~~~~L~~  213 (326)
T 2qi9_A          136 ARR-HLSTSRLLLAGVALGIISSALMTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQSWLMLALIPVL-LWISSQSRPMNM  213 (326)
T ss_dssp             HTT-CCCHHHHHHHHHHHHHHHHHHHHHHHHTCCTTHHHHHHHHHTCCCTTCCGGGHHHHTTTHHHH-HHHTTCHHHHHH
T ss_pred             HCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHH-HHHHHHHHHHHH
T ss_conf             535-565058899999999999999999998168999999999973477788746778899999999-999999988777


Q ss_pred             HHCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             72468899871787104677999999999999999989999999999999999852089899999999999999999999
Q gi|254780539|r  159 LFFDERHAHSVGINVKLLKMLFFSLLTITIVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSY  238 (273)
Q Consensus       159 ~sfD~~~A~~~Gi~v~~~~~l~l~l~al~v~~~v~~vG~llv~allv~Paa~A~~~~~~~~~~~~~s~~~g~~~~~~G~~  238 (273)
                      .+.|||.|++.|+|+++.+...+.+.++.++.++..+|.+-+.++ +.|+.+.+..++++|+.++.|.++|.........
T Consensus       214 l~lG~~~A~sLGv~v~~~r~~~l~~~~ll~a~~va~~G~I~FvGL-i~PhiaR~~~g~~~~~~l~~s~l~Ga~lll~aD~  292 (326)
T 2qi9_A          214 LALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGL-VIPHILRLSGLTDHRVLLPGCALAGASALLLADI  292 (326)
T ss_dssp             HHTCHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHHHHCCCCSSTT-HHHHHHHTTTCCSHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHH-HHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             636849888679858998899886889999999985156999999-8999999862777436999999999999999999


Q ss_pred             HHHH----HCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             9999----579818999999999999999980424
Q gi|254780539|r  239 ISYF----LDCSPGGIIVIIETSLFLLCLFFFSKQ  269 (273)
Q Consensus       239 lS~~----~~lp~g~~Iv~~~~~~f~~~~~~~~~~  269 (273)
                      ++..    .++|.|-. ..+.|..|++.++..++|
T Consensus       293 i~r~i~~p~eiPvGvi-taliG~P~fi~Ll~r~~R  326 (326)
T 2qi9_A          293 VARLALAAAELPIGVV-TATLGAPVFIWLLLKAGR  326 (326)
T ss_dssp             HHHSSSTTCCCCHHHH-HHHHHHHHHHHHHSCC--
T ss_pred             HHHHHCCCCCCHHHHH-HHHHHHHHHHHHHHHCCC
T ss_conf             9966146654219999-999999999997720479


No 3  
>2jo1_A Phospholemman; FXYD1, Na,K-ATPase, micelle, hydrolase regulator; NMR {Homo sapiens}
Probab=43.68  E-value=12  Score=14.90  Aligned_cols=33  Identities=24%  Similarity=0.452  Sum_probs=20.6

Q ss_pred             HHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7463257999999999999999877799999965
Q gi|254780539|r    6 LEPFTYNYMNTAIWMSTLIGCVCGLLSAYLILKG   39 (273)
Q Consensus         6 ~~~~~~~f~~~all~~~li~~~~~~lG~~~v~r~   39 (273)
                      .+||.|+| ++-=+.|++.+.+.-++|.++++-+
T Consensus         6 ~DPF~YDY-~tLRiGGLi~a~vlf~~GiliilS~   38 (72)
T 2jo1_A            6 HDPFTYDY-QSLQIGGLVIAGILFILGILIVLSR   38 (72)
T ss_dssp             HSGGGCST-HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCH-HHHEECCCHHHHHHHHHHHHHHHCC
T ss_conf             79851441-7850544245899999999999858


No 4  
>2zxe_G FXYD10, phospholemman-like protein; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_G*
Probab=41.16  E-value=13  Score=14.67  Aligned_cols=31  Identities=23%  Similarity=0.418  Sum_probs=18.8

Q ss_pred             HHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             74632579999999999999998777999999
Q gi|254780539|r    6 LEPFTYNYMNTAIWMSTLIGCVCGLLSAYLIL   37 (273)
Q Consensus         6 ~~~~~~~f~~~all~~~li~~~~~~lG~~~v~   37 (273)
                      -++|.|+| ++-=+.|++.+.+.-++|.++++
T Consensus         9 ~dpF~YDy-~tLRigGLi~a~vLf~~GI~iil   39 (74)
T 2zxe_G            9 DERFTYDY-YRLRVVGLIVAAVLCVIGIIILL   39 (74)
T ss_dssp             GGGGCCCH-HHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCCCCCH-HHHHCCCCHHHHHHHHHHHHHHH
T ss_conf             89851432-78503220679999999999998


No 5  
>2jp3_A FXYD domain-containing ION transport regulator 4; protein, transcription; NMR {Rattus norvegicus}
Probab=38.76  E-value=14  Score=14.45  Aligned_cols=31  Identities=19%  Similarity=0.369  Sum_probs=18.7

Q ss_pred             HHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             46325799999999999999987779999996
Q gi|254780539|r    7 EPFTYNYMNTAIWMSTLIGCVCGLLSAYLILK   38 (273)
Q Consensus         7 ~~~~~~f~~~all~~~li~~~~~~lG~~~v~r   38 (273)
                      ++|.|+| ++-=+.|++.+.+.-.+|.++++.
T Consensus         8 ~pF~YDy-~tLRigGLi~a~vlf~~GiliilS   38 (67)
T 2jp3_A            8 SPFYYDW-ESLQLGGLIFGGLLCIAGIALALS   38 (67)
T ss_dssp             SGGGGGG-HHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCCCCH-HHHEECCCHHHHHHHHHHHHHHHC
T ss_conf             9861431-784143415799999999999986


No 6  
>3gia_A Uncharacterized protein MJ0609; membrane protein, transporter, cell membrane, membrane, transmembrane, transport protein; HET: D10 BCN; 2.32A {Methanocaldococcus jannaschii} PDB: 3gi9_C* 3gi8_C
Probab=17.47  E-value=36  Score=12.17  Aligned_cols=84  Identities=11%  Similarity=-0.032  Sum_probs=30.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHC
Q ss_conf             999999989999999999999999852089899999999999999999999999957981-8999999999999999980
Q gi|254780539|r  188 IVIGFQTVGILLVIATVITPGATAKLMSKSFGTYLVSSSLLGATSSFLGSYISYFLDCSP-GGIIVIIETSLFLLCLFFF  266 (273)
Q Consensus       188 v~~~v~~vG~llv~allv~Paa~A~~~~~~~~~~~~~s~~~g~~~~~~G~~lS~~~~lp~-g~~Iv~~~~~~f~~~~~~~  266 (273)
                      ........+.++...+.......-|...+..++....+. +.............+.+.+. -..+..+...+.+...++.
T Consensus       342 ~l~~~~~~~~~i~~~~~~~~~~~l~~~~~~~~~~~~~~~-i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~  420 (444)
T 3gia_A          342 GVASITSAVFMVIYLFVILSHYILIDEVGGRKEIVIFSF-IVVLGVFLLLLYYQWITNRFVFYGIIATFIGVLIFEIIYR  420 (444)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHTHHHHCCCHHHHHHHH-HHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999999999885277888501899-9999999999999987059999999999999999999999


Q ss_pred             CCCCCC
Q ss_conf             424457
Q gi|254780539|r  267 SKQYRT  272 (273)
Q Consensus       267 ~~~~r~  272 (273)
                      ++++|+
T Consensus       421 ~~~~~~  426 (444)
T 3gia_A          421 KVTKRT  426 (444)
T ss_dssp             HHHCCC
T ss_pred             HHHCCC
T ss_conf             870434


No 7  
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4}
Probab=9.69  E-value=62  Score=10.84  Aligned_cols=17  Identities=12%  Similarity=0.131  Sum_probs=12.0

Q ss_pred             HCCHHHHHHCCCCCHHH
Q ss_conf             24688998717871046
Q gi|254780539|r  160 FFDERHAHSVGINVKLL  176 (273)
Q Consensus       160 sfD~~~A~~~Gi~v~~~  176 (273)
                      +|||++|+..|+++..+
T Consensus        69 ~~~~~~a~~lGvd~~~l   85 (333)
T 3io5_A           69 GITPAYLRSMGVDPERV   85 (333)
T ss_dssp             CCCHHHHHHTTCCGGGE
T ss_pred             CCCHHHHHHCCCCCCCC
T ss_conf             78989999809881005


No 8  
>1afo_A Glycophorin A; integral membrane protein, transmembrane helix interactions, membrane protein folding; NMR {Homo sapiens} SCOP: j.35.1.1
Probab=9.43  E-value=64  Score=10.78  Aligned_cols=11  Identities=18%  Similarity=0.709  Sum_probs=3.8

Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999999
Q gi|254780539|r  227 LLGATSSFLGS  237 (273)
Q Consensus       227 ~~g~~~~~~G~  237 (273)
                      ++|+.+++.|.
T Consensus        16 i~gvmagvigt   26 (40)
T 1afo_A           16 IFGVMAGVIGT   26 (40)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHHH
T ss_conf             99999989999


No 9  
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, cytoplasm, DNA damage, DNA recombination; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ...
Probab=8.97  E-value=67  Score=10.67  Aligned_cols=17  Identities=24%  Similarity=0.419  Sum_probs=13.1

Q ss_pred             HCCHHHHHHCCCCCHHH
Q ss_conf             24688998717871046
Q gi|254780539|r  160 FFDERHAHSVGINVKLL  176 (273)
Q Consensus       160 sfD~~~A~~~Gi~v~~~  176 (273)
                      +|||++|+..|+++..+
T Consensus       100 ~~~~~~a~~~GvD~~~l  116 (349)
T 2zr9_A          100 ALDPEYAKKLGVDTDSL  116 (349)
T ss_dssp             CCCHHHHHHTTCCGGGC
T ss_pred             CCCHHHHHHCCCCHHHE
T ss_conf             58999999839988996


No 10 
>1tba_A TAFII230, transcription initiation factor IID 230K chain; complex (transcription factors), TAF, TAFII230, solution structure; NMR {Drosophila melanogaster} SCOP: a.15.1.1
Probab=8.41  E-value=68  Score=10.61  Aligned_cols=13  Identities=23%  Similarity=0.396  Sum_probs=9.7

Q ss_pred             CCCCCHHHCCCCC
Q ss_conf             2242112115310
Q gi|254780539|r  116 AVYVENIFLGNTL  128 (273)
Q Consensus       116 ~~~l~~~LfG~il  128 (273)
                      ..++.++||||+-
T Consensus         7 ~~~LtGfLFGNId   19 (67)
T 1tba_A            7 GLDLTGILFGNID   19 (67)
T ss_dssp             SCCCTTHHHHCEE
T ss_pred             CCCEEEEEECCCC
T ss_conf             7210122442437


Done!