BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780542|ref|YP_003064955.1| hypothetical protein
CLIBASIA_02145 [Candidatus Liberibacter asiaticus str. psy62]
         (210 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780542|ref|YP_003064955.1| hypothetical protein CLIBASIA_02145 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040219|gb|ACT57015.1| hypothetical protein CLIBASIA_02145 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 210

 Score =  430 bits (1106), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 210/210 (100%), Positives = 210/210 (100%)

Query: 1   MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLII 60
           MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLII
Sbjct: 1   MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLII 60

Query: 61  KPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ 120
           KPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ
Sbjct: 61  KPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ 120

Query: 121 CKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMD 180
           CKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMD
Sbjct: 121 CKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMD 180

Query: 181 LKGRPIQELGNNLSDSGLNEQDHNDVQISK 210
           LKGRPIQELGNNLSDSGLNEQDHNDVQISK
Sbjct: 181 LKGRPIQELGNNLSDSGLNEQDHNDVQISK 210


>gi|315122870|ref|YP_004063359.1| hypothetical protein CKC_05630 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496272|gb|ADR52871.1| hypothetical protein CKC_05630 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 193

 Score =  217 bits (553), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 130/181 (71%), Gaps = 3/181 (1%)

Query: 1   MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLII 60
           MK++VL L + F F+ A    SARF NK+AEFAGMDKITGR+L FDV+IN+S QFGSL I
Sbjct: 1   MKHKVLFLAVLFFFNTAGIVKSARFENKIAEFAGMDKITGRILRFDVDINRSVQFGSLKI 60

Query: 61  KPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ 120
            PMVCYSRDD+E QR+D+FVSISEI TD  VRSIFSGWMFADSPAMNAIDHSIYD+WL+Q
Sbjct: 61  TPMVCYSRDDKEIQRVDSFVSISEISTDHTVRSIFSGWMFADSPAMNAIDHSIYDVWLIQ 120

Query: 121 CKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSS---SNKTLEKESSQPLENNL 177
           CK+PI DS  NS   S        + +       K+S  S   S+  L+K  +Q  ENNL
Sbjct: 121 CKNPIKDSDKNSTRYSTPVPKMTVTENPDDNSIPKASSQSIEISDAHLDKNYNQKSENNL 180

Query: 178 S 178
           +
Sbjct: 181 N 181


>gi|222148330|ref|YP_002549287.1| hypothetical protein Avi_1785 [Agrobacterium vitis S4]
 gi|221735318|gb|ACM36281.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 171

 Score =  150 bits (380), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 65/115 (56%), Positives = 85/115 (73%)

Query: 8   LILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYS 67
           L + F  +    A++AR +N VA F+G+DKITGR+  FDV +N++ QFG+L + P  CYS
Sbjct: 47  LTVAFSITATVPADAARISNAVAVFSGLDKITGRITEFDVYLNETVQFGALQVTPKACYS 106

Query: 68  RDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           RD+ EAQ +DAFV + EI  DR +R IFSGWMFADSPA+NAI+H IYD+WL  CK
Sbjct: 107 RDETEAQHVDAFVQVDEITLDRRIRQIFSGWMFADSPALNAIEHPIYDVWLKDCK 161


>gi|153009606|ref|YP_001370821.1| hypothetical protein Oant_2276 [Ochrobactrum anthropi ATCC 49188]
 gi|151561494|gb|ABS14992.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188]
          Length = 156

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 65/119 (54%), Positives = 84/119 (70%)

Query: 4   RVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           +V L+ L    S  + A + R  N VAEF+G+DKITGR+ TFDV IN++ QFG+L + P 
Sbjct: 26  QVALISLIATTSSFQAAMAERITNPVAEFSGLDKITGRITTFDVYINETVQFGALQVTPK 85

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           VCYSR + EA R D FV + EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 86  VCYSRTENEAPRTDGFVEVEEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK 144


>gi|222085635|ref|YP_002544165.1| hypothetical protein Arad_1920 [Agrobacterium radiobacter K84]
 gi|221723083|gb|ACM26239.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 146

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 80/103 (77%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A +AR +N VA F+G+DKITGR+ TFDV +N++ QFG+L + P  CYSRDD E Q++D F
Sbjct: 30  AEAARISNPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKACYSRDDTEQQKVDGF 89

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V + EI  DR +R IF+GWMFADSP +NA++H IYD+WL +CK
Sbjct: 90  VEVDEITLDRRIRRIFTGWMFADSPGLNAVEHPIYDVWLKECK 132


>gi|306843802|ref|ZP_07476400.1| Hypothetical protein BIBO1_0463 [Brucella sp. BO1]
 gi|306275880|gb|EFM57596.1| Hypothetical protein BIBO1_0463 [Brucella sp. BO1]
          Length = 151

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 66/118 (55%), Positives = 88/118 (74%), Gaps = 3/118 (2%)

Query: 6   LLLILFFVFS-HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMV 64
           L+ +L  + S HA  A + R +N VA+F+G+DKITGR+ TFDV IN++ QFG+L + P V
Sbjct: 24  LITVLAGIGSLHA--ARAERISNPVAQFSGLDKITGRITTFDVYINETVQFGALQVTPKV 81

Query: 65  CYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           CYSR + EA R DAFV++ EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 82  CYSRTEDEAPRTDAFVTVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK 139


>gi|265983997|ref|ZP_06096732.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|264662589|gb|EEZ32850.1| conserved hypothetical protein [Brucella sp. 83/13]
          Length = 151

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 80/103 (77%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A + R +N VA+F+G+DKITGR+ TFDV IN++ QFG+L + P VCYSR + EA R DAF
Sbjct: 37  ARAERISNPVAQFSGLDKITGRITTFDVYINETVQFGALQVTPKVCYSRTEDEAPRTDAF 96

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V++ EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 97  VTVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK 139


>gi|254719007|ref|ZP_05180818.1| hypothetical protein Bru83_05609 [Brucella sp. 83/13]
 gi|306840106|ref|ZP_07472892.1| Hypothetical protein BROD_2979 [Brucella sp. NF 2653]
 gi|306404834|gb|EFM61127.1| Hypothetical protein BROD_2979 [Brucella sp. NF 2653]
          Length = 156

 Score =  147 bits (372), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 80/103 (77%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A + R +N VA+F+G+DKITGR+ TFDV IN++ QFG+L + P VCYSR + EA R DAF
Sbjct: 42  ARAERISNPVAQFSGLDKITGRITTFDVYINETVQFGALQVTPKVCYSRTEDEAPRTDAF 101

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V++ EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 102 VTVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK 144


>gi|306840398|ref|ZP_07473163.1| Hypothetical protein BIBO2_0198 [Brucella sp. BO2]
 gi|306289636|gb|EFM60840.1| Hypothetical protein BIBO2_0198 [Brucella sp. BO2]
          Length = 156

 Score =  147 bits (372), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 80/103 (77%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A + R +N VA+F+G+DKITGR+ TFDV IN++ QFG+L + P VCYSR + EA R DAF
Sbjct: 42  ARAERISNPVAQFSGLDKITGRITTFDVYINETVQFGALQVTPKVCYSRTEDEAPRTDAF 101

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V++ EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 102 VTVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK 144


>gi|239831781|ref|ZP_04680110.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824048|gb|EEQ95616.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 162

 Score =  147 bits (372), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 88/124 (70%), Gaps = 2/124 (1%)

Query: 1   MKYRVLLLILFFVFSHAKF--ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSL 58
           +K  V L ++ F+ + + F  A + R  N VAEF+G+DKITGR+ TFDV IN++ QFG+L
Sbjct: 27  IKRAVQLALISFMATASCFQAAMAERITNPVAEFSGLDKITGRITTFDVYINETVQFGAL 86

Query: 59  IIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWL 118
            + P VCYSR + EA R D FV + EI  DR +R IF+GWMFADSP +NA++H IYD+WL
Sbjct: 87  QVTPKVCYSRTENEAPRTDGFVQVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWL 146

Query: 119 MQCK 122
             CK
Sbjct: 147 KDCK 150


>gi|23501790|ref|NP_697917.1| hypothetical protein BR0904 [Brucella suis 1330]
 gi|62289847|ref|YP_221640.1| hypothetical protein BruAb1_0915 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699773|ref|YP_414347.1| hypothetical protein BAB1_0922 [Brucella melitensis biovar Abortus
           2308]
 gi|148559612|ref|YP_001258882.1| hypothetical protein BOV_0900 [Brucella ovis ATCC 25840]
 gi|161618862|ref|YP_001592749.1| hypothetical protein BCAN_A0917 [Brucella canis ATCC 23365]
 gi|163843175|ref|YP_001627579.1| hypothetical protein BSUIS_A0943 [Brucella suis ATCC 23445]
 gi|225852416|ref|YP_002732649.1| hypothetical protein BMEA_A0943 [Brucella melitensis ATCC 23457]
 gi|254689153|ref|ZP_05152407.1| hypothetical protein Babob68_02995 [Brucella abortus bv. 6 str.
           870]
 gi|254693636|ref|ZP_05155464.1| hypothetical protein Babob3T_03019 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697288|ref|ZP_05159116.1| hypothetical protein Babob28_06109 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701668|ref|ZP_05163496.1| hypothetical protein Bsuib55_12531 [Brucella suis bv. 5 str. 513]
 gi|254704211|ref|ZP_05166039.1| hypothetical protein Bsuib36_09839 [Brucella suis bv. 3 str. 686]
 gi|254706887|ref|ZP_05168715.1| hypothetical protein BpinM_07851 [Brucella pinnipedialis
           M163/99/10]
 gi|254710005|ref|ZP_05171816.1| hypothetical protein BpinB_06966 [Brucella pinnipedialis B2/94]
 gi|254714006|ref|ZP_05175817.1| hypothetical protein BcetM6_11741 [Brucella ceti M644/93/1]
 gi|254716935|ref|ZP_05178746.1| hypothetical protein BcetM_11037 [Brucella ceti M13/05/1]
 gi|254730186|ref|ZP_05188764.1| hypothetical protein Babob42_03034 [Brucella abortus bv. 4 str.
           292]
 gi|256031500|ref|ZP_05445114.1| hypothetical protein BpinM2_12743 [Brucella pinnipedialis
           M292/94/1]
 gi|256044577|ref|ZP_05447481.1| hypothetical protein Bmelb1R_08773 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256061009|ref|ZP_05451166.1| hypothetical protein Bneo5_11692 [Brucella neotomae 5K33]
 gi|256113450|ref|ZP_05454291.1| hypothetical protein Bmelb3E_11952 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256159625|ref|ZP_05457387.1| hypothetical protein BcetM4_11713 [Brucella ceti M490/95/1]
 gi|256254905|ref|ZP_05460441.1| hypothetical protein BcetB_11530 [Brucella ceti B1/94]
 gi|256257403|ref|ZP_05462939.1| hypothetical protein Babob9C_08584 [Brucella abortus bv. 9 str.
           C68]
 gi|256369332|ref|YP_003106840.1| hypothetical protein BMI_I903 [Brucella microti CCM 4915]
 gi|260168633|ref|ZP_05755444.1| hypothetical protein BruF5_09729 [Brucella sp. F5/99]
 gi|260563928|ref|ZP_05834414.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|261213902|ref|ZP_05928183.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261218741|ref|ZP_05933022.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261222087|ref|ZP_05936368.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261317553|ref|ZP_05956750.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321760|ref|ZP_05960957.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261752220|ref|ZP_05995929.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261754879|ref|ZP_05998588.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261758106|ref|ZP_06001815.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265988587|ref|ZP_06101144.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265994838|ref|ZP_06107395.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265998052|ref|ZP_06110609.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|297248252|ref|ZP_06931970.1| hypothetical protein BAYG_01190 [Brucella abortus bv. 5 str. B3196]
 gi|23347721|gb|AAN29832.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62195979|gb|AAX74279.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615874|emb|CAJ10878.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
           2308]
 gi|148370869|gb|ABQ60848.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gi|161335673|gb|ABX61978.1| Hypothetical protein BCAN_A0917 [Brucella canis ATCC 23365]
 gi|163673898|gb|ABY38009.1| Hypothetical protein BSUIS_A0943 [Brucella suis ATCC 23445]
 gi|225640781|gb|ACO00695.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|255999492|gb|ACU47891.1| hypothetical protein BMI_I903 [Brucella microti CCM 4915]
 gi|260153944|gb|EEW89036.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260915509|gb|EEX82370.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260920671|gb|EEX87324.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260923830|gb|EEX90398.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294450|gb|EEX97946.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261296776|gb|EEY00273.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261738090|gb|EEY26086.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261741973|gb|EEY29899.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261744632|gb|EEY32558.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262552520|gb|EEZ08510.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262765951|gb|EEZ11740.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|264660784|gb|EEZ31045.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|297175421|gb|EFH34768.1| hypothetical protein BAYG_01190 [Brucella abortus bv. 5 str. B3196]
          Length = 156

 Score =  147 bits (372), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 80/103 (77%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A + R +N VA+F+G+DKITGR+ TFDV IN++ QFG+L + P VCYSR + EA R DAF
Sbjct: 42  ARAERISNPVAQFSGLDKITGRITTFDVYINETVQFGALQVTPKVCYSRTEDEAPRTDAF 101

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V++ EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 102 VTVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK 144


>gi|17987348|ref|NP_539982.1| hypothetical protein BMEI1065 [Brucella melitensis bv. 1 str. 16M]
 gi|189024089|ref|YP_001934857.1| hypothetical protein BAbS19_I08620 [Brucella abortus S19]
 gi|260545406|ref|ZP_05821147.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260566541|ref|ZP_05837011.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260754652|ref|ZP_05867000.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260757875|ref|ZP_05870223.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260761698|ref|ZP_05874041.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883678|ref|ZP_05895292.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261314352|ref|ZP_05953549.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261325009|ref|ZP_05964206.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|265991001|ref|ZP_06103558.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265999496|ref|ZP_06111709.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|294852259|ref|ZP_06792932.1| hypothetical protein BAZG_01178 [Brucella sp. NVSL 07-0026]
 gi|17983032|gb|AAL52246.1| retrovirus-related pol polyprotein [Brucella melitensis bv. 1 str.
           16M]
 gi|189019661|gb|ACD72383.1| hypothetical protein BAbS19_I08620 [Brucella abortus S19]
 gi|260096813|gb|EEW80688.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260156059|gb|EEW91139.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260668193|gb|EEX55133.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260672130|gb|EEX58951.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674760|gb|EEX61581.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260873206|gb|EEX80275.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261300989|gb|EEY04486.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261303378|gb|EEY06875.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|263001785|gb|EEZ14360.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094290|gb|EEZ18151.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|294820848|gb|EFG37847.1| hypothetical protein BAZG_01178 [Brucella sp. NVSL 07-0026]
          Length = 151

 Score =  147 bits (372), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 80/103 (77%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A + R +N VA+F+G+DKITGR+ TFDV IN++ QFG+L + P VCYSR + EA R DAF
Sbjct: 37  ARAERISNPVAQFSGLDKITGRITTFDVYINETVQFGALQVTPKVCYSRTEDEAPRTDAF 96

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V++ EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 97  VTVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK 139


>gi|225627393|ref|ZP_03785430.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|237815335|ref|ZP_04594333.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|225617398|gb|EEH14443.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|237790172|gb|EEP64382.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
          Length = 157

 Score =  147 bits (372), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 63/107 (58%), Positives = 82/107 (76%), Gaps = 2/107 (1%)

Query: 16  HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQR 75
           HA  A + R +N VA+F+G+DKITGR+ TFDV IN++ QFG+L + P VCYSR + EA R
Sbjct: 41  HA--ARAERISNPVAQFSGLDKITGRITTFDVYINETVQFGALQVTPKVCYSRTEDEAPR 98

Query: 76  IDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            DAFV++ EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 99  TDAFVTVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK 145


>gi|326408925|gb|ADZ65990.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326538641|gb|ADZ86856.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 121

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 63/107 (58%), Positives = 82/107 (76%), Gaps = 2/107 (1%)

Query: 16  HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQR 75
           HA  A + R +N VA+F+G+DKITGR+ TFDV IN++ QFG+L + P VCYSR + EA R
Sbjct: 5   HA--ARAERISNPVAQFSGLDKITGRITTFDVYINETVQFGALQVTPKVCYSRTEDEAPR 62

Query: 76  IDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            DAFV++ EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 63  TDAFVTVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK 109


>gi|190891554|ref|YP_001978096.1| hypothetical protein RHECIAT_CH0001952 [Rhizobium etli CIAT 652]
 gi|218515121|ref|ZP_03511961.1| hypothetical protein Retl8_16241 [Rhizobium etli 8C-3]
 gi|190696833|gb|ACE90918.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 146

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 78/103 (75%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           AN+AR  N VA F+G+DKITGR+ TFDV +N++ QFG+L + P  CYSRD  EAQ+ID F
Sbjct: 28  ANAARIENPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKACYSRDQAEAQKIDGF 87

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V + EI  DR +R IF+GWMFA SP +NA++H IYD+WL  CK
Sbjct: 88  VEVDEITLDRKIRRIFTGWMFAASPGLNAVEHPIYDVWLKDCK 130


>gi|116251846|ref|YP_767684.1| hypothetical protein RL2086 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115256494|emb|CAK07578.1| conserved hypothetical exported protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 146

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 78/103 (75%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           AN+AR  N VA F+G+DKITGR+ TFDV +N++ QFG+L + P  CYSRD  EAQ+ID F
Sbjct: 28  ANAARIENPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKACYSRDQSEAQKIDGF 87

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V + EI  DR +R IF+GWMFA SP +NA++H IYD+WL  CK
Sbjct: 88  VEVDEITLDRKIRRIFTGWMFAASPGLNAVEHPIYDVWLKDCK 130


>gi|218508641|ref|ZP_03506519.1| hypothetical protein RetlB5_14231 [Rhizobium etli Brasil 5]
          Length = 146

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 78/103 (75%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           AN+AR  N VA F+G+DKITGR+ TFDV +N++ QFG+L + P  CYSRD  EAQ+ID F
Sbjct: 28  ANAARIENPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKACYSRDQAEAQKIDGF 87

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V + EI  DR +R IF+GWMFA SP +NA++H IYD+WL  CK
Sbjct: 88  VEVDEITLDRKIRRIFTGWMFAASPGLNAVEHPIYDVWLKDCK 130


>gi|327193632|gb|EGE60515.1| hypothetical protein RHECNPAF_1440013 [Rhizobium etli CNPAF512]
          Length = 146

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 78/103 (75%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           AN+AR  N VA F+G+DKITGR+ TFDV +N++ QFG+L + P  CYSRD  EAQ+ID F
Sbjct: 28  ANAARIENPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKACYSRDQAEAQKIDGF 87

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V + EI  DR +R IF+GWMFA SP +NA++H IYD+WL  CK
Sbjct: 88  VEVDEITLDRKIRRIFTGWMFAASPGLNAVEHPIYDVWLKDCK 130


>gi|159184714|ref|NP_354334.2| hypothetical protein Atu1328 [Agrobacterium tumefaciens str. C58]
 gi|159140002|gb|AAK87119.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 145

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 86/122 (70%), Gaps = 3/122 (2%)

Query: 4   RVLLLILFFVFSHAKFAN---SARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLII 60
           R L + LF   S     +   +AR  N+VA F+G+DKITGR+ +FDV I+++ QFG+L +
Sbjct: 11  RALTVSLFAAVSAVLIVSPVAAARLENRVAVFSGIDKITGRITSFDVYIDETVQFGALQV 70

Query: 61  KPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ 120
            P VCYSRD  E Q+IDAFV + EI  DR +R IF+GWMFADSP +NA++H IYD+WL  
Sbjct: 71  TPKVCYSRDQTETQKIDAFVEVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLTG 130

Query: 121 CK 122
           CK
Sbjct: 131 CK 132


>gi|86357492|ref|YP_469384.1| hypothetical protein RHE_CH01866 [Rhizobium etli CFN 42]
 gi|86281594|gb|ABC90657.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 146

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 60/102 (58%), Positives = 78/102 (76%)

Query: 21  NSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
           ++AR  N VA F+G+DKITGR+ TFDV +N++ QFG+L + P  CYSRD  EAQ+ID FV
Sbjct: 29  HAARIDNPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKACYSRDQAEAQKIDGFV 88

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            + EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 89  EVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK 130


>gi|325292687|ref|YP_004278551.1| hypothetical protein AGROH133_05769 [Agrobacterium sp. H13-3]
 gi|325060540|gb|ADY64231.1| hypothetical protein AGROH133_05769 [Agrobacterium sp. H13-3]
          Length = 145

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 59/102 (57%), Positives = 81/102 (79%)

Query: 21  NSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
           ++AR  N+VA F+G+DKITGR+ +FDV I+++ QFG+L + P VCYSRD  EAQ+IDAF+
Sbjct: 31  SAARLENRVAVFSGIDKITGRITSFDVYIDETVQFGALQVTPKVCYSRDQTEAQKIDAFI 90

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            + EI  DR ++ IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 91  EVDEITLDRKIKRIFTGWMFADSPGLNAVEHPIYDVWLTGCK 132


>gi|218462710|ref|ZP_03502801.1| hypothetical protein RetlK5_26127 [Rhizobium etli Kim 5]
          Length = 146

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 78/103 (75%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A++ R  N VA F+G+DKITGR+ TFDV +N++ QFG+L + P VCYSRD  EAQ+ID F
Sbjct: 28  AHATRIENPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKVCYSRDQAEAQKIDGF 87

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V + EI  DR +R IF+GWMFA SP +NA++H IYD+WL  CK
Sbjct: 88  VEVDEITLDRKIRRIFTGWMFAASPGLNAVEHPIYDVWLKDCK 130


>gi|218661471|ref|ZP_03517401.1| hypothetical protein RetlI_19085 [Rhizobium etli IE4771]
          Length = 125

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 78/103 (75%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A++ R  N VA F+G+DKITGR+ TFDV +N++ QFG+L + P VCYSRD  EAQ+ID F
Sbjct: 7   AHATRIENPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKVCYSRDQAEAQKIDGF 66

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V + EI  DR +R IF+GWMFA SP +NA++H IYD+WL  CK
Sbjct: 67  VEVDEITLDRKIRRIFTGWMFAASPGLNAVEHPIYDVWLKDCK 109


>gi|209549131|ref|YP_002281048.1| hypothetical protein Rleg2_1532 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534887|gb|ACI54822.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 146

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 78/103 (75%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A++AR  N VA F+G+DKITGR+ TFDV +N++ QFG+L + P  CYSRD  EAQ+ID F
Sbjct: 28  AHAARIENPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKACYSRDQAEAQKIDGF 87

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V + EI  DR +R IF+GWMFA SP +NA++H IYD+WL  CK
Sbjct: 88  VEVDEITLDRKIRRIFTGWMFAASPGLNAVEHPIYDVWLKDCK 130


>gi|163759361|ref|ZP_02166447.1| hypothetical protein HPDFL43_06335 [Hoeflea phototrophica DFL-43]
 gi|162283765|gb|EDQ34050.1| hypothetical protein HPDFL43_06335 [Hoeflea phototrophica DFL-43]
          Length = 145

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 79/103 (76%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A++AR  N VA F+G+DKITGR+ TFDV + ++ QFG+L + P VCYSRD+ EA +   F
Sbjct: 29  ASAARIENPVAVFSGIDKITGRITTFDVYVGETVQFGALQVTPKVCYSRDESEAPKTTTF 88

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V + EI  DR +R +F+GWMFADSP +NA+DH++YD+WL +CK
Sbjct: 89  VEVDEITLDRKIRRLFTGWMFADSPGLNAVDHAVYDVWLKECK 131


>gi|227821674|ref|YP_002825644.1| hypothetical protein NGR_c11050 [Sinorhizobium fredii NGR234]
 gi|227340673|gb|ACP24891.1| hypothetical protein NGR_c11050 [Sinorhizobium fredii NGR234]
          Length = 150

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 85/121 (70%), Gaps = 1/121 (0%)

Query: 7   LLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCY 66
           +L+   + S  + A + R +N VA F+G+DKITGR+ TFDV I ++ QFG+L + P VCY
Sbjct: 21  VLLALPLISAGEPARATRLSNAVAVFSGIDKITGRITTFDVYIGETVQFGALQVTPHVCY 80

Query: 67  SRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPIN 126
           SRD+ EA +   FV + EI  DR +R IF+GWMFADSP +NA++H +YD+WL  CK P +
Sbjct: 81  SRDETEAPKTTTFVDVDEITLDRKIRRIFTGWMFADSPGLNAVEHPVYDVWLQSCK-PTS 139

Query: 127 D 127
           D
Sbjct: 140 D 140


>gi|150396172|ref|YP_001326639.1| hypothetical protein Smed_0949 [Sinorhizobium medicae WSM419]
 gi|150027687|gb|ABR59804.1| conserved hypothetical protein [Sinorhizobium medicae WSM419]
          Length = 150

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 59/110 (53%), Positives = 79/110 (71%)

Query: 13  VFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE 72
           V S  + A +AR  N VA F+G+DKITGR+ +FDV I ++ QFG+L + P VCYSRD+ E
Sbjct: 27  VVSTTEPAQAARLPNAVAVFSGIDKITGRITSFDVYIGETVQFGALQVTPRVCYSRDETE 86

Query: 73  AQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           A +   FV + EI  DR +R IF+GWMFADSP +NA++H +YD+WL  CK
Sbjct: 87  APKTTTFVEVDEITLDRKIRRIFTGWMFADSPGLNAVEHPVYDVWLQSCK 136


>gi|319783248|ref|YP_004142724.1| hypothetical protein Mesci_3554 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169136|gb|ADV12674.1| Protein of unknown function DUF2155 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 196

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 57/99 (57%), Positives = 77/99 (77%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           R  N VAEFAG+DKITGR++TFDV I+++ QFG+L + P VCYSR   EA + D+FV + 
Sbjct: 43  RVTNAVAEFAGIDKITGRIITFDVYIDETVQFGALQVTPRVCYSRPQAEAPKTDSFVEVD 102

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           EI  DR +R IF+GWMFA+SP +NA++H++YD+WL  CK
Sbjct: 103 EITLDRKIRRIFTGWMFAESPGLNAVEHAVYDVWLKACK 141


>gi|13470480|ref|NP_102049.1| cellulase-like protein [Mesorhizobium loti MAFF303099]
 gi|14021222|dbj|BAB47835.1| cellulase-like protein [Mesorhizobium loti MAFF303099]
          Length = 198

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 57/102 (55%), Positives = 78/102 (76%)

Query: 21  NSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
            S R  N VAEFAG+DKITGR++TFDV I+++ QFG+L + P VCYSR   E  + D+FV
Sbjct: 44  GSDRITNPVAEFAGIDKITGRIITFDVYIDETVQFGALQVTPRVCYSRPQNEEPKTDSFV 103

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            + EI  DR +R IF+GWMFA+SP +NA++H++YD+WL +CK
Sbjct: 104 EVDEITLDRKIRRIFTGWMFAESPGLNAVEHAVYDVWLKECK 145


>gi|260460719|ref|ZP_05808969.1| cellulase-like protein [Mesorhizobium opportunistum WSM2075]
 gi|259033296|gb|EEW34557.1| cellulase-like protein [Mesorhizobium opportunistum WSM2075]
          Length = 197

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 57/102 (55%), Positives = 77/102 (75%)

Query: 21  NSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
            S R  N VAEFAG+DKITGR++TFDV I+++ QFG+L + P VCYSR   E  + D+FV
Sbjct: 41  GSDRITNPVAEFAGIDKITGRIITFDVYIDETVQFGALQVTPRVCYSRPQNEEPKTDSFV 100

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            + EI  DR +R IF+GWMFA+SP +NA++H++YD+WL  CK
Sbjct: 101 EVDEITLDRKIRRIFTGWMFAESPGLNAVEHAVYDVWLKACK 142


>gi|241204456|ref|YP_002975552.1| hypothetical protein Rleg_1727 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858346|gb|ACS56013.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 146

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 58/99 (58%), Positives = 74/99 (74%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           R  N VA F+G+DKITGR+ TFDV +N++ QFG+L + P  CYSRD  EAQ+ID FV + 
Sbjct: 32  RIENPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKACYSRDQSEAQKIDGFVEVD 91

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           EI  DR +R IF+GWMFA SP +NA++H IYD+WL  CK
Sbjct: 92  EITLDRKIRRIFTGWMFAASPGLNAVEHPIYDVWLKDCK 130


>gi|15965070|ref|NP_385423.1| hypothetical protein SMc01347 [Sinorhizobium meliloti 1021]
 gi|307301141|ref|ZP_07580910.1| Protein of unknown function DUF2155 [Sinorhizobium meliloti BL225C]
 gi|307317874|ref|ZP_07597312.1| Protein of unknown function DUF2155 [Sinorhizobium meliloti AK83]
 gi|15074249|emb|CAC45896.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306896636|gb|EFN27384.1| Protein of unknown function DUF2155 [Sinorhizobium meliloti AK83]
 gi|306904096|gb|EFN34682.1| Protein of unknown function DUF2155 [Sinorhizobium meliloti BL225C]
          Length = 150

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 58/110 (52%), Positives = 80/110 (72%)

Query: 13  VFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE 72
           V S  + A +AR +N VA F+G+DKITGR+ +FDV I ++ QFG+L + P VC+SRD+ E
Sbjct: 27  VTSAVETAQAARLSNAVAVFSGIDKITGRITSFDVYIGETVQFGALQVTPRVCHSRDETE 86

Query: 73  AQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           A +   FV + EI  DR +R IF+GWMFADSP +NA++H +YD+WL  CK
Sbjct: 87  APKTTTFVEVDEITLDRKIRRIFTGWMFADSPGLNAVEHPVYDVWLQSCK 136


>gi|110634070|ref|YP_674278.1| cellulase-like protein [Mesorhizobium sp. BNC1]
 gi|110285054|gb|ABG63113.1| cellulase-like protein [Chelativorans sp. BNC1]
          Length = 141

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 78/103 (75%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A++ R  N VAEF+G+DKITGR+  FDV ++++ QFG+L + P VCYS  + E  + DAF
Sbjct: 28  AHAERIKNPVAEFSGIDKITGRITNFDVYMDETVQFGALQVTPRVCYSSPETEEPKTDAF 87

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V ++EI  DR +R IF+GWMFA+SP +NAI+H++YD+WL  CK
Sbjct: 88  VEVNEITLDRQIRRIFTGWMFAESPGVNAIEHAVYDVWLKSCK 130


>gi|90417714|ref|ZP_01225626.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337386|gb|EAS51037.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 135

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 61/125 (48%), Positives = 84/125 (67%), Gaps = 3/125 (2%)

Query: 1   MKYRVLLLILFFVFSHAKFANSA---RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGS 57
           M  R+   ILF V +      ++   R ANKVA F+G+DKITGR+ +FDV I+++ QFG+
Sbjct: 1   MNRRLCASILFAVTTGLALVPASAQQRIANKVAVFSGLDKITGRITSFDVYIDETVQFGA 60

Query: 58  LIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIW 117
           L + P VCY+  + EA + DAFV + EI   R +R IFSGWMFA SP +NA++H +YD+W
Sbjct: 61  LQVTPKVCYTSAEGEAAKTDAFVKVDEITLQRDIRQIFSGWMFAASPGLNAVEHPVYDVW 120

Query: 118 LMQCK 122
           L  CK
Sbjct: 121 LKSCK 125


>gi|328543660|ref|YP_004303769.1| Cellulase-like protein [polymorphum gilvum SL003B-26A1]
 gi|326413404|gb|ADZ70467.1| Cellulase-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 183

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 56/125 (44%), Positives = 83/125 (66%), Gaps = 2/125 (1%)

Query: 17  AKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRI 76
           A  A++ +  N VA F+G+DKITGR+++FDV I ++ QFG+L + P VCYSR   E  + 
Sbjct: 28  AGPAHADKIENPVAVFSGLDKITGRIISFDVYIGETVQFGALQVTPRVCYSRPQTETPQT 87

Query: 77  DAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESIS 136
           DAFV + EI  +  VR IFSGWMFA SP ++A++H++YD+WL  C+  +  S+   E  S
Sbjct: 88  DAFVQVDEITLNNEVRRIFSGWMFAASPGLHAVEHAVYDVWLTDCR--MTSSVPPPEGYS 145

Query: 137 KKALS 141
              ++
Sbjct: 146 GPPVA 150


>gi|170738647|ref|YP_001767302.1| hypothetical protein M446_0297 [Methylobacterium sp. 4-46]
 gi|168192921|gb|ACA14868.1| conserved hypothetical proteinn [Methylobacterium sp. 4-46]
          Length = 210

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 105/185 (56%), Gaps = 15/185 (8%)

Query: 6   LLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVC 65
           L+L L  V + A  A+  R  N  A F+G+DKITGR++TF+V ++++ QFG+L + P VC
Sbjct: 14  LVLSLAGVLAPAAQADKIR--NPTAVFSGLDKITGRIVTFEVSVDETVQFGALQLTPRVC 71

Query: 66  YSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPI 125
           Y+R   E+ R  AF+ + E+  +   R IF+GWMFA SP ++AI+H IYD+WL+ CK   
Sbjct: 72  YTRPPTESARTTAFLEVDEVTLENKYRRIFTGWMFAASPGLHAIEHPIYDVWLVDCKG-G 130

Query: 126 NDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMD---LK 182
            D I+ ++        E     + +   E+      N+  E   +QP+     +D   L+
Sbjct: 131 TDIIAEAK--------EQDDAPVAAAKPERRR-RDPNQQQEARRAQPVNRQGQVDVAPLR 181

Query: 183 GRPIQ 187
           G P+Q
Sbjct: 182 GTPVQ 186


>gi|39935492|ref|NP_947768.1| hypothetical protein RPA2426 [Rhodopseudomonas palustris CGA009]
 gi|39649344|emb|CAE27867.1| hypothetical protein RPA2426 [Rhodopseudomonas palustris CGA009]
          Length = 329

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 69/101 (68%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           +  NK A FAG+DKITGR + FD +I ++ QFG+L +K   CY+R   EA   DAFV + 
Sbjct: 166 KIVNKKASFAGLDKITGRTINFDADIGETVQFGALRVKTDACYTRPSTEAANTDAFVEVD 225

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
           EI     V+ IFSGWMFA SP ++A++H IYDIWL  CKDP
Sbjct: 226 EITLQGEVKRIFSGWMFAASPGLHAVEHPIYDIWLTDCKDP 266


>gi|192291083|ref|YP_001991688.1| hypothetical protein Rpal_2704 [Rhodopseudomonas palustris TIE-1]
 gi|192284832|gb|ACF01213.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 329

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 69/101 (68%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           +  NK A FAG+DKITGR + FD +I ++ QFG+L +K   CY+R   EA   DAFV + 
Sbjct: 166 KIVNKKASFAGLDKITGRTINFDADIGETVQFGALRVKTDACYTRPSTEAANTDAFVEVD 225

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
           EI     V+ IFSGWMFA SP ++A++H IYDIWL  CKDP
Sbjct: 226 EITLQGEVKRIFSGWMFAASPGLHAVEHPIYDIWLTDCKDP 266


>gi|316934413|ref|YP_004109395.1| hypothetical protein Rpdx1_3081 [Rhodopseudomonas palustris DX-1]
 gi|315602127|gb|ADU44662.1| Protein of unknown function DUF2155 [Rhodopseudomonas palustris
           DX-1]
          Length = 324

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 75/115 (65%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           +  NK A F G+DKITGR ++FD +I ++ QFG+L +K   CY+R   EA   DAFV + 
Sbjct: 163 KIVNKKASFTGLDKITGRTISFDADIGETVQFGALRVKTDACYTRPSTEATNTDAFVEVD 222

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKK 138
           EI     V+ IFSGWMFA SP ++A++H IYDIWL  CK P   ++++++    K
Sbjct: 223 EITLQGEVKRIFSGWMFAASPGLHAVEHPIYDIWLTDCKGPETPNVASAQPEPPK 277


>gi|209885432|ref|YP_002289289.1| hypothetical protein OCAR_6311 [Oligotropha carboxidovorans OM5]
 gi|209873628|gb|ACI93424.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 297

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 75/112 (66%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           +  NK A F+G+DKITGR++TFD +I ++ QFG+L +K   CY+R   EA   DAFV + 
Sbjct: 150 KIPNKKAVFSGLDKITGRIITFDQDIGETVQFGALRVKTDACYTRPATEAANTDAFVEVD 209

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESI 135
           EI     V+ IFSGWMFA SP ++A++H IYD+WL+ CK P     + +E +
Sbjct: 210 EITLQNEVKRIFSGWMFAASPGLHAVEHPIYDVWLIDCKSPEQPVTAQNEPV 261


>gi|146340455|ref|YP_001205503.1| putative signal peptide [Bradyrhizobium sp. ORS278]
 gi|146193261|emb|CAL77277.1| conserved hypothetical protein; putative signal peptide
           [Bradyrhizobium sp. ORS278]
          Length = 321

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 71/103 (68%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           +  NK A F+G+DKITGR++ FD EI ++ QFG+L +K   CY+R   EA   DAFV + 
Sbjct: 155 KIVNKKASFSGLDKITGRIINFDEEIGETVQFGALRVKTDACYTRPASEAANTDAFVQVD 214

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPIN 126
           EI     V+ IFSGWMFA SP ++ ++H IYDIWL+ CK+P N
Sbjct: 215 EITLQGEVKRIFSGWMFAASPGLHGVEHPIYDIWLVDCKEPQN 257


>gi|91976894|ref|YP_569553.1| hypothetical protein RPD_2422 [Rhodopseudomonas palustris BisB5]
 gi|91683350|gb|ABE39652.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 316

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 77/117 (65%), Gaps = 1/117 (0%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           +  NK A F G+DKITGR ++FD +I ++ QFG+L +K   CY+R   EA   DAFV + 
Sbjct: 170 KIVNKKASFTGLDKITGRTISFDADIGETVQFGALRVKTDACYTRPSTEAANTDAFVEVD 229

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKAL 140
           EI     V+ I+SGWMFA SP ++A++H IYDIWL  CK+P   ++ N++  + K +
Sbjct: 230 EITLQGEVKRIYSGWMFAASPGLHAVEHPIYDIWLTDCKNP-ETTVVNAQPEAPKPV 285


>gi|299133762|ref|ZP_07026956.1| Protein of unknown function DUF2155 [Afipia sp. 1NLS2]
 gi|298591598|gb|EFI51799.1| Protein of unknown function DUF2155 [Afipia sp. 1NLS2]
          Length = 306

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 74/113 (65%)

Query: 22  SARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVS 81
           + +  NK A F+G+DKITGR++TFD +I ++ QFG+L +K   CY+R   EA   DAFV 
Sbjct: 153 AVKIPNKKAVFSGLDKITGRIITFDEDIGETVQFGALRVKTDACYTRPATEAANTDAFVE 212

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSES 134
           + EI     V+ IFSGWMFA SP ++A++H IYD+WL  CK P     + +E 
Sbjct: 213 VDEITLQNEVKRIFSGWMFAASPGLHAVEHPIYDVWLTDCKGPEQPVTAQNEP 265


>gi|188580300|ref|YP_001923745.1| hypothetical protein Mpop_1034 [Methylobacterium populi BJ001]
 gi|179343798|gb|ACB79210.1| conserved hypothetical proteinn [Methylobacterium populi BJ001]
          Length = 219

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 98/171 (57%), Gaps = 15/171 (8%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A++ +  N  A F+G+DKITGR++TF+V I+++ QFG+L + P VCYSR   E  +  AF
Sbjct: 26  ASADKIKNPTAVFSGLDKITGRIVTFEVAIDETVQFGALQMTPRVCYSRPPTETPKTTAF 85

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKA 139
           + + E+  D   R IF+GWMFA SP ++AI+H IYD+WL  CK         ++ I++  
Sbjct: 86  LEVDEVTLDSKYRRIFTGWMFASSPGLHAIEHPIYDVWLTDCK-------GGTDVIAEAK 138

Query: 140 LSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDL---KGRPIQ 187
             E      + Q   K  G+   KT    +SQ +  N  +D+   +G P+Q
Sbjct: 139 EQEDVPALASRQEKPKKKGADPTKT----ASQ-VNQNGQVDVEGPRGVPVQ 184


>gi|304391690|ref|ZP_07373632.1| putative signal peptide protein [Ahrensia sp. R2A130]
 gi|303295919|gb|EFL90277.1| putative signal peptide protein [Ahrensia sp. R2A130]
          Length = 142

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 56/128 (43%), Positives = 79/128 (61%), Gaps = 9/128 (7%)

Query: 4   RVLLLILFFVFSHAKFANS---------ARFANKVAEFAGMDKITGRVLTFDVEINQSAQ 54
           R+L+  L    +    A +         +R ANKVA FAG+DKITGR+ TFDV ++++ +
Sbjct: 2   RILMAALMATVASTALAQTDGFTEEEQISRIANKVAVFAGLDKITGRITTFDVYMDETVK 61

Query: 55  FGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIY 114
           FG L + P  CYS    E  +  +F+ + EI  DR +R IFSGWMFA+SP +NAI+H + 
Sbjct: 62  FGQLELTPRACYSSSAAETPKTTSFIEVDEITLDRRIRRIFSGWMFAESPGLNAIEHPVN 121

Query: 115 DIWLMQCK 122
           D+WL  CK
Sbjct: 122 DVWLKACK 129


>gi|298291312|ref|YP_003693251.1| hypothetical protein Snov_1322 [Starkeya novella DSM 506]
 gi|296927823|gb|ADH88632.1| Protein of unknown function DUF2155 [Starkeya novella DSM 506]
          Length = 233

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 68/99 (68%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           +  NK A F+G+DKITGR+++FDV +N++ QFG+L I P  CY+R + E Q    FV + 
Sbjct: 122 KIENKTAVFSGLDKITGRIISFDVSVNETVQFGALRITPRACYTRPETEQQNTTGFVEVQ 181

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           EI  D  V+ +F GWMFA SP ++ ++H IYD+WL  CK
Sbjct: 182 EITLDGKVQPLFGGWMFASSPGLHGVEHPIYDVWLTDCK 220


>gi|86750143|ref|YP_486639.1| hypothetical protein RPB_3026 [Rhodopseudomonas palustris HaA2]
 gi|86573171|gb|ABD07728.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 326

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 53/107 (49%), Positives = 70/107 (65%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           +  NK A F G+DKITGR + FD +I ++ QFG+L +K   CY+R   EA   DAFV + 
Sbjct: 180 KIVNKKASFTGLDKITGRTINFDADIGETVQFGALRVKTDACYTRPSTEAANTDAFVEVD 239

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           EI     V+ IFSGWMFA SP ++A++H IYDIWL  CK+P    +S
Sbjct: 240 EITLQGEVKRIFSGWMFAASPGLHAVEHPIYDIWLTDCKNPETPVVS 286


>gi|75675950|ref|YP_318371.1| hypothetical protein Nwi_1758 [Nitrobacter winogradskyi Nb-255]
 gi|74420820|gb|ABA05019.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 397

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 71/105 (67%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A + R  NK A F+G+DKITGR++ FD +I ++ QFG+L +K   CY+R   EA   DAF
Sbjct: 233 APAERIVNKKAVFSGLDKITGRIIHFDEDIGETVQFGALRVKTSACYTRPATEAANTDAF 292

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
           V + EI     V+ IFSGWMFA SP ++ ++H IYD+WL  CKDP
Sbjct: 293 VEVDEITLQGEVKRIFSGWMFASSPGLHGVEHPIYDVWLTDCKDP 337


>gi|148255598|ref|YP_001240183.1| hypothetical protein BBta_4221 [Bradyrhizobium sp. BTAi1]
 gi|146407771|gb|ABQ36277.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 316

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 73/110 (66%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           +  NK A F+G+DKITGR++ FD +I ++ QFG+L +K   CY+R   EA   DAFV + 
Sbjct: 153 KIVNKKASFSGLDKITGRIINFDEDIGETVQFGALRVKTDACYTRPATEAANTDAFVQVD 212

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSE 133
           EI     V+ IFSGWMFA SP ++ ++H IYDIWL+ CK+P    +S + 
Sbjct: 213 EITLQGEVKRIFSGWMFAASPGLHGVEHPIYDIWLVDCKEPQTTVVSTAP 262


>gi|114704669|ref|ZP_01437577.1| hypothetical protein FP2506_07031 [Fulvimarina pelagi HTCC2506]
 gi|114539454|gb|EAU42574.1| hypothetical protein FP2506_07031 [Fulvimarina pelagi HTCC2506]
          Length = 113

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 53/99 (53%), Positives = 71/99 (71%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           R  N VA F+G+DKITGR+  FDV I+++ QFG+L + P VC +  + EA + DAFV + 
Sbjct: 5   RLENPVAVFSGLDKITGRLTDFDVFIDETVQFGALQVTPRVCKTSAEGEATQTDAFVEVD 64

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           EI  DR +R IFSGWMFA SP +NA++H +YD+WL  CK
Sbjct: 65  EITLDREIRRIFSGWMFAASPGLNAVEHPVYDVWLKSCK 103


>gi|254469527|ref|ZP_05082932.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gi|211961362|gb|EEA96557.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
          Length = 181

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 78/121 (64%), Gaps = 2/121 (1%)

Query: 27  NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIF 86
           N VA F G+DKITGR+ TFDV I+++ QFG+L + P VC SR   EA +  AF+ + E+ 
Sbjct: 38  NPVAVFKGLDKITGRITTFDVYIDETVQFGALQVTPRVCNSRPLTEASQTTAFIEVDELT 97

Query: 87  TDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSEYSST 146
            D  VR IFSGWMFA +P ++A++HS+YDIWL+ CK     S+   E  +  A+   S  
Sbjct: 98  LDSKVRRIFSGWMFASNPGVHAVEHSVYDIWLINCKK--TTSVPPPEGYAGPAVELVSEE 155

Query: 147 D 147
           D
Sbjct: 156 D 156


>gi|115525001|ref|YP_781912.1| hypothetical protein RPE_2995 [Rhodopseudomonas palustris BisA53]
 gi|115518948|gb|ABJ06932.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 308

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 68/101 (67%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           +  NK A F+G+DKITGR++ FD +I ++ QFG+L +K   CY+R   EA   DAFV + 
Sbjct: 163 KIVNKKAVFSGLDKITGRIINFDADIGETVQFGALRVKTDACYTRPSTEATNTDAFVEVD 222

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
           EI     V+ IFSGWMFA SP ++ I+H IYDIWL  CK P
Sbjct: 223 EITLQGEVKRIFSGWMFAASPGLHGIEHPIYDIWLTDCKGP 263


>gi|118589092|ref|ZP_01546499.1| hypothetical protein SIAM614_13608 [Stappia aggregata IAM 12614]
 gi|118438421|gb|EAV45055.1| hypothetical protein SIAM614_13608 [Stappia aggregata IAM 12614]
          Length = 193

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 85/140 (60%), Gaps = 7/140 (5%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A++ +  N VA F+G+DKITGR+++FDV I ++ QFG+L + P VCY+R   E+     F
Sbjct: 43  AHAEKIENPVAVFSGLDKITGRIISFDVYIGETVQFGALQVTPRVCYTRPQTESPLTTGF 102

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKA 139
           V + EI  +  VR I+SGWMFA SP ++A++H +YDIWL  CK  +  ++   E  +   
Sbjct: 103 VQVDEITLNNEVRRIYSGWMFAASPGLHAVEHPVYDIWLTDCK--LASTVPPPEDYAGPP 160

Query: 140 LSEYSSTDITSQGSEKSSGS 159
           +     T   ++G +  +G 
Sbjct: 161 I-----TGTVAEGEDPLAGP 175


>gi|163850532|ref|YP_001638575.1| hypothetical protein Mext_1100 [Methylobacterium extorquens PA1]
 gi|218529229|ref|YP_002420045.1| hypothetical protein Mchl_1229 [Methylobacterium chloromethanicum
           CM4]
 gi|240137597|ref|YP_002962068.1| hypothetical protein MexAM1_META1p0870 [Methylobacterium extorquens
           AM1]
 gi|254560069|ref|YP_003067164.1| hypothetical protein METDI1582 [Methylobacterium extorquens DM4]
 gi|163662137|gb|ABY29504.1| conserved hypothetical proteinn [Methylobacterium extorquens PA1]
 gi|218521532|gb|ACK82117.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
 gi|240007565|gb|ACS38791.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens AM1]
 gi|254267347|emb|CAX23179.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens DM4]
          Length = 219

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 63/167 (37%), Positives = 95/167 (56%), Gaps = 15/167 (8%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           +  N  A F+G+DKITGR++TF+V I+++ QFG+L + P VCYSR   E  +  AF+ + 
Sbjct: 30  KIKNPTAVFSGLDKITGRIVTFEVAIDETVQFGALQMTPRVCYSRPPTETPKTTAFLEVD 89

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSEY 143
           E+  D   R IF+GWMFA SP ++AI+H IYD+WL  CK         S+ I++    E 
Sbjct: 90  EVTLDSKYRRIFTGWMFAASPGLHAIEHPIYDVWLTDCK-------GGSDVIAEAKEQED 142

Query: 144 SSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDL---KGRPIQ 187
                + Q   +  G+   KT    S+Q +  N  +D+   +G P+Q
Sbjct: 143 VPALASRQDKPRKKGADPTKT----SAQ-VNQNGQVDVEGPRGVPVQ 184


>gi|307947206|ref|ZP_07662541.1| putative signal peptide protein [Roseibium sp. TrichSKD4]
 gi|307770870|gb|EFO30096.1| putative signal peptide protein [Roseibium sp. TrichSKD4]
          Length = 180

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 52/128 (40%), Positives = 77/128 (60%), Gaps = 2/128 (1%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
             S +  N VA F+G+DKITGR++ FDV I ++ QFG+L + P VCY+R   E+     F
Sbjct: 31  PQSQKIENPVAVFSGLDKITGRIINFDVYIGETVQFGALQVTPRVCYTRPQTESPLTTGF 90

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKA 139
           + + EI  +  VR IFSGWM+A SP ++A++H +YDIWL  CK     ++   E      
Sbjct: 91  IQVDEITLNNEVRRIFSGWMYAASPGLHAVEHGVYDIWLTNCKR--TSTVPPPEGYDGPP 148

Query: 140 LSEYSSTD 147
           + + +S D
Sbjct: 149 VEQVTSED 156


>gi|90424380|ref|YP_532750.1| hypothetical protein RPC_2883 [Rhodopseudomonas palustris BisB18]
 gi|90106394|gb|ABD88431.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 309

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 68/101 (67%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           +  NK A F+G+DKITGR++ FD +I ++ QFG+L +K   CY+R   EA   DAFV + 
Sbjct: 162 KIVNKKASFSGLDKITGRIINFDADIGETVQFGALRVKTDACYTRPATEAANTDAFVEVD 221

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
           EI     V+ IFSGWMFA SP ++ ++H IYDIWL  CK P
Sbjct: 222 EITLQGEVKRIFSGWMFAASPGLHGVEHPIYDIWLTDCKGP 262


>gi|170746752|ref|YP_001753012.1| hypothetical protein Mrad2831_0305 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653274|gb|ACB22329.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 218

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/171 (35%), Positives = 95/171 (55%), Gaps = 15/171 (8%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A + +  N  A F+G+DKITGR++ F+V ++++ QFG+L + P VCY+R   E+ +  AF
Sbjct: 25  AAADKIKNPTAVFSGLDKITGRIVNFEVAVDETVQFGALQLTPRVCYTRPPTESAKTTAF 84

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKA 139
           + + E+  D   R IF+GWMFA SP ++AI+H IYD+WL+ CK         S+ I++  
Sbjct: 85  LEVDEVTLDNKYRRIFTGWMFASSPGLHAIEHPIYDVWLVDCK-------GGSDVIAEAK 137

Query: 140 LSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDL---KGRPIQ 187
             E            K  G  + KT     +Q L  N  +D+   +G P+Q
Sbjct: 138 EQEDVPAVAAKPEKAKRPGKDATKT-----AQQLNANGQVDVEAPRGVPVQ 183


>gi|85716172|ref|ZP_01047147.1| hypothetical protein NB311A_05700 [Nitrobacter sp. Nb-311A]
 gi|85697005|gb|EAQ34888.1| hypothetical protein NB311A_05700 [Nitrobacter sp. Nb-311A]
          Length = 306

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 52/105 (49%), Positives = 71/105 (67%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A + +  NK A F+G+DKITGR++ FD +I ++ QFG+L +K   CY+R   EA   DAF
Sbjct: 144 APAEKVINKKAVFSGLDKITGRIIHFDEDIGETVQFGALRVKTDACYTRPATEAANTDAF 203

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
           V + EI     V+ IFSGWMFA SP ++ ++H IYD+WL  CKDP
Sbjct: 204 VEVDEITLQGEVKRIFSGWMFAASPGLHGVEHPIYDVWLTDCKDP 248


>gi|319898785|ref|YP_004158878.1| hypothetical protein BARCL_0615 [Bartonella clarridgeiae 73]
 gi|319402749|emb|CBI76296.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 147

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 50/99 (50%), Positives = 72/99 (72%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           R +N++  F+G+DKITGRV +F+V I Q  Q+G+L I P VCY+  + E  R  +FV ++
Sbjct: 42  RVSNEIGIFSGLDKITGRVTSFEVHIGQVYQYGALQIIPRVCYTSSENEPARTTSFVEVN 101

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           E+  ++  R IF+GWMFADSP +NA++HSIYD+WL  CK
Sbjct: 102 EMTLEKKTRRIFTGWMFADSPGLNAVEHSIYDVWLKDCK 140


>gi|154247423|ref|YP_001418381.1| hypothetical protein Xaut_3495 [Xanthobacter autotrophicus Py2]
 gi|154161508|gb|ABS68724.1| conserved hypothetical protein [Xanthobacter autotrophicus Py2]
          Length = 228

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 68/99 (68%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           + AN  A +AG+DKITGR+  FDV I ++AQFG+L + P VCY+R   E Q   +F  ++
Sbjct: 119 KIANAFAVYAGLDKITGRITAFDVAIGETAQFGALQVTPRVCYTRPATETQNTTSFTEVN 178

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           E+      + IF+GWMFA SP ++A++H IYD+WL+ CK
Sbjct: 179 EVTLQGQAKRIFTGWMFASSPGLHAVEHPIYDVWLIGCK 217


>gi|319408372|emb|CBI82025.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 118

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 50/101 (49%), Positives = 70/101 (69%)

Query: 22  SARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVS 81
           + R +N V  FAG+DKITGR + F+V I +  Q+G+L + P VCY+  + E  R + FV 
Sbjct: 9   AERVSNAVVVFAGLDKITGRTIRFEVSIGEVYQYGALRVTPRVCYTSSEGEPTRTNGFVE 68

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           + EI  ++ +R IF+GWMFADSP +NA++H IYDIWL  CK
Sbjct: 69  VDEITLNKEMRRIFTGWMFADSPGLNAVEHPIYDIWLKDCK 109


>gi|27379396|ref|NP_770925.1| hypothetical protein blr4285 [Bradyrhizobium japonicum USDA 110]
 gi|27352547|dbj|BAC49550.1| blr4285 [Bradyrhizobium japonicum USDA 110]
          Length = 360

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 50/101 (49%), Positives = 69/101 (68%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           +  NK A F+G+DKITGR++ FD +I ++ QFG+L +K   CY+R   EA   DAFV + 
Sbjct: 190 KIVNKKATFSGLDKITGRIINFDEDIGETVQFGALRVKTDACYTRPATEAANTDAFVEVD 249

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
           EI     V+ IFSGWM+A SP ++ ++H IYDIWL  CK+P
Sbjct: 250 EITLQGEVKRIFSGWMYAASPGLHGVEHPIYDIWLTDCKEP 290


>gi|220925866|ref|YP_002501168.1| hypothetical protein Mnod_6040 [Methylobacterium nodulans ORS 2060]
 gi|219950473|gb|ACL60865.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060]
          Length = 210

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 94/167 (56%), Gaps = 19/167 (11%)

Query: 27  NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIF 86
           N  A F+G+DKITGR+++F+V ++++ QFG+L + P VCY+R   E+ +  AF+ + E+ 
Sbjct: 33  NPTAVFSGLDKITGRIVSFEVAVDETVQFGALQLTPRVCYTRPPTESAKTTAFLEVDEVT 92

Query: 87  TDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK---DPINDSISNSESISKKALSEY 143
            +   R IF+GWMFA SP ++AI+H IYD+WL+ CK   D I ++    ++    A  E 
Sbjct: 93  LENKYRRIFTGWMFAASPGLHAIEHPIYDVWLVDCKGGTDIIAEAKEQDDAPVAAAKPER 152

Query: 144 SSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMD---LKGRPIQ 187
              D              N+  E   +QP+     +D   L+G P+Q
Sbjct: 153 RRRD-------------PNQREEARRAQPVNRQGQVDVTPLRGTPVQ 186


>gi|49475388|ref|YP_033429.1| hypothetical protein BH05970 [Bartonella henselae str. Houston-1]
 gi|49238194|emb|CAF27404.1| hypothetical protein BH05970 [Bartonella henselae str. Houston-1]
          Length = 141

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 69/103 (66%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
             + R +N +A FAG+DKITGR   F+V + +  Q+G+L + P VCY+    E  R   F
Sbjct: 30  VQAERVSNGIAVFAGLDKITGRTTRFEVSLGEVYQYGALQVTPRVCYTSSKDEPTRTTGF 89

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V ++E+  D+ VR IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 90  VEVNEVTLDKKVRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK 132


>gi|319404107|emb|CBI77697.1| conserved exported hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 140

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 71/104 (68%)

Query: 19  FANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDA 78
           F  + R +N++  F G+DKITG+V +F+V I Q  Q+G+L + P VCY+    E  R  +
Sbjct: 28  FVQAERISNEIVIFTGLDKITGQVTSFEVHIGQVYQYGALQVIPRVCYTSSKNEPARTTS 87

Query: 79  FVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           F+ +SE+  ++  R IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 88  FIEVSEMTLEKKTRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK 131


>gi|92117356|ref|YP_577085.1| hypothetical protein Nham_1811 [Nitrobacter hamburgensis X14]
 gi|91800250|gb|ABE62625.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 306

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 68/98 (69%)

Query: 27  NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIF 86
           NK A F+G+DKITGR++ FD ++ ++ QFG+L +K   CY+R   EA   DAFV + EI 
Sbjct: 150 NKKAVFSGLDKITGRIIHFDEDVGETVQFGALRVKTDACYTRPATEAANTDAFVEVDEIT 209

Query: 87  TDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
               V+ IFSGWMFA SP ++ ++H +YD+WL  CKDP
Sbjct: 210 LQGEVKRIFSGWMFAASPGLHGVEHPVYDVWLTDCKDP 247


>gi|319407121|emb|CBI80758.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 121

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 71/104 (68%)

Query: 19  FANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDA 78
           F  + R +N++  F G+DKITG+V +F+V I Q  Q+G+L + P VCY+    E  R  +
Sbjct: 9   FLQAERISNEIVIFTGLDKITGQVTSFEVHIGQVYQYGALQVIPRVCYTSSKNEPARTTS 68

Query: 79  FVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           F+ +SE+  ++  R IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 69  FIEVSEMTLEKKTRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK 112


>gi|163868079|ref|YP_001609283.1| hypothetical protein Btr_0884 [Bartonella tribocorum CIP 105476]
 gi|161017730|emb|CAK01288.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 138

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 75/122 (61%)

Query: 1   MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLII 60
           ++  + L+ +    S      + R +N +A FAG+DKITGR   F+V + +  Q+G+L +
Sbjct: 8   LRIHIFLIGILVFLSLNSGGRAERISNGIAVFAGLDKITGRTTRFEVSLGEVYQYGALQV 67

Query: 61  KPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ 120
            P  CY+    E  R   FV ++E+  D+ +R IF+GWMFADSP +NA++H IYD+WL  
Sbjct: 68  TPRACYTSSKDEPTRTTGFVEVNEVTLDKKIRRIFTGWMFADSPGLNAVEHPIYDVWLKD 127

Query: 121 CK 122
           CK
Sbjct: 128 CK 129


>gi|254502067|ref|ZP_05114218.1| hypothetical protein SADFL11_2105 [Labrenzia alexandrii DFL-11]
 gi|222438138|gb|EEE44817.1| hypothetical protein SADFL11_2105 [Labrenzia alexandrii DFL-11]
          Length = 169

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 48/103 (46%), Positives = 70/103 (67%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A S +  N VA F+G+DKITGR++ FDV + ++ QFG+L + P VC++R   E+     F
Sbjct: 19  AESEKIENPVAVFSGLDKITGRIINFDVYVGETVQFGALQVTPRVCHTRPQTESPLTTGF 78

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V + EI  +  VR IFSGWM+A SP ++A++H +YDIWL  C+
Sbjct: 79  VQVDEITLNNEVRRIFSGWMYAASPGLHAVEHPVYDIWLTDCR 121


>gi|319405550|emb|CBI79169.1| conserved exported hypothetical protein [Bartonella sp. AR 15-3]
          Length = 139

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 78/120 (65%), Gaps = 1/120 (0%)

Query: 3   YRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKP 62
           Y  LL+ +  +F+      + R +N++  F G+DKITG+V +F+V I Q  Q+G+L + P
Sbjct: 13  YTYLLVGIAVLFT-VSCVQAERISNEIVIFTGLDKITGQVTSFEVHIGQVYQYGALQVIP 71

Query: 63  MVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            VCY+    EA R   FV ++E+  ++  R IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 72  RVCYTSSKNEAARTIGFVEVNEMTLEKKTRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK 131


>gi|240850282|ref|YP_002971675.1| hypothetical protein Bgr_06800 [Bartonella grahamii as4aup]
 gi|240267405|gb|ACS50993.1| hypothetical protein Bgr_06800 [Bartonella grahamii as4aup]
          Length = 141

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 76/120 (63%), Gaps = 1/120 (0%)

Query: 3   YRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKP 62
           Y  L+ +L F+ S      + R +N +A FAG+DKITGR   F+V + +  Q+G+L + P
Sbjct: 14  YIFLMGVLVFL-SLNSGVRAERISNGIAVFAGLDKITGRTTRFEVTLGKIYQYGALQVTP 72

Query: 63  MVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
             CY+    E  R   FV ++E+  D+ VR IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 73  RACYTSSKDEPTRTTGFVEVNEVTLDKKVRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK 132


>gi|49474317|ref|YP_032359.1| hypothetical protein BQ07260 [Bartonella quintana str. Toulouse]
 gi|49239821|emb|CAF26212.1| hypothetical protein BQ07260 [Bartonella quintana str. Toulouse]
          Length = 141

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 66/99 (66%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           R +N +  FAG+DKITGR   F+V + +  Q+G+L + P VCY+    E      FV ++
Sbjct: 34  RVSNAIVVFAGLDKITGRTTLFEVSLGEVYQYGALQVTPRVCYTGSKDEPTHTTGFVEVN 93

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           EI  ++ VR IF+GWMFADSP +NA++H +YD+WL  CK
Sbjct: 94  EITLEKKVRRIFTGWMFADSPGLNAVEHPVYDVWLKDCK 132


>gi|121602347|ref|YP_988869.1| hypothetical protein BARBAKC583_0556 [Bartonella bacilliformis
           KC583]
 gi|120614524|gb|ABM45125.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 132

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 71/102 (69%)

Query: 21  NSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
            + R +N +A F+G+DKITGR   F+V I++  QFG+L + P +CY+  + E  R  +F+
Sbjct: 31  QAKRVSNTIAVFSGLDKITGRTTRFEVPIDRVYQFGALQVTPRICYTSSEDEPARPASFI 90

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            ++E+  D+  + IF+GW+FADSP +NA++H IYD+WL  CK
Sbjct: 91  EVNEVTLDKKTQRIFTGWIFADSPGLNAVEHPIYDVWLKDCK 132


>gi|217976383|ref|YP_002360530.1| hypothetical protein Msil_0187 [Methylocella silvestris BL2]
 gi|217501759|gb|ACK49168.1| conserved hypothetical protein [Methylocella silvestris BL2]
          Length = 240

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 67/103 (65%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A + R  + +A F+G+DKITGR++TF+V  +++ QFG+L I    CY+R   EA +   F
Sbjct: 35  AQADRIKHPIAVFSGLDKITGRIITFEVATDETVQFGTLQITERACYTRPATEAPQTTTF 94

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           V + E+      + IFSGWMFA SP ++ I+H IYDIWL  CK
Sbjct: 95  VEVDEVDAKNDYKRIFSGWMFAASPGLHGIEHPIYDIWLTDCK 137


>gi|300022476|ref|YP_003755087.1| hypothetical protein Hden_0952 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299524297|gb|ADJ22766.1| Protein of unknown function DUF2155 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 215

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 75/130 (57%), Gaps = 1/130 (0%)

Query: 13  VFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE 72
           +   A  A + R  N VA F+ +DK+T R+  F+VE+N++ +FG+L + P  CYSR   E
Sbjct: 59  LLGPASPARADRIENGVAVFSALDKVTARISKFEVELNKTVEFGALRVTPRSCYSRPPTE 118

Query: 73  AQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNS 132
             +   FV + E   D   + IF+GWMFA+SP +  ++H  YD+WL  C+ P   S++  
Sbjct: 119 EPKTTTFVEVDETQLDGTEKRIFTGWMFAESPGIYGLEHPTYDVWLTDCEKP-RRSVAEK 177

Query: 133 ESISKKALSE 142
           +    +A SE
Sbjct: 178 KPAPAEAPSE 187


>gi|312116102|ref|YP_004013698.1| hypothetical protein Rvan_3418 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311221231|gb|ADP72599.1| Protein of unknown function DUF2155 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 145

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 65/108 (60%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A++ R AN  A FA +DK+TGRV   ++ + ++  FG+L I P  CY+R   E     AF
Sbjct: 26  ASADRIANSTAVFAALDKVTGRVQPLEIPMGRTVTFGALTITPRACYTRPSTETPLTSAF 85

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPIND 127
           + + E+  D     IF+GW FA+SP ++A++H  +D+WL  CK P  D
Sbjct: 86  IEVDEVVLDGSSHRIFTGWTFAESPGLHAVEHPTFDVWLTSCKTPSAD 133


>gi|182678917|ref|YP_001833063.1| hypothetical protein Bind_1951 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182634800|gb|ACB95574.1| conserved hypothetical protein [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 247

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 19  FANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDA 78
           FA + R  + +A F+G+DKITGR+++F+V  +++ QFGSL I    CY+R   E  +   
Sbjct: 29  FARADRIKHPIAVFSGLDKITGRIISFEVATDETVQFGSLQITERACYTRPSTETPQTIT 88

Query: 79  FVSISEIFT---DRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           FV + EI      +  + IF+GWMFA SP ++A++H +YDIWL  CK
Sbjct: 89  FVEVDEIDAADKTKTPKQIFAGWMFAASPGLHALEHPVYDIWLNDCK 135


>gi|296447987|ref|ZP_06889893.1| Protein of unknown function DUF2155 [Methylosinus trichosporium
           OB3b]
 gi|296254497|gb|EFH01618.1| Protein of unknown function DUF2155 [Methylosinus trichosporium
           OB3b]
          Length = 236

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 65/97 (67%), Gaps = 1/97 (1%)

Query: 27  NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIF 86
           +  A FAG+DK TGR++ FDV I+++ QFGSL I P VC +R   EA +  +FV + +  
Sbjct: 35  HPTAVFAGLDKTTGRIINFDVAIDETVQFGSLQITPRVCNTRPQTEAPQTTSFVEVDDQD 94

Query: 87  TDR-IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
             +   + IFSGWMFA SP ++ ++HS+YD+WL  CK
Sbjct: 95  PAKNEAKRIFSGWMFAASPGLHGVEHSVYDVWLTDCK 131


>gi|323137691|ref|ZP_08072767.1| Protein of unknown function DUF2155 [Methylocystis sp. ATCC 49242]
 gi|322396988|gb|EFX99513.1| Protein of unknown function DUF2155 [Methylocystis sp. ATCC 49242]
          Length = 256

 Score =  105 bits (261), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 75/140 (53%), Gaps = 21/140 (15%)

Query: 2   KYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIK 61
           ++   L +  F  S    A   R  +  A FAG+DK TGR++ FDV I+++ QFG+L + 
Sbjct: 6   RFGAALGVAGFALSGVAVAEPIR--HPTATFAGLDKTTGRIINFDVAIDETVQFGALQVT 63

Query: 62  PMVCYSRDDREAQRIDAFVSISEIF-----------------TD--RIVRSIFSGWMFAD 102
           P VC +R   E  +  +FV + E+                  TD  +  + IFSGWMFA 
Sbjct: 64  PRVCNTRPQTETPQTTSFVEVDELILKPERQGRPEAKPEQAKTDGKQEAKRIFSGWMFAA 123

Query: 103 SPAMNAIDHSIYDIWLMQCK 122
           SP ++ ++H +YD+WL+ CK
Sbjct: 124 SPGLHGVEHPVYDVWLVDCK 143


>gi|154253733|ref|YP_001414557.1| cellulase-like protein [Parvibaculum lavamentivorans DS-1]
 gi|154157683|gb|ABS64900.1| cellulase-like protein [Parvibaculum lavamentivorans DS-1]
          Length = 135

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 67/114 (58%), Gaps = 5/114 (4%)

Query: 25  FANK--VAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSI 82
           FA+K  VA F+G+DK T RV +F V++++ AQFGSL +    C  R   E  +  AF+ I
Sbjct: 22  FADKYPVAVFSGLDKTTARVTSFSVKVDEPAQFGSLEVLVRACDKRPPEEPPQTAAFLEI 81

Query: 83  SEIFTDR---IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSE 133
            +I  D        IF GWMFA+SP +N ++H +YDIW+  CK     + + SE
Sbjct: 82  RQIDRDDDSVQPAPIFEGWMFAESPGLNGLEHPVYDIWVTDCKTASGGASTGSE 135


>gi|163795175|ref|ZP_02189143.1| hypothetical protein BAL199_05889 [alpha proteobacterium BAL199]
 gi|159179573|gb|EDP64102.1| hypothetical protein BAL199_05889 [alpha proteobacterium BAL199]
          Length = 142

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 53/97 (54%)

Query: 25  FANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISE 84
               VA+  G+DK+T R+ T  V +  S  FG+L I    C       A    AF+ I +
Sbjct: 31  LPRPVAKLQGLDKVTARISTVTVPVGDSVVFGTLHITAQTCQEHPPTLAPESAAFLIIED 90

Query: 85  IFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
              D   R IF GWMFA SPA+N++DH +YD+W++ C
Sbjct: 91  QPPDEAPRRIFDGWMFASSPALNSVDHPVYDVWMLAC 127


>gi|144898205|emb|CAM75069.1| conserved hypothetical protein, secreted [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 127

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 65/113 (57%)

Query: 10  LFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRD 69
           L ++ + A    +   +  +A   G+DKIT RV+T +  + +  +FG+L +    C  R 
Sbjct: 12  LLWLTAPAIAQQAPELSLDMAVLGGLDKITARVVTIEAPVGEPVRFGTLEVVARACKKRR 71

Query: 70  DREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
             E+    AF+ I +I   +  + +F GWMFA SPA++A++H +YD+W++ C+
Sbjct: 72  PEESPESAAFLDIWDIKQGQPAQGVFRGWMFASSPALSAMEHPVYDVWVLDCR 124


>gi|114569813|ref|YP_756493.1| hypothetical protein Mmar10_1263 [Maricaulis maris MCS10]
 gi|114340275|gb|ABI65555.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 158

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 54/99 (54%), Gaps = 5/99 (5%)

Query: 29  VAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTD 88
           V    G+DK+T R   F+VEI  + QFG+L I    C  R   E     AF+ I++  TD
Sbjct: 59  VVVLRGLDKVTARTRDFEVEIGDTVQFGALSITAQYCRKRPPEETPETYAFLQINDRRTD 118

Query: 89  RIV-----RSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
                     +FSGWMFA  PA N ++H +YD+W++ C+
Sbjct: 119 GFGVDVEGEQVFSGWMFASRPAQNPLEHPVYDVWVIDCR 157


>gi|83858504|ref|ZP_00952026.1| hypothetical protein OA2633_03356 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853327|gb|EAP91179.1| hypothetical protein OA2633_03356 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 157

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 57/94 (60%), Gaps = 5/94 (5%)

Query: 34  GMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRI-VR 92
           G+DK+T R   F+  I +  +FG+L I    C  R   E   + AF+ I +  TD   V+
Sbjct: 63  GLDKVTARTRDFEAPIGEEVRFGALSITVPYCRKRPPEEPPEVYAFLEIEDRRTDGFGVQ 122

Query: 93  S----IFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           +    +FSGWMFA +PA+NA++H +YD+W++ C+
Sbjct: 123 AEGELMFSGWMFASNPALNALEHPVYDVWVIDCR 156


>gi|83311840|ref|YP_422104.1| hypothetical protein amb2741 [Magnetospirillum magneticum AMB-1]
 gi|82946681|dbj|BAE51545.1| Uncharacterized protein [Magnetospirillum magneticum AMB-1]
          Length = 167

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 54/93 (58%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDR 89
           A   G+DK+T RV+T +  +      G+L I    C  R   +     AF+ I E+  D+
Sbjct: 70  AVLQGLDKVTARVVTVEAPVGAPVHVGALEIIVRACKKRRPEDQPESAAFLDIWELHKDQ 129

Query: 90  IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
              ++F GWMFA SPA++A++H +YDIW++ C+
Sbjct: 130 PASALFRGWMFASSPALSAMEHPVYDIWVLDCR 162


>gi|260575570|ref|ZP_05843568.1| conserved hypothetical protein [Rhodobacter sp. SW2]
 gi|259022213|gb|EEW25511.1| conserved hypothetical protein [Rhodobacter sp. SW2]
          Length = 145

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 74/152 (48%), Gaps = 21/152 (13%)

Query: 7   LLILFFVFSHAKFANSARFANKVAEFAG-----MDKITGRVLTFDVEINQSAQFGSLIIK 61
           LL+L  + S A        A +VA+  G     +DK++G     ++   QSA  G L I+
Sbjct: 4   LLLLAVLASPAA-------AQEVADAPGGILRWLDKVSGETADIELSRGQSAVSGRLTIQ 56

Query: 62  PMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
              C    D  A    A ++I+E   D++   +FSGWM A SPA++A+DH  YD+W+++C
Sbjct: 57  LDACRYPVDNPASNAFAHLTITE---DKVATPVFSGWMVAASPALSALDHRRYDVWVLRC 113

Query: 122 KDPINDSISNSE------SISKKALSEYSSTD 147
             P  D I   E      +    AL E +  D
Sbjct: 114 ITPTTDQIEVPEDAPVEDAAEPPALPEDAPVD 145


>gi|296534672|ref|ZP_06897071.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
 gi|296264997|gb|EFH11223.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
          Length = 124

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 55/97 (56%)

Query: 26  ANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEI 85
           A + A+   +DK+T RV   +  +NQ  QFG+L +    C +R   E     A++ + + 
Sbjct: 28  AARTAKLQALDKVTARVTVLETPVNQPIQFGTLRVTVRACNARPPEEVPDAAAWLEVLDT 87

Query: 86  FTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
             D    + F GWMFA++P ++ ++H +YD+ +++C+
Sbjct: 88  RNDPNGAAAFRGWMFANAPGVSMLEHPVYDLRILECR 124


>gi|83593772|ref|YP_427524.1| cellulase-like protein [Rhodospirillum rubrum ATCC 11170]
 gi|83576686|gb|ABC23237.1| cellulase-like protein [Rhodospirillum rubrum ATCC 11170]
          Length = 163

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 62/126 (49%), Gaps = 6/126 (4%)

Query: 10  LFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSR- 68
           L  + +    A +       A    +DK T RV    + +    + GSL I    C  R 
Sbjct: 19  LCLMLAATAPAGAEDINADTARLGWLDKTTARVGESSIAVGGDLRLGSLTITVRSCVRRV 78

Query: 69  --DDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPIN 126
             DD E+    AF+ I E       + IF GWMFA SP+++A+DH++YD+W+++C+ P +
Sbjct: 79  PPDDPESA---AFLDIVERAEGVAAKQIFEGWMFASSPSLSAMDHAVYDVWVLRCEIPAD 135

Query: 127 DSISNS 132
               +S
Sbjct: 136 RDAGDS 141


>gi|294678127|ref|YP_003578742.1| hypothetical protein RCAP_rcc02605 [Rhodobacter capsulatus SB 1003]
 gi|294476947|gb|ADE86335.1| conserved hypothetical protein [Rhodobacter capsulatus SB 1003]
          Length = 122

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 52/93 (55%), Gaps = 3/93 (3%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDR 89
           A   G+DKI G      + + QS  +GSL ++   C    D  A    AF+ I++     
Sbjct: 31  ATLRGLDKIAGAATDLPLSVGQSLDYGSLSVRLTDCRYPADDPASNAYAFLEITDT---A 87

Query: 90  IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           I R +F GWM A +PA++A+DH  YD+W+++CK
Sbjct: 88  IGREVFRGWMIAQNPALSALDHQRYDVWVLRCK 120


>gi|288958846|ref|YP_003449187.1| hypothetical protein AZL_020050 [Azospirillum sp. B510]
 gi|288911154|dbj|BAI72643.1| hypothetical protein AZL_020050 [Azospirillum sp. B510]
          Length = 134

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 51/95 (53%)

Query: 27  NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIF 86
              A+   +DK+T R  TF + + ++    SL I    C      E     AF+ ++EI 
Sbjct: 38  RPAAKLQWLDKVTARTSTFTMRVGETKAMSSLRITLRACRENPPIETPESAAFLEVTEIK 97

Query: 87  TDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
                  +FSGWMF+ SPA++A+++ IYD+W++ C
Sbjct: 98  PGEQAEQVFSGWMFSSSPALSAMENPIYDVWVLGC 132


>gi|294084611|ref|YP_003551369.1| cellulase-like protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664184|gb|ADE39285.1| cellulase-like protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 139

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 65/121 (53%), Gaps = 2/121 (1%)

Query: 4   RVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           +++   +    S+A    +     K+    G+DKIT R+ T    I+   +FG+L +   
Sbjct: 17  KIIFAAMVLYVSYAMPVAAEWIDGKIVVLQGLDKITARITTLTTAIDTPLRFGTLQLTVN 76

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIV--RSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
            C  R   E     AF++I +   D  +  +S+F+GWMF+ SPA++A++H +YDI L+ C
Sbjct: 77  RCAFRPPEEPPENVAFLTILDRGHDLSLAPKSVFTGWMFSSSPAVSAMEHPVYDITLLSC 136

Query: 122 K 122
           +
Sbjct: 137 R 137


>gi|149201009|ref|ZP_01877984.1| hypothetical protein RTM1035_15327 [Roseovarius sp. TM1035]
 gi|149145342|gb|EDM33368.1| hypothetical protein RTM1035_15327 [Roseovarius sp. TM1035]
          Length = 111

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 54/90 (60%), Gaps = 5/90 (5%)

Query: 34  GMDKITGRVLTFDVEINQSAQFGSLIIKPMVC-YSRDDREAQRIDAFVSISEIFTDRIVR 92
           G+DKI G     ++   QS  FGSL +    C Y +DD  A    A+++ISE     +  
Sbjct: 25  GLDKINGSAQDLELANGQSGVFGSLDVVLGECRYPQDDPAADAY-AYLTISEQAGGAV-- 81

Query: 93  SIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            IFSGWM A SPA+NA++H  YDIW+++CK
Sbjct: 82  -IFSGWMLASSPALNALEHPRYDIWVLRCK 110


>gi|114799292|ref|YP_760947.1| hypothetical protein HNE_2252 [Hyphomonas neptunium ATCC 15444]
 gi|114739466|gb|ABI77591.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 184

 Score = 71.6 bits (174), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 60/139 (43%), Gaps = 18/139 (12%)

Query: 4   RVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           R L L    V +    + S       A    +DKITGR     V++ +   +GSL +   
Sbjct: 6   RFLALASLSVLAALPASASTMAQKNEATLRALDKITGRSTDIVVKVGEPVVYGSLRVDLK 65

Query: 64  VCYSRDDREAQRIDAFVSIS-------EIFTDRIVRS-----------IFSGWMFADSPA 105
            CY     E     AF+ I+       E     +              +FSGWM+A SP 
Sbjct: 66  ACYQAPPEEVPESAAFLRIASTQPVAVETMEAAVAAKDVPPSEADSPILFSGWMYASSPG 125

Query: 106 MNAIDHSIYDIWLMQCKDP 124
           +NA++H +YDIW+++C  P
Sbjct: 126 LNALEHPVYDIWVIRCTAP 144


>gi|126727094|ref|ZP_01742931.1| hypothetical protein RB2150_00624 [Rhodobacterales bacterium
           HTCC2150]
 gi|126703522|gb|EBA02618.1| hypothetical protein RB2150_00624 [Rhodobacterales bacterium
           HTCC2150]
          Length = 119

 Score = 71.2 bits (173), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 65/122 (53%), Gaps = 7/122 (5%)

Query: 6   LLLILFFVFSHAKFANSAR--FANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           ++ +L  + +   FA  A    +   A    +DK++G+   FD+   QSA  G+L +   
Sbjct: 1   MIRVLAVIAALCPFAALAEDTTSTTTANMRALDKVSGQTWDFDISSGQSASLGNLTLFSK 60

Query: 64  VC-YSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            C Y  DD  +   +A+V +S I  +R    +F GWM A SPA+NA DH+ YD+WL+ C 
Sbjct: 61  ECRYPTDDPSS---NAYVYLS-IQDERDGGELFRGWMVAASPALNAFDHARYDVWLLSCA 116

Query: 123 DP 124
            P
Sbjct: 117 LP 118


>gi|254294263|ref|YP_003060286.1| hypothetical protein Hbal_1904 [Hirschia baltica ATCC 49814]
 gi|254042794|gb|ACT59589.1| conserved hypothetical protein [Hirschia baltica ATCC 49814]
          Length = 217

 Score = 71.2 bits (173), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 62/115 (53%), Gaps = 11/115 (9%)

Query: 15  SHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCY-SRDDREA 73
           +   FA   R   KV     ++KITG+    ++E++++ QFG L +    C+ S  + + 
Sbjct: 20  TQTAFALDPRPGVKVR---ALEKITGKATDIEIELDETVQFGGLGLTVRACHQSPPEDQP 76

Query: 74  QRIDAFVSISEIFTDRIVRS-------IFSGWMFADSPAMNAIDHSIYDIWLMQC 121
               A++ +  +  +    +       +FSGWMFA SP +NA++HS+YD+W++ C
Sbjct: 77  PEAAAYLEVISMGVNAETGTAKDDDPRLFSGWMFASSPGLNALEHSLYDVWVISC 131


>gi|83949686|ref|ZP_00958419.1| hypothetical protein ISM_01290 [Roseovarius nubinhibens ISM]
 gi|83837585|gb|EAP76881.1| hypothetical protein ISM_01290 [Roseovarius nubinhibens ISM]
          Length = 129

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 50/88 (56%), Gaps = 3/88 (3%)

Query: 35  MDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSI 94
           +DK+ G V   ++    SA+FG L I    C   +   A    AF++I E   D   +  
Sbjct: 42  LDKVNGSVTDLELGNASSARFGRLTINLGECRFPEGDPAGDAYAFLTIQE---DGQTQPQ 98

Query: 95  FSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           FSGWM A SPA++A+DH  YD+W+M+CK
Sbjct: 99  FSGWMIASSPALSALDHPRYDVWVMRCK 126


>gi|254459519|ref|ZP_05072935.1| conserved hypothetical protein [Rhodobacterales bacterium HTCC2083]
 gi|206676108|gb|EDZ40595.1| conserved hypothetical protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 120

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 57/115 (49%), Gaps = 3/115 (2%)

Query: 8   LILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYS 67
           L   F+ + A  A  A  +   AE   +DK++G+   +D+      + G L I    C  
Sbjct: 7   LAGLFLCASAVHAQQAVSSGTGAELRVLDKVSGQSSNYDLASGSKMEIGQLTIALRAC-- 64

Query: 68  RDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           R    A   DAF  I E+        IF GWM A SPA+NA++H  YD+W+++CK
Sbjct: 65  RYPEGAPANDAFAYI-EVNETESATGIFGGWMIASSPALNAMEHPRYDVWVLRCK 118


>gi|260426797|ref|ZP_05780776.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260421289|gb|EEX14540.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 119

 Score = 68.9 bits (167), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (51%), Gaps = 3/102 (2%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A  A  +   A   G+DK+TGR    ++   Q+AQFG + I    C      +A    AF
Sbjct: 18  AQEATSSGSGAVLRGLDKLTGRASDIELGTGQTAQFGRIEISLAECRYPVGNQAGDAFAF 77

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           +++ E          F GWM A SPA+NA+DH  YD+W+++C
Sbjct: 78  LTVREAGHPD---PAFRGWMVASSPALNAMDHQRYDVWVLRC 116


>gi|114767025|ref|ZP_01445933.1| hypothetical protein 1100011001191_R2601_18438 [Pelagibaca
           bermudensis HTCC2601]
 gi|114540809|gb|EAU43873.1| hypothetical protein R2601_18438 [Roseovarius sp. HTCC2601]
          Length = 119

 Score = 68.9 bits (167), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 48/88 (54%), Gaps = 3/88 (3%)

Query: 34  GMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRS 93
           G+DK+TGR    ++   ++AQF    I    C   +   A    AF+++ E         
Sbjct: 32  GLDKLTGRAYDIEMRAGETAQFARTEISLQECRYPEGDPAGDAFAFLTVREAGN---AEP 88

Query: 94  IFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           +F GWM A SPA+NA+DH  YD+W+++C
Sbjct: 89  VFRGWMIASSPALNAMDHQRYDVWVLRC 116


>gi|304570805|ref|YP_002517336.2| hypothetical protein CCNA_01963 [Caulobacter crescentus NA1000]
          Length = 194

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 57/114 (50%), Gaps = 9/114 (7%)

Query: 17  AKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVC-YSRDDREAQR 75
           A+ A  AR++  VA    +DK+T   + F+V I Q  ++ +LI     C  +  D  A  
Sbjct: 73  AEPAKRARYS--VAILQALDKVTTETMRFEVPIGQPIRYKTLIFTVRACETAAADEVAPE 130

Query: 76  IDAFVSI---SEIFTDRIV---RSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
             A+V +    +    R     R I+ GWM+A SP +N + H +YD WL+ CK 
Sbjct: 131 SAAYVVVDTQPKAQAGRAAPPGRQIYKGWMYASSPGLNPLQHPVYDAWLIACKQ 184


>gi|16126129|ref|NP_420693.1| hypothetical protein CC_1886 [Caulobacter crescentus CB15]
 gi|13423333|gb|AAK23861.1| hypothetical protein CC_1886 [Caulobacter crescentus CB15]
          Length = 223

 Score = 68.6 bits (166), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 57/114 (50%), Gaps = 9/114 (7%)

Query: 17  AKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVC-YSRDDREAQR 75
           A+ A  AR++  VA    +DK+T   + F+V I Q  ++ +LI     C  +  D  A  
Sbjct: 102 AEPAKRARYS--VAILQALDKVTTETMRFEVPIGQPIRYKTLIFTVRACETAAADEVAPE 159

Query: 76  IDAFVSI---SEIFTDRIV---RSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
             A+V +    +    R     R I+ GWM+A SP +N + H +YD WL+ CK 
Sbjct: 160 SAAYVVVDTQPKAQAGRAAPPGRQIYKGWMYASSPGLNPLQHPVYDAWLIACKQ 213


>gi|167646524|ref|YP_001684187.1| hypothetical protein Caul_2562 [Caulobacter sp. K31]
 gi|167348954|gb|ABZ71689.1| conserved hypothetical protein [Caulobacter sp. K31]
          Length = 227

 Score = 68.2 bits (165), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 54/106 (50%), Gaps = 7/106 (6%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVC-YSRDDREAQRIDAFVSI 82
           R  + VA    +DK+T   + F+  + Q  ++ +L+     C  +  D +A    A+V +
Sbjct: 111 RSRSSVAIIQALDKVTTETMRFEAPVGQPIRYKTLVFTVRACETTTPDEDAPDSVAYVVV 170

Query: 83  ---SEIFTDRIV---RSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
               +    R+    R I+ GWM+A+SP +N + H +YD WL+ CK
Sbjct: 171 DTQPKALPGRVAPPGRQIYKGWMYANSPGLNPLQHPVYDAWLIACK 216


>gi|85704727|ref|ZP_01035828.1| hypothetical protein ROS217_06595 [Roseovarius sp. 217]
 gi|85670545|gb|EAQ25405.1| hypothetical protein ROS217_06595 [Roseovarius sp. 217]
          Length = 119

 Score = 68.2 bits (165), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 52/89 (58%), Gaps = 3/89 (3%)

Query: 34  GMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRS 93
           G+DKI G+    D+   +   FG+L ++   C   +   A    A+++I E     +V  
Sbjct: 33  GLDKINGQASDLDLANGEMGAFGTLDVELGECRYPEGNPAGDSYAYLTIREQNGGAVV-- 90

Query: 94  IFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            FSGWM A SPA+NA++H+ YDIW+++CK
Sbjct: 91  -FSGWMLASSPALNALEHARYDIWVLRCK 118


>gi|91762149|ref|ZP_01264114.1| hypothetical protein PU1002_02751 [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91717951|gb|EAS84601.1| hypothetical protein PU1002_02751 [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 135

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 64/119 (53%), Gaps = 2/119 (1%)

Query: 5   VLLLILFFVFS-HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           + +LI FF+ S  +    +     K  E   +DK++ +     ++I +  +F SL+IK +
Sbjct: 16  LFILIYFFLTSISSPLVANENSEGKFVEIKILDKVSSKTDLLKLKIGEELRFKSLLIKSL 75

Query: 64  VCYSRDDREAQRIDAFVSISE-IFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
            C + +  +   I +++ + + I  D     IF+GW F+ SPA+N  DH +YDIWL +C
Sbjct: 76  KCKNSEFDDNPEITSYIQVKDTINNDNNEVFIFNGWTFSSSPAVNPFDHPVYDIWLTRC 134


>gi|71083428|ref|YP_266147.1| hypothetical protein SAR11_0725 [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71062541|gb|AAZ21544.1| conserved hypothetical protein [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 135

 Score = 67.8 bits (164), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 28  KVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISE-IF 86
           K  E   +DK++ +     ++I +  +F SL+IK + C + +  +   I  ++ + + I 
Sbjct: 40  KFVEIKILDKVSSKTDLLKLKIGEELRFKSLLIKSLKCKNSEFDDNPEITVYIQVKDTIK 99

Query: 87  TDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
            D     IF+GW F+ SPA+N  DH +YDIWL +C
Sbjct: 100 NDNNEVFIFNGWTFSSSPAVNPFDHPVYDIWLTRC 134


>gi|159043941|ref|YP_001532735.1| hypothetical protein Dshi_1392 [Dinoroseobacter shibae DFL 12]
 gi|157911701|gb|ABV93134.1| conserved hypothetical protein [Dinoroseobacter shibae DFL 12]
          Length = 180

 Score = 67.8 bits (164), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 51/90 (56%), Gaps = 5/90 (5%)

Query: 35  MDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSI 94
           +DK TGRV T ++   ++ Q G L I  + C   ++  A   DAFV +    T+R    +
Sbjct: 74  LDKTTGRVETLEIPAGEARQSGRLSITLIECRFPEENPAS--DAFVHLQ--ITERDT-PL 128

Query: 95  FSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
           + GWM A SPA+ A+DH  YD+W ++C  P
Sbjct: 129 YDGWMIASSPALAALDHHRYDVWALRCATP 158


>gi|149916369|ref|ZP_01904889.1| hypothetical protein RAZWK3B_12282 [Roseobacter sp. AzwK-3b]
 gi|149809823|gb|EDM69675.1| hypothetical protein RAZWK3B_12282 [Roseobacter sp. AzwK-3b]
          Length = 121

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 54/94 (57%), Gaps = 5/94 (5%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVC-YSRDDREAQRIDAFVSISEIFTD 88
           A   G+DKI G  +   +   +SA+ G+L +    C Y   D  +   DAF  I+ +   
Sbjct: 30  AALRGLDKINGDTVDMMLATGESAELGNLEVTLGECRYPAGDAAS---DAFAYIT-VRDP 85

Query: 89  RIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           RI + +F GWM A SPA+NA++H  YD+W+++C+
Sbjct: 86  RIGQPVFEGWMIASSPALNAMEHQRYDVWVLRCR 119


>gi|295689564|ref|YP_003593257.1| hypothetical protein Cseg_2176 [Caulobacter segnis ATCC 21756]
 gi|295431467|gb|ADG10639.1| Protein of unknown function DUF2155 [Caulobacter segnis ATCC 21756]
          Length = 221

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 55/111 (49%), Gaps = 9/111 (8%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVC-YSRDDREAQRIDA 78
           A   R+A  +A    +DK+T   + F+V + Q  ++ +L+     C  +  D  A    A
Sbjct: 103 AKRQRYA--IAILQALDKVTTETMRFEVPVGQPIRYKTLVFTVRACETAAADEIAPETTA 160

Query: 79  FVSI---SEIFTDRIV---RSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
           +V +    +    R     R I+ GWM+A SP +N ++H +YD WL+ CK 
Sbjct: 161 YVIVDTQPKAQAGRPAPPGRQIYKGWMYASSPGLNPLEHPVYDAWLIACKQ 211


>gi|119384014|ref|YP_915070.1| hypothetical protein Pden_1269 [Paracoccus denitrificans PD1222]
 gi|119373781|gb|ABL69374.1| conserved hypothetical protein [Paracoccus denitrificans PD1222]
          Length = 163

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (58%), Gaps = 7/94 (7%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVC-YSRDDREAQRIDAFVSISEIFTD 88
           A+  G+DKITGR   F + + + A+FG L +    C Y   D  +   DA+  ++   TD
Sbjct: 72  AQLRGLDKITGRTQDFTLAVGEVAEFGRLQLSLAECRYPAADPTS---DAYAELT--ITD 126

Query: 89  RIVRS-IFSGWMFADSPAMNAIDHSIYDIWLMQC 121
               + +FSGWM A SPA++++D S YD+W++ C
Sbjct: 127 SQANARLFSGWMIASSPALSSLDDSRYDVWVISC 160


>gi|254475589|ref|ZP_05088975.1| conserved hypothetical protein [Ruegeria sp. R11]
 gi|214029832|gb|EEB70667.1| conserved hypothetical protein [Ruegeria sp. R11]
          Length = 122

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 50/88 (56%), Gaps = 3/88 (3%)

Query: 34  GMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRS 93
           G+DK+ G+    +V +  SA+   +I+  M C    D       A++++ +   D  V  
Sbjct: 35  GLDKVNGQTQDLEVPVGSSAEIFGVIVNVMDCRYPADNPTGDAFAYLTVRDP-NDGTV-- 91

Query: 94  IFSGWMFADSPAMNAIDHSIYDIWLMQC 121
            F GWM A SPA+NA+DHS YDIW+M+C
Sbjct: 92  FFDGWMIASSPALNALDHSRYDIWVMRC 119


>gi|126733140|ref|ZP_01748887.1| hypothetical protein RCCS2_03274 [Roseobacter sp. CCS2]
 gi|126716006|gb|EBA12870.1| hypothetical protein RCCS2_03274 [Roseobacter sp. CCS2]
          Length = 146

 Score = 65.5 bits (158), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 51/91 (56%), Gaps = 13/91 (14%)

Query: 35  MDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVR-- 92
           +DK+TG+V    +E  Q+A  G L +K   C  R   E    DAF  I       +VR  
Sbjct: 62  LDKLTGQVSDVSLETGQTATLGFLSVKLNEC--RYPIENPSGDAFTQI-------VVRDN 112

Query: 93  --SIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
             ++FSGWM A +PA+NA+DH  YD+W ++C
Sbjct: 113 EGTLFSGWMLASAPALNAMDHPRYDVWALRC 143


>gi|255263053|ref|ZP_05342395.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255105388|gb|EET48062.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 119

 Score = 64.7 bits (156), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 49/88 (55%), Gaps = 3/88 (3%)

Query: 35  MDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSI 94
           +DKITGRV   +++   +A+ G L +    C       +    A +++ E  T      +
Sbjct: 34  LDKITGRVADVELDTGGTARQGRLSVTLAECRYPSGNRSGNAYALLTVIEAGTPD---PV 90

Query: 95  FSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           F GWM A +PA+NA++H  YD+W+M+CK
Sbjct: 91  FRGWMIASAPALNAMEHPRYDVWVMRCK 118


>gi|86137322|ref|ZP_01055899.1| hypothetical protein MED193_05669 [Roseobacter sp. MED193]
 gi|85825657|gb|EAQ45855.1| hypothetical protein MED193_05669 [Roseobacter sp. MED193]
          Length = 133

 Score = 64.3 bits (155), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 51/99 (51%), Gaps = 3/99 (3%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDR 89
           A   G+DK+ G     +V+I  SA+   LI+    C            A+++I +     
Sbjct: 37  AVLRGLDKVNGHHTDIEVQIGGSAEIYGLIVTLTECRYPAANPTGDAYAYLTIRDPLNGE 96

Query: 90  IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDS 128
           +    F GWM A SPA++A+DH+ YD+W+++CK  + + 
Sbjct: 97  V---FFDGWMIASSPALSALDHARYDVWVIRCKSSVGEG 132


>gi|220964072|gb|ACL95428.1| conserved hypothetical protein [Caulobacter crescentus NA1000]
          Length = 112

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 34  GMDKITGRVLTFDVEINQSAQFGSLIIKPMVC-YSRDDREAQRIDAFVSI---SEIFTDR 89
            +DK+T   + F+V I Q  ++ +LI     C  +  D  A    A+V +    +    R
Sbjct: 6   ALDKVTTETMRFEVPIGQPIRYKTLIFTVRACETAAADEVAPESAAYVVVDTQPKAQAGR 65

Query: 90  IV---RSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
                R I+ GWM+A SP +N + H +YD WL+ CK
Sbjct: 66  AAPPGRQIYKGWMYASSPGLNPLQHPVYDAWLIACK 101


>gi|99081361|ref|YP_613515.1| hypothetical protein TM1040_1520 [Ruegeria sp. TM1040]
 gi|99037641|gb|ABF64253.1| hypothetical protein TM1040_1520 [Ruegeria sp. TM1040]
          Length = 145

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 51/89 (57%), Gaps = 3/89 (3%)

Query: 34  GMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRS 93
           G+DK+ G+ +  +V+   +A+   LI+    C  R   E    DAF  ++ I   +  + 
Sbjct: 58  GLDKVNGKSVDVEVQTGGTAEIFGLIVTLREC--RYPTENPSGDAFAYLT-IRDRQDGKV 114

Query: 94  IFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            F GWM A SPA+NA+DH  YD+W+++CK
Sbjct: 115 FFDGWMIASSPALNALDHRRYDVWVLRCK 143


>gi|259416815|ref|ZP_05740735.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259348254|gb|EEW60031.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 145

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 3/94 (3%)

Query: 29  VAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTD 88
           +A   G+DK+ G+    DV+   S +   LI+    C  R   E    DAF  ++ I   
Sbjct: 53  IASLRGLDKVNGKSTDVDVQTGGSVEVFGLIVTMREC--RYPTENPSGDAFAYLT-IRDR 109

Query: 89  RIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           +  +  F GWM A SPA++A+DH  YD+W+++CK
Sbjct: 110 QDGKVFFDGWMIASSPALSALDHRRYDVWVLRCK 143


>gi|163741338|ref|ZP_02148730.1| hypothetical protein RG210_17800 [Phaeobacter gallaeciensis 2.10]
 gi|161385691|gb|EDQ10068.1| hypothetical protein RG210_17800 [Phaeobacter gallaeciensis 2.10]
          Length = 120

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 49/92 (53%), Gaps = 3/92 (3%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDR 89
           A   G+DK+ G+    ++ +  SA+   +I+    C    D       A++++     D 
Sbjct: 29  AVLRGLDKVNGQTQDLEIPVGGSAEIFGVIVSLRECRYPADNPTGDAYAYLTVRNP-NDA 87

Query: 90  IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
            V   F GWM A SPA+NA+DHS YD+W+M+C
Sbjct: 88  TV--YFDGWMIASSPALNALDHSRYDVWVMRC 117


>gi|254511429|ref|ZP_05123496.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221535140|gb|EEE38128.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 119

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 52/95 (54%), Gaps = 3/95 (3%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDR 89
           A   G+DK++G+ L  ++   Q+     L +    C  R   E    DAF  ++ I+   
Sbjct: 28  AMLRGLDKVSGQTLDVEIRNGQTETVFGLDVALGDC--RYPAENPTGDAFAYLT-IWEQG 84

Query: 90  IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
             + +F GWM A SPA+NA+DH+ YD+W+++C  P
Sbjct: 85  KAQQLFDGWMVATSPALNALDHARYDVWVIRCMTP 119


>gi|163736132|ref|ZP_02143551.1| hypothetical protein RGBS107_13411 [Phaeobacter gallaeciensis
           BS107]
 gi|161390002|gb|EDQ14352.1| hypothetical protein RGBS107_13411 [Phaeobacter gallaeciensis
           BS107]
          Length = 120

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 49/92 (53%), Gaps = 3/92 (3%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDR 89
           A   G+DK+ G+    ++ +  SA+   +I+    C    D       A++++     D 
Sbjct: 29  AVLRGLDKVNGQTQDLEIPVGGSAEIFGVIVSLRECRYPADNPTGDAYAYLTVRNP-NDA 87

Query: 90  IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
            V   F GWM A SPA+NA+DHS YD+W+M+C
Sbjct: 88  TV--YFDGWMIASSPALNALDHSRYDVWVMRC 117


>gi|84515419|ref|ZP_01002781.1| hypothetical protein SKA53_02136 [Loktanella vestfoldensis SKA53]
 gi|84510702|gb|EAQ07157.1| hypothetical protein SKA53_02136 [Loktanella vestfoldensis SKA53]
          Length = 131

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (55%), Gaps = 5/88 (5%)

Query: 35  MDKITGRVLTFDVEINQSAQFGSLIIKPMVC-YSRDDREAQRIDAFVSISEIFTDRIVRS 93
           +DK+TG V   +V   Q+   G+L +    C Y  ++  ++   A V    I     V  
Sbjct: 33  LDKLTGAVTDLEVSNGQTDNVGALSVTLGDCRYPAENVASEGYAALV----IHYRAEVAP 88

Query: 94  IFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           IF+GWM A SPA+NA+DH  YD+W+++C
Sbjct: 89  IFAGWMLASSPALNALDHPRYDVWVLRC 116


>gi|329850493|ref|ZP_08265338.1| hypothetical protein ABI_34000 [Asticcacaulis biprosthecum C19]
 gi|328840808|gb|EGF90379.1| hypothetical protein ABI_34000 [Asticcacaulis biprosthecum C19]
          Length = 233

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 57/118 (48%), Gaps = 16/118 (13%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQR-IDAFVSI 82
           R+   + E   +DK+    + F+  I Q  +F  LI     C    D EAQ  + A++++
Sbjct: 121 RYGTAIIE--ALDKVNAESVRFEAPIGQPVRFKGLIYLVKACEMTADDEAQNDVMAYMTV 178

Query: 83  SEIFTDRIV----------RSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
               T+ +           + IF GW F+ SP++N + H IYD W++ C+ P+  + S
Sbjct: 179 R---TNPVAATNTSIGSKSKQIFQGWSFSSSPSLNPMQHPIYDAWVIGCRKPLGGTTS 233


>gi|126741250|ref|ZP_01756929.1| hypothetical protein RSK20926_17467 [Roseobacter sp. SK209-2-6]
 gi|126717655|gb|EBA14378.1| hypothetical protein RSK20926_17467 [Roseobacter sp. SK209-2-6]
          Length = 126

 Score = 62.0 bits (149), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 54/100 (54%), Gaps = 17/100 (17%)

Query: 29  VAEFAGMDKITGRVLTFDVEINQSAQ-FGSLIIKPMVCYSRDDREAQRIDAFVSISEIFT 87
           +A   G+DK+ G+    +V++ +SA+ FG L+      Y  D+      DAF  +     
Sbjct: 34  MAILRGLDKVNGQSTDVEVQVGRSAEVFGLLVTLAQCRYPVDNPTG---DAFAYL----- 85

Query: 88  DRIVR------SIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
             I+R        F GWM A SPA+NA+DHS YD+W+++C
Sbjct: 86  --IIRDPNNGAQFFEGWMIASSPALNALDHSRYDVWVIRC 123


>gi|254453527|ref|ZP_05066964.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198267933|gb|EDY92203.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
          Length = 105

 Score = 61.6 bits (148), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 46/87 (52%), Gaps = 3/87 (3%)

Query: 35  MDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSI 94
           +DKITGR    +    Q+   G L I    C  R     Q  DA+  ++ ++ +     +
Sbjct: 19  LDKITGRTHDLEFGNGQTQTVGLLAITMTEC--RYPSGNQSGDAYTLLTIVY-NNAADPV 75

Query: 95  FSGWMFADSPAMNAIDHSIYDIWLMQC 121
           F GWM A +PA+NA+DH  YD+W ++C
Sbjct: 76  FRGWMIASAPALNALDHPRYDVWTLRC 102


>gi|56695909|ref|YP_166260.1| hypothetical protein SPO1008 [Ruegeria pomeroyi DSS-3]
 gi|56677646|gb|AAV94312.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 119

 Score = 61.6 bits (148), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 53/95 (55%), Gaps = 3/95 (3%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDR 89
           A   G+DK++G+   F V    +A+   L +    C  R   E    DAF  ++ I+   
Sbjct: 28  AMLRGLDKVSGQTEDFRVATGGTAEIYGLDVALGDC--RYPVENPTGDAFAYLT-IWERG 84

Query: 90  IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
             ++IF GWM A SPA++A+DHS YD+W+++C  P
Sbjct: 85  QRQAIFDGWMIASSPALSALDHSRYDVWVIRCMTP 119


>gi|89068966|ref|ZP_01156348.1| hypothetical protein OG2516_01791 [Oceanicola granulosus HTCC2516]
 gi|89045547|gb|EAR51611.1| hypothetical protein OG2516_01791 [Oceanicola granulosus HTCC2516]
          Length = 117

 Score = 61.6 bits (148), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 49/87 (56%), Gaps = 3/87 (3%)

Query: 35  MDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSI 94
           +DK TG V   +++  Q+AQ G + +    C       A   DA+  ++  +  + V  +
Sbjct: 31  LDKQTGHVEDLELQAGQTAQSGLVEVSLGACRYPAGNPAG--DAYALLTVHYRGQ-VEPV 87

Query: 95  FSGWMFADSPAMNAIDHSIYDIWLMQC 121
           F GWM A +PA+NA+DH  YD+W+++C
Sbjct: 88  FRGWMIASAPALNAMDHPRYDVWVLRC 114


>gi|260432985|ref|ZP_05786956.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416813|gb|EEX10072.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 119

 Score = 61.2 bits (147), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 53/95 (55%), Gaps = 3/95 (3%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDR 89
           A   G+DK++G+ +  +++  ++A    L +    C  R   E    DAF  ++ I+   
Sbjct: 28  AVLRGLDKVSGQTVDVEMQPGETASIFGLDVALGDC--RYPTENPTGDAFAFLT-IWEKG 84

Query: 90  IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
               +F GWM A SPA+NA+DHS YD+W+++C  P
Sbjct: 85  EAEQLFDGWMIATSPALNALDHSRYDVWVIRCITP 119


>gi|77463761|ref|YP_353265.1| hypothetical protein RSP_0193 [Rhodobacter sphaeroides 2.4.1]
 gi|126462591|ref|YP_001043705.1| hypothetical protein Rsph17029_1826 [Rhodobacter sphaeroides ATCC
           17029]
 gi|332558617|ref|ZP_08412939.1| hypothetical protein RSWS8N_06160 [Rhodobacter sphaeroides WS8N]
 gi|77388179|gb|ABA79364.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
 gi|126104255|gb|ABN76933.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17029]
 gi|332276329|gb|EGJ21644.1| hypothetical protein RSWS8N_06160 [Rhodobacter sphaeroides WS8N]
          Length = 123

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 48/87 (55%), Gaps = 3/87 (3%)

Query: 35  MDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSI 94
           +DK++G     +++  QSA  G L I+   C       A   DA+  ++ I   R    +
Sbjct: 32  LDKMSGETADVELQRGQSAVSGHLTIELDECRFPAGDPAS--DAYAHLT-IRDSRAAEPV 88

Query: 95  FSGWMFADSPAMNAIDHSIYDIWLMQC 121
           F GWM A SPA++A+DH  YD+WL++C
Sbjct: 89  FDGWMIASSPALSALDHPRYDVWLLRC 115


>gi|254456041|ref|ZP_05069470.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207083043|gb|EDZ60469.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 135

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 62/121 (51%), Gaps = 6/121 (4%)

Query: 3   YRVLLLILFFV-FSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIK 61
           Y +L + LF   FS AK      F     +   +DKI+ +     ++  +  +F  L IK
Sbjct: 18  YFILFIYLFLCNFSFAKNNTEGVFT----DLKILDKISSKNTLIQLKNGELVKFKDLSIK 73

Query: 62  PMVCYSRDDREAQRIDAFVSISEIF-TDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ 120
            + C + +  +   I A++ + ++   D+    +F+GWMF+ SP++   DH +YD+WL+ 
Sbjct: 74  SLKCKNSEFDDNPEITAYIQVKDLTDQDKDEVFVFNGWMFSSSPSITPFDHPVYDVWLVN 133

Query: 121 C 121
           C
Sbjct: 134 C 134


>gi|329890102|ref|ZP_08268445.1| hypothetical protein BDIM_17990 [Brevundimonas diminuta ATCC 11568]
 gi|328845403|gb|EGF94967.1| hypothetical protein BDIM_17990 [Brevundimonas diminuta ATCC 11568]
          Length = 231

 Score = 60.5 bits (145), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 54/106 (50%), Gaps = 7/106 (6%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEIN-QSAQFG-SLIIKPMVC-YSRDDREAQRIDAFV 80
           R   ++A    +DK T   + F+VE+  +  +FG +L+ K   C  S  D   +   A++
Sbjct: 125 RQRRRIAVIQAVDKTTAETMRFEVEVGGRPVRFGKTLLFKARACEVSASDEMTEDAIAYM 184

Query: 81  SIS----EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            +      +      R +F GWMFA SP+++ + H +YD W++ CK
Sbjct: 185 EVGVQPRGLAAPTEARQVFKGWMFASSPSVSGLQHPVYDAWVVGCK 230


>gi|146277492|ref|YP_001167651.1| hypothetical protein Rsph17025_1452 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555733|gb|ABP70346.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 123

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 54/100 (54%), Gaps = 10/100 (10%)

Query: 28  KVAEFAG-----MDKITGRVLTFDVEINQSAQFGSLIIKPMVC-YSRDDREAQRIDAFVS 81
           + AE +G     +DK++G     ++   QSA  G L I+   C Y   D  +   DAF  
Sbjct: 20  RTAEGSGALLRWLDKMSGETADAELMRGQSAVSGHLTIELDECRYPAGDPAS---DAFAH 76

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           ++ I   R    +F GWM A SPA++++DH  YD+WL++C
Sbjct: 77  LT-IRDSRAAEPVFDGWMIASSPALSSLDHPRYDVWLLRC 115


>gi|84686584|ref|ZP_01014477.1| hypothetical protein 1099457000254_RB2654_07826 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84665497|gb|EAQ11974.1| hypothetical protein RB2654_07826 [Rhodobacterales bacterium
           HTCC2654]
          Length = 179

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 5/93 (5%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVC-YSRDDREAQRIDAFVSISEIFTD 88
           A   G+DK+ G  +  ++   ++ + G L +    C Y  D+ +    DAF  +  I   
Sbjct: 88  AVLRGLDKLAGTSIDLNLATGETGELGWLQVTMAECRYPNDNPQG---DAFAHLV-IRNG 143

Query: 89  RIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
                +F GWM A SPA++A+DHS +D+W+M C
Sbjct: 144 NDEEPLFDGWMIASSPALSALDHSRFDVWVMNC 176


>gi|84499427|ref|ZP_00997715.1| hypothetical protein OB2597_05850 [Oceanicola batsensis HTCC2597]
 gi|84392571|gb|EAQ04782.1| hypothetical protein OB2597_05850 [Oceanicola batsensis HTCC2597]
          Length = 127

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDR 89
           A   G+DK+ G      V    +   G L I    C       A    AF++I+E    +
Sbjct: 35  AVLRGLDKMNGETRDVSVPSGTAVMVGKLSITMWECRYPAGNPAGDAYAFMTITE--PAK 92

Query: 90  IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
               IFSGWM A SPA+NA+DH  YD+W++ C
Sbjct: 93  SSDPIFSGWMVASSPALNALDHFRYDVWVLSC 124


>gi|304321753|ref|YP_003855396.1| hypothetical protein PB2503_11034 [Parvularcula bermudensis
           HTCC2503]
 gi|303300655|gb|ADM10254.1| hypothetical protein PB2503_11034 [Parvularcula bermudensis
           HTCC2503]
          Length = 259

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 58/142 (40%), Gaps = 54/142 (38%)

Query: 35  MDKITGRVLTFDVEINQSAQFGSLIIKPMVC-----------------YS---------- 67
           +DKIT       + + ++A FG L + P  C                 Y+          
Sbjct: 112 LDKITATFTDITIPLGETAAFGPLTLLPRTCDRRPPEEPPETTVFLEVYAGDGDVQGQRA 171

Query: 68  ---RDDREAQRIDAFVSISE------------------------IFTDRIVRSIFSGWMF 100
              R +REA +++A  S  +                        I T+ +   +F GWMF
Sbjct: 172 RDARAEREAMQVEAPRSTLQLPGTQMSSGAEADTPPSALAQENVIDTEALGEDVFKGWMF 231

Query: 101 ADSPAMNAIDHSIYDIWLMQCK 122
           A SP++NA++H +YD+W++ CK
Sbjct: 232 ASSPSLNAMEHPVYDVWVIDCK 253


>gi|89055209|ref|YP_510660.1| hypothetical protein Jann_2718 [Jannaschia sp. CCS1]
 gi|88864758|gb|ABD55635.1| hypothetical protein Jann_2718 [Jannaschia sp. CCS1]
          Length = 184

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 50/88 (56%), Gaps = 6/88 (6%)

Query: 35  MDKITGRVLTFDVEINQSAQFGSLIIKPMVC-YSRDDREAQRIDAFVSISEIFTDRIVRS 93
           +DK+ G+    ++ + Q+  FG + I+ + C Y   D      DAF  +  +  +    +
Sbjct: 100 LDKMLGQPTDIELSMGQTVVFGRVAIRVIECRYPAADPGG---DAFALLEVLNMEG--ET 154

Query: 94  IFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           +F GWM A SPA+NA++HS YD+W++ C
Sbjct: 155 LFDGWMIASSPALNALEHSRYDVWVLGC 182


>gi|315499994|ref|YP_004088797.1| hypothetical protein Astex_3010 [Asticcacaulis excentricus CB 48]
 gi|315418006|gb|ADU14646.1| Protein of unknown function DUF2155 [Asticcacaulis excentricus CB
           48]
          Length = 272

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 21/98 (21%), Positives = 48/98 (48%), Gaps = 7/98 (7%)

Query: 35  MDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQR-----IDAFVSISEIFTDR 89
           +DK+TG  + F+  + +  ++  ++     C +    EA       ++   S        
Sbjct: 167 LDKVTGEAIRFEAPVGKPKRYRGMVYTVKACETSAQDEAMSDTMTYLEVRTSPQPAANGT 226

Query: 90  IVRS--IFSGWMFADSPAMNAIDHSIYDIWLMQCKDPI 125
           + +   +F GW +A +P +N ++H +YD+W++ C+ P+
Sbjct: 227 VPKPKDVFKGWTYASTPGVNGMEHPVYDVWVVSCRTPL 264


>gi|110680058|ref|YP_683065.1| hypothetical protein RD1_2853 [Roseobacter denitrificans OCh 114]
 gi|109456174|gb|ABG32379.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 119

 Score = 58.2 bits (139), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 50/93 (53%), Gaps = 5/93 (5%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVC-YSRDDREAQRIDAFVSISEIFTD 88
           A+  G+D+I G      V   Q+A+   + I+   C Y   +      DAF S+ E+   
Sbjct: 28  AQLRGVDRINGETFEIIVPKGQTAKLDRISIRLNACRYPVGNPSG---DAFASL-EVRDI 83

Query: 89  RIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
                IFSGWM A SPA++A+DH  YDIW+M+C
Sbjct: 84  DSGAFIFSGWMIASSPALSAMDHPRYDIWVMRC 116


>gi|254486361|ref|ZP_05099566.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214043230|gb|EEB83868.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 117

 Score = 58.2 bits (139), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 59/118 (50%), Gaps = 10/118 (8%)

Query: 7   LLILFFVFS---HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           LLIL  V S   HA+ A SA           +DK++G      +   Q+A  G+L +   
Sbjct: 4   LLILLAVLSSPLHAEEATSA----PGGVLRALDKVSGAAQDIVMFRGQTAHVGNLDVLMT 59

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
            C       A   DA+V + EI T      +FSGWM A SPA++A++H  YDIW ++C
Sbjct: 60  DCRFPKGNPAG--DAYVEL-EIKTTGRDDKLFSGWMIASSPALSALEHPRYDIWAIRC 114


>gi|254464893|ref|ZP_05078304.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206685801|gb|EDZ46283.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 125

 Score = 58.2 bits (139), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 53/108 (49%), Gaps = 3/108 (2%)

Query: 14  FSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREA 73
           +   + A S+      A    +DK+ G  +  ++ +  SA+   L++    C    +   
Sbjct: 18  WGQEQVAQSSAAQGTAAVLRALDKVNGHSMDAEIAVGSSAEMFGLLVTVSDCRYPAENPT 77

Query: 74  QRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
               AF+++     D  V+  F GWM A SPA+N +DHS YD+W+++C
Sbjct: 78  GDAYAFLTVRNP-GDSAVQ--FEGWMIASSPALNPLDHSRYDVWVIRC 122


>gi|302383315|ref|YP_003819138.1| hypothetical protein Bresu_2205 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302193943|gb|ADL01515.1| Protein of unknown function DUF2155 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 228

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 8/108 (7%)

Query: 22  SARFANKVAEFAGMDKITGRVLTFDVEIN-QSAQFGS-LIIKPMVCYSRDDREAQRIDAF 79
           + R   +VA    +DKIT   + F+VE+     +F + LI     C    D E    DA 
Sbjct: 121 TPRQRRRVAIVEAIDKITAESMRFEVEVGGPPVRFNNNLIFTARACEVSADNELVN-DAI 179

Query: 80  VSISEIFTDRIV-----RSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
             +      R       R IF GWMF+ +PA++ + H IYD W++ CK
Sbjct: 180 AYLDITLQPRATPAAAPRQIFRGWMFSSTPAISGLQHPIYDAWIVGCK 227


>gi|296282309|ref|ZP_06860307.1| hypothetical protein CbatJ_01745 [Citromicrobium bathyomarinum
           JL354]
          Length = 173

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 52/103 (50%), Gaps = 6/103 (5%)

Query: 25  FANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE-AQRIDAFVSI- 82
            A +VA    ++K       F+++  ++ + G ++I+   C      E  Q   AFV + 
Sbjct: 61  MAERVATIGLLNKRNNVSRDFEMKPGEATRVGDVVIRLRACEKTAPWELPQDEGAFVQVF 120

Query: 83  ----SEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
                   T+R    +FSGW+F +SP++N ++H IYD+W+  C
Sbjct: 121 VRERRGAETERSWNKVFSGWLFRNSPSLNVVEHPIYDVWVKSC 163


>gi|260752613|ref|YP_003225506.1| hypothetical protein Za10_0371 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258551976|gb|ACV74922.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 216

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 1/98 (1%)

Query: 25  FANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRI-DAFVSIS 83
            + +VA    ++K TG      +   +   F  LIIK   C      EA+ +  AFV + 
Sbjct: 82  MSQRVAVLGVLNKKTGEWQDITLHTGEITHFPDLIIKLQACDETMPWEAEHLTGAFVQVE 141

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
            +  +   + IFSGW++ ++P++N ++   YDIW   C
Sbjct: 142 SLKYNHRWQRIFSGWLYKEAPSLNVLESPDYDIWPKSC 179


>gi|241761853|ref|ZP_04759939.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241373767|gb|EER63327.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 214

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 1/98 (1%)

Query: 25  FANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRI-DAFVSIS 83
            + +VA    ++K TG      +   +   F  LIIK   C      EA+ +  AFV + 
Sbjct: 80  MSQRVAVLGVLNKKTGEWQDITLHTGEITHFPDLIIKLQACDETMPWEAEHLTGAFVQVE 139

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
            +  +   + IFSGW++ ++P++N ++   YDIW   C
Sbjct: 140 SLKYNHRWQRIFSGWLYKEAPSLNVLESPDYDIWPKSC 177


>gi|163731530|ref|ZP_02138977.1| hypothetical protein RLO149_19539 [Roseobacter litoralis Och 149]
 gi|161394984|gb|EDQ19306.1| hypothetical protein RLO149_19539 [Roseobacter litoralis Och 149]
          Length = 119

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 51/96 (53%), Gaps = 11/96 (11%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVC-YSRDDREAQRIDAFVSISEIFTD 88
           A+  G+D+I G      V   Q+A+   + I    C Y   +      DAF S++     
Sbjct: 28  AQLRGVDRINGDTFEIIVPRGQTAELERISITLNSCRYPVGNPSG---DAFASLNV---- 80

Query: 89  RIVRS---IFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           R + S   IFSGWM A SPA++A+DH  YDIW+M+C
Sbjct: 81  RDINSGANIFSGWMIASSPALSAMDHPRYDIWVMRC 116


>gi|283856366|ref|YP_003377799.1| hypothetical protein ZMO2007 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|283775365|gb|ADB28965.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 214

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 1/98 (1%)

Query: 25  FANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRI-DAFVSIS 83
            + +VA    ++K TG      +   +   F  LIIK   C      EA+ +  AFV + 
Sbjct: 80  MSQRVAILGVLNKKTGEWQDITLHTGEITHFPDLIIKLQACDETMPWEAEHLTGAFVQVE 139

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
            +  +   + IFSGW++ ++P++N ++   YDIW   C
Sbjct: 140 SLKYNHRWQRIFSGWLYKEAPSLNVLESPDYDIWPKSC 177


>gi|197105316|ref|YP_002130693.1| hypothetical protein PHZ_c1853 [Phenylobacterium zucineum HLK1]
 gi|196478736|gb|ACG78264.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 227

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 9/107 (8%)

Query: 23  ARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVC-YSRDDREAQRIDAFVS 81
           AR+   V     +DK++   L F+  + +  ++  LI     C  S  D   +   A+V+
Sbjct: 107 ARYDTAV--LQALDKVSAETLKFEAPVGRPVRWKGLIFTVRACERSAPDEPVEDAIAYVT 164

Query: 82  I------SEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           I               R  F GWM+A SP +N ++H+ YD W++ C+
Sbjct: 165 IDSQPRPQPGRPTPPPRQAFRGWMYASSPGLNPMEHATYDAWVISCR 211


>gi|254440647|ref|ZP_05054140.1| hypothetical protein OA307_62 [Octadecabacter antarcticus 307]
 gi|198250725|gb|EDY75040.1| hypothetical protein OA307_62 [Octadecabacter antarcticus 307]
          Length = 106

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 35  MDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSI 94
           +DKITGR    +    Q+     + I    C  R     Q  DA+  ++ I  +     +
Sbjct: 20  LDKITGRTQDLEFGNGQTQTVELMAITMTEC--RYPSGNQSGDAYAFLT-ILYNNAADPV 76

Query: 95  FSGWMFADSPAMNAIDHSIYDIWLMQC 121
           F GWM A +PA+NA+DH  YD+W ++C
Sbjct: 77  FRGWMIASAPALNALDHPRYDVWALRC 103


>gi|310816207|ref|YP_003964171.1| hypothetical protein EIO_1753 [Ketogulonicigenium vulgare Y25]
 gi|308754942|gb|ADO42871.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 121

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 45/87 (51%), Gaps = 3/87 (3%)

Query: 35  MDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSI 94
           +DK+ G V   ++   QSA  G L++    C    D      DAF  I+  F   +   +
Sbjct: 35  LDKLNGSVTDLELTNGQSATVGRLVVTLGECRFPTDNPMG--DAFQMITLQFEGNL-EPV 91

Query: 95  FSGWMFADSPAMNAIDHSIYDIWLMQC 121
           F GWM A SPA++A D++ YD+W + C
Sbjct: 92  FMGWMIASSPAVSAFDNARYDVWPLSC 118


>gi|163746707|ref|ZP_02154064.1| hypothetical protein OIHEL45_14929 [Oceanibulbus indolifex HEL-45]
 gi|161379821|gb|EDQ04233.1| hypothetical protein OIHEL45_14929 [Oceanibulbus indolifex HEL-45]
          Length = 146

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 51/88 (57%), Gaps = 5/88 (5%)

Query: 35  MDKITGRVLTFDVEINQSAQFGSLIIKPMVC-YSRDDREAQRIDAFVSISEIFTDRIVRS 93
           +DKI+G  +  ++    +   G+L I  + C Y   D  A   +A+ ++ EI       +
Sbjct: 60  LDKISGDTIDLEITKGDNQSLGNLQITMVDCRYPVGDPAA---NAYAAL-EITESGDSGT 115

Query: 94  IFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           +FSGWM A +PA++A++H  YDIW+++C
Sbjct: 116 LFSGWMIAAAPALHALEHFRYDIWVLRC 143


>gi|85710256|ref|ZP_01041321.1| hypothetical protein NAP1_15263 [Erythrobacter sp. NAP1]
 gi|85688966|gb|EAQ28970.1| hypothetical protein NAP1_15263 [Erythrobacter sp. NAP1]
          Length = 164

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 14/85 (16%)

Query: 46  DVEI--NQSAQFGSLIIKPMVCYSRDDRE-AQRIDAFVSISEIFTDRIVRS------IFS 96
           D+E+   ++A+ G +I++   C      E  Q   AFV +     D + R       IFS
Sbjct: 77  DLELSPGETAEVGPVIVRLEACERTAPYEFPQETGAFVQV-----DVLERGASEHARIFS 131

Query: 97  GWMFADSPAMNAIDHSIYDIWLMQC 121
           GW+F ++P++N ++H IYD+W+  C
Sbjct: 132 GWLFKENPSLNVVEHPIYDVWVKDC 156


>gi|126732550|ref|ZP_01748348.1| hypothetical protein SSE37_10642 [Sagittula stellata E-37]
 gi|126706996|gb|EBA06064.1| hypothetical protein SSE37_10642 [Sagittula stellata E-37]
          Length = 124

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 3/92 (3%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDR 89
           A   G+DK+  +V  F +   ++   G L +    C            AF++I E     
Sbjct: 33  AVLRGLDKLNAKVADFTLSNGENHVMGLLEVVLRECRYPVGDPTGNAYAFLTIRE---AG 89

Query: 90  IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           + + +F GWM A SPA+  +DH  YD+W+++C
Sbjct: 90  VAQPVFEGWMVASSPALYPLDHPRYDVWVLRC 121


>gi|330813928|ref|YP_004358167.1| hypothetical protein SAR11G3_00953 [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487023|gb|AEA81428.1| hypothetical protein SAR11G3_00953 [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 131

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 61/132 (46%), Gaps = 13/132 (9%)

Query: 1   MKYRVLLLILFFVFSHAKFANSARFAN--------KVAEFAGMDKITGRVLTFDVEINQS 52
           M  R+L     F+F    +A      +          A    +DKIT +  T  ++IN+ 
Sbjct: 1   MATRILAYFFLFIFLSPIYALGQGLKDVKILDSNANTANIVILDKITSKKNTHTIQINKK 60

Query: 53  AQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFT---DRIVRSIFSGWMFADSPAMNAI 109
            +F SL +    C   +   + +  AFV I +      D++   I++GWMF+  P++N +
Sbjct: 61  YKFYSLEVLVKRCVLDNSDGSLKTSAFVQIQDPNKKNKDQVY--IYNGWMFSGFPSINPM 118

Query: 110 DHSIYDIWLMQC 121
           +H  YDIW+  C
Sbjct: 119 EHVNYDIWIESC 130


>gi|85375052|ref|YP_459114.1| hypothetical protein ELI_11125 [Erythrobacter litoralis HTCC2594]
 gi|84788135|gb|ABC64317.1| hypothetical protein ELI_11125 [Erythrobacter litoralis HTCC2594]
          Length = 157

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 4/81 (4%)

Query: 45  FDVEINQSAQFGSLIIKPMVCYSRDDRE-AQRIDAFVSI---SEIFTDRIVRSIFSGWMF 100
            ++   +S + G +I++   C      E  Q   AFV +    +   +   R IFSGWMF
Sbjct: 61  LEMSPGESRRIGDIIVRLSACERTAPWEMPQETGAFVQVLVEGKGEDEGEWRKIFSGWMF 120

Query: 101 ADSPAMNAIDHSIYDIWLMQC 121
             SP++N ++H +YD+W+  C
Sbjct: 121 QRSPSLNVVEHPVYDVWVKDC 141


>gi|149179614|ref|ZP_01858130.1| hypothetical protein PM8797T_18696 [Planctomyces maris DSM 8797]
 gi|148841545|gb|EDL55992.1| hypothetical protein PM8797T_18696 [Planctomyces maris DSM 8797]
          Length = 161

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 5/84 (5%)

Query: 43  LTFDVEINQSAQ--FGSLIIKPMVCYSRDDREAQRID-AFVSI--SEIFTDRIVRSIFSG 97
           L+ D+E+    Q   G +II+   C      E ++ + AFV +   E  +    R +FSG
Sbjct: 70  LSQDLELKPGEQRRVGDVIIRLRACERTAPWEMEKDEGAFVQVLVRERGSTSDFRRVFSG 129

Query: 98  WMFADSPAMNAIDHSIYDIWLMQC 121
           W+F + P++N ++H IYD+W+  C
Sbjct: 130 WLFKNKPSINVVEHPIYDVWVKSC 153


>gi|149186415|ref|ZP_01864728.1| hypothetical protein ED21_23038 [Erythrobacter sp. SD-21]
 gi|148830004|gb|EDL48442.1| hypothetical protein ED21_23038 [Erythrobacter sp. SD-21]
          Length = 161

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 5/84 (5%)

Query: 43  LTFDVEINQSAQ--FGSLIIKPMVCYSRDDREAQRID-AFVSI--SEIFTDRIVRSIFSG 97
           L+ D+E+    Q   G +II+   C      E ++ + AFV +   E  +    R +FSG
Sbjct: 70  LSQDLELKPGEQRRVGDVIIRLRACERTAPWEMEKDEGAFVQVLVRERGSTSDFRRVFSG 129

Query: 98  WMFADSPAMNAIDHSIYDIWLMQC 121
           W+F + P++N ++H IYD+W+  C
Sbjct: 130 WLFKNKPSINVVEHPIYDVWVKSC 153


>gi|307295108|ref|ZP_07574950.1| Protein of unknown function DUF2155 [Sphingobium chlorophenolicum
           L-1]
 gi|306879582|gb|EFN10800.1| Protein of unknown function DUF2155 [Sphingobium chlorophenolicum
           L-1]
          Length = 218

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 63/147 (42%), Gaps = 4/147 (2%)

Query: 28  KVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE-AQRIDAFVSISEIF 86
           +VA    ++K  G      ++  ++ + G  I++   C +    E  Q   AFV +    
Sbjct: 59  RVAVIGLLNKRNGITTDLQMKPGEALRVGDAIVRLQACETTAPWENVQETGAFVQLDVRS 118

Query: 87  T-DRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSEYSS 145
           T D   R  FSGW+F + P  N + H IYD+W+  C     ++  ++  +  K   E S+
Sbjct: 119 TADNKWRRNFSGWLFRERPDRNVVQHPIYDVWVRSCTMSWPETGPDTVKLGDKG--EASA 176

Query: 146 TDITSQGSEKSSGSSSNKTLEKESSQP 172
                        +SS +T E  +S P
Sbjct: 177 GGPAQASPASGENASSAQTPEPPASTP 203


>gi|83943116|ref|ZP_00955576.1| hypothetical protein EE36_13083 [Sulfitobacter sp. EE-36]
 gi|83846124|gb|EAP84001.1| hypothetical protein EE36_13083 [Sulfitobacter sp. EE-36]
          Length = 117

 Score = 52.0 bits (123), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 64/120 (53%), Gaps = 9/120 (7%)

Query: 4   RVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEI--NQSAQFGSLIIK 61
           R +L++L  + +  +    A     V     +DK++G  ++ DVE+   ++A+ G+L + 
Sbjct: 2   RKILMMLAIMAAPVQAQQVASAEGGV--LRALDKVSG--VSRDVEMRRGETARVGNLNVT 57

Query: 62  PMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
              C       A   DA+  +  + T    R +F+GWM A +PA++A++H  YDIW+++C
Sbjct: 58  MNECRYPSGNPAG--DAYAELEIVETGDENR-LFAGWMIASAPALSALEHPRYDIWVIRC 114


>gi|87198847|ref|YP_496104.1| hypothetical protein Saro_0825 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134528|gb|ABD25270.1| conserved hypothetical protein [Novosphingobium aromaticivorans DSM
           12444]
          Length = 217

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 8/87 (9%)

Query: 43  LTFDVEI--NQSAQFGSLIIKPMVCYSRDDRE-AQRIDAFVS--ISEIFTDR---IVRSI 94
           +T DV +   +S + G+ I+K   C      E      AFV   + E  T +     R +
Sbjct: 73  ITQDVVLKSGESRRIGNAIVKLATCEKTAPWEDPPETGAFVQLFVEERATTQEKLAWRKV 132

Query: 95  FSGWMFADSPAMNAIDHSIYDIWLMQC 121
           FSGW+F ++P++N ++H +YD+W+  C
Sbjct: 133 FSGWLFRNAPSLNVVEHPVYDVWVKDC 159


>gi|94498773|ref|ZP_01305321.1| hypothetical protein SKA58_14272 [Sphingomonas sp. SKA58]
 gi|94421782|gb|EAT06835.1| hypothetical protein SKA58_14272 [Sphingomonas sp. SKA58]
          Length = 176

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 44/99 (44%), Gaps = 2/99 (2%)

Query: 25  FANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE-AQRIDAFVSIS 83
            A + A    ++K  G      ++  ++ + G  I++   C +    E  Q   AFV + 
Sbjct: 19  MAERSAVLGLLNKRNGLTRDLTLKPGEAVRVGDAIVRLQACETTAPWENIQDTGAFVQLD 78

Query: 84  -EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
                D   R  FSGW+F D P  N + H IYD+W+  C
Sbjct: 79  VRSSADNKWRRAFSGWLFRDRPDRNVVQHPIYDVWVRSC 117


>gi|114771113|ref|ZP_01448553.1| hypothetical protein OM2255_03407 [alpha proteobacterium HTCC2255]
 gi|114548395|gb|EAU51281.1| hypothetical protein OM2255_03407 [alpha proteobacterium HTCC2255]
          Length = 131

 Score = 51.6 bits (122), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 62/122 (50%), Gaps = 13/122 (10%)

Query: 6   LLLILFFVFSHAKFA-NSARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           +L  LF +F+    A  S +  N   A    +D+++G V  F +   +    G++ +   
Sbjct: 3   VLTFLFIIFAQTVLAQGSIKVTNGSGALLRTLDRLSGNVTDFKITNGEEIILGNINVLMK 62

Query: 64  VCYSRDDREAQRID----AFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLM 119
            C       +Q ID    AF+ IS   T+++    F GWM + SPA++A++H  YD+W++
Sbjct: 63  EC----RYPSQSIDSNAFAFLVISGQETEKL---FFEGWMISSSPALSALEHPRYDVWVL 115

Query: 120 QC 121
           +C
Sbjct: 116 KC 117


>gi|83954273|ref|ZP_00962993.1| hypothetical protein NAS141_18244 [Sulfitobacter sp. NAS-14.1]
 gi|83841310|gb|EAP80480.1| hypothetical protein NAS141_18244 [Sulfitobacter sp. NAS-14.1]
          Length = 141

 Score = 51.2 bits (121), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 52/89 (58%), Gaps = 7/89 (7%)

Query: 35  MDKITGRVLTFDVEI--NQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVR 92
           +DK++G  ++ DVE+   ++A+ G+L +    C       A   DA+  + EI       
Sbjct: 55  LDKVSG--VSRDVEMRRGETARVGNLNVTMNECRYPSGNPAG--DAYAEL-EIVETGDEN 109

Query: 93  SIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
            +F+GWM A +PA++A++H  YDIW+++C
Sbjct: 110 RLFAGWMIASAPALSALEHPRYDIWVIRC 138


>gi|254418951|ref|ZP_05032675.1| hypothetical protein BBAL3_1261 [Brevundimonas sp. BAL3]
 gi|196185128|gb|EDX80104.1| hypothetical protein BBAL3_1261 [Brevundimonas sp. BAL3]
          Length = 221

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 52/109 (47%), Gaps = 11/109 (10%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEIN-QSAQFG-SLIIKPMVC-YSRDDREAQRIDAFV 80
           R   K A    +DK T   + F+VE+  +  +F  +LI     C  S  D   +   A+V
Sbjct: 115 RQRRKFAVIQAIDKTTAETMKFEVEVGGRPVRFNRNLIFSVRACEVSTPDELTEDAIAYV 174

Query: 81  SISEIFTDRIV------RSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
            +S     R        R I+ GWMFA SPA++ + +  YD W++ CK+
Sbjct: 175 DVS--LQSRGANQPAEPRQIYRGWMFASSPAVSGLQNPNYDAWVVGCKN 221


>gi|239947487|ref|ZP_04699240.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921763|gb|EER21787.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 157

 Score = 48.5 bits (114), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 1/102 (0%)

Query: 21  NSARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           NS+ F N    +   ++KIT      D ++ +   FG++ IK   C    D   +     
Sbjct: 55  NSSEFKNYTNGKIIALNKITATSEEIDFKVGEEKYFGNIKIKLHKCIKNLDPYNEDNYLL 114

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           ++I+E   D     +F GWM + S +++  +H IY+I+   C
Sbjct: 115 MTITEYKIDEDPNLLFQGWMISSSISLSTFEHPIYEIFAKDC 156


>gi|51473553|ref|YP_067310.1| hypothetical protein RT0348 [Rickettsia typhi str. Wilmington]
 gi|51459865|gb|AAU03828.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 155

 Score = 48.1 bits (113), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 48/101 (47%), Gaps = 1/101 (0%)

Query: 22  SARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
           +A F N    +   ++KIT      D++  +   FG++ IK   C    D   Q     +
Sbjct: 54  NAEFKNYTNGKIIALNKITATSEEIDLKTGEEKYFGNIKIKLHKCIKNLDPYNQDNYLLM 113

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           +I+E   D     +F GWM + S +++  +HSIY+I+   C
Sbjct: 114 TITEYKIDEDPSLLFQGWMVSSSISLSTFEHSIYEIFAKDC 154


>gi|258541331|ref|YP_003186764.1| hypothetical protein APA01_02320 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632409|dbj|BAH98384.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256635466|dbj|BAI01435.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256638521|dbj|BAI04483.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256641575|dbj|BAI07530.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256644630|dbj|BAI10578.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256647685|dbj|BAI13626.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256650738|dbj|BAI16672.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653729|dbj|BAI19656.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 195

 Score = 47.8 bits (112), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 42/88 (47%), Gaps = 3/88 (3%)

Query: 35  MDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSI 94
           +DK+   V    V +  +A + SL I P  C  R    +    A++++ +   +    + 
Sbjct: 51  LDKLDAHVEVLSVPVGTTAHYKSLDITPSRCLQRPPTLSPDAAAWLALQDKHPNG---AT 107

Query: 95  FSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           F GWM A  P +   +  +YD+ +++C+
Sbjct: 108 FQGWMLAAEPTLGVFESPVYDVRMVRCE 135


>gi|329114933|ref|ZP_08243689.1| Hypothetical protein APO_1737 [Acetobacter pomorum DM001]
 gi|326695830|gb|EGE47515.1| Hypothetical protein APO_1737 [Acetobacter pomorum DM001]
          Length = 195

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 43/88 (48%), Gaps = 3/88 (3%)

Query: 35  MDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSI 94
           +D++   V    V +  +A + SL I P  C  R    +    A++++ +   +    + 
Sbjct: 51  LDRLDAHVEVISVPVGTTAHYKSLDITPSRCLQRPPTLSPDAAAWLAVQDKHPNG---AA 107

Query: 95  FSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           F GWM A  PA+   +  +YD+ +++C+
Sbjct: 108 FQGWMLAAEPALGVFESPVYDVRMVRCE 135


>gi|91205215|ref|YP_537570.1| hypothetical protein RBE_0400 [Rickettsia bellii RML369-C]
 gi|157827446|ref|YP_001496510.1| hypothetical protein A1I_05755 [Rickettsia bellii OSU 85-389]
 gi|91068759|gb|ABE04481.1| unknown [Rickettsia bellii RML369-C]
 gi|157802750|gb|ABV79473.1| hypothetical protein A1I_05755 [Rickettsia bellii OSU 85-389]
          Length = 158

 Score = 46.2 bits (108), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 51/108 (47%), Gaps = 1/108 (0%)

Query: 15  SHAKFANSARFAN-KVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREA 73
           S+   ++S  F N    E   ++K T +      ++ +   FG++ IK   C    D   
Sbjct: 50  SNQAISDSTEFKNCDNCEITALNKTTAKSEKLTFKVGEEQYFGNIKIKIHKCVKNLDPYN 109

Query: 74  QRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           +     ++I+E   D   + +F GWM + S +++  +H IY+I+  +C
Sbjct: 110 EDNYILMTITEYIIDEDPKLLFQGWMTSGSISLSTFEHPIYEIFAKEC 157


>gi|15604227|ref|NP_220743.1| hypothetical protein RP359 [Rickettsia prowazekii str. Madrid E]
 gi|6647974|sp|Q9ZDG9|Y359_RICPR RecName: Full=Uncharacterized protein RP359
 gi|3860919|emb|CAA14819.1| unknown [Rickettsia prowazekii]
 gi|292571968|gb|ADE29883.1| hypothetical protein rpr22_CDS352 [Rickettsia prowazekii Rp22]
          Length = 155

 Score = 45.1 bits (105), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 1/101 (0%)

Query: 22  SARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
           SA F N    +   ++KIT       ++  +   FG++ IK   C    D   Q     +
Sbjct: 54  SAEFKNYTNGKIIALNKITATSEEIGLKAGEEKYFGNIKIKLHKCIKNLDPYNQDNYLLM 113

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           +I+E   D     +F GWM + S +++  +H IY+I+   C
Sbjct: 114 TITEYKIDEDPTLLFQGWMVSSSISLSTFEHPIYEIFAKDC 154


>gi|15892410|ref|NP_360124.1| hypothetical protein RC0487 [Rickettsia conorii str. Malish 7]
 gi|15619561|gb|AAL03025.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 157

 Score = 44.7 bits (104), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 47/102 (46%), Gaps = 1/102 (0%)

Query: 21  NSARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           +S+ F N    +   ++ IT      D ++ +   FG++ IK   C    D   +     
Sbjct: 55  DSSEFKNYTNGKIIALNNITATSEEIDFKVGEEKYFGNIKIKLHKCIKNLDPYNEDNYLL 114

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           ++I+E   D     +F GWM + S +++  +H IY+I+   C
Sbjct: 115 MTITEYKIDEDPNVLFQGWMISSSISLSTFEHPIYEIFAKDC 156


>gi|296114615|ref|ZP_06833268.1| hypothetical protein GXY_02521 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978971|gb|EFG85696.1| hypothetical protein GXY_02521 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 247

 Score = 44.7 bits (104), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/142 (19%), Positives = 56/142 (39%), Gaps = 8/142 (5%)

Query: 35  MDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSI 94
           +DK+   V   ++   Q A + SL +    C  R         A++++ +        + 
Sbjct: 55  LDKLDAHVQILNIPAGQDATYKSLTLHARACLERPPTLPADTAAWLAVRDAHEGM---TP 111

Query: 95  FSGWMFADSPAMNAIDHSIYDIWLMQCKD----PINDSISNSESISKKA-LSEYSSTDIT 149
           F GWM    PA+    + +YD+ ++ C      PI   ++  +  +  A +    ST   
Sbjct: 112 FDGWMLTQEPALGLFQNPLYDVQVVGCAGADVAPIPPPLAVVQQQATPADVPAAPSTAAL 171

Query: 150 SQGSEKSSGSSSNKTLEKESSQ 171
              +    G++S  T +  + Q
Sbjct: 172 GTAAMTPDGAASPATPQTATPQ 193


>gi|157825620|ref|YP_001493340.1| hypothetical protein A1C_02685 [Rickettsia akari str. Hartford]
 gi|157799578|gb|ABV74832.1| hypothetical protein A1C_02685 [Rickettsia akari str. Hartford]
          Length = 160

 Score = 44.3 bits (103), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 49/102 (48%), Gaps = 1/102 (0%)

Query: 21  NSARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           +S+ F N    +   ++KIT      + ++ +   FG++ IK   C    D   +     
Sbjct: 55  DSSEFKNYTNGKIIALNKITATSEEINFKVGEEKYFGNIKIKLHKCIKNLDPYNEDNYLL 114

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           ++I+E   D     +F GWM + S +++  +H IY+I++  C
Sbjct: 115 MTITEYTIDEDPNLLFQGWMTSSSISLSTFEHPIYEIFVKDC 156


>gi|34580588|ref|ZP_00142068.1| hypothetical protein [Rickettsia sibirica 246]
 gi|157828361|ref|YP_001494603.1| hypothetical protein A1G_02765 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933069|ref|YP_001649858.1| hypothetical protein RrIowa_0581 [Rickettsia rickettsii str. Iowa]
 gi|28261973|gb|EAA25477.1| unknown [Rickettsia sibirica 246]
 gi|157800842|gb|ABV76095.1| hypothetical protein A1G_02765 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908156|gb|ABY72452.1| hypothetical protein RrIowa_0581 [Rickettsia rickettsii str. Iowa]
          Length = 157

 Score = 44.3 bits (103), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 47/102 (46%), Gaps = 1/102 (0%)

Query: 21  NSARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           +S+ F N    +   ++ IT      D ++ +   FG++ IK   C    D   +     
Sbjct: 55  DSSEFKNYTNGKIIALNNITATSEEIDFKVGEEKYFGNIKIKLHKCIKNLDPYNEDNYLL 114

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           ++I+E   D     +F GWM + S +++  +H IY+I+   C
Sbjct: 115 MTITEYKIDEDPNLLFQGWMISSSISLSTFEHPIYEIFAKDC 156


>gi|238651032|ref|YP_002916889.1| hypothetical protein RPR_06840 [Rickettsia peacockii str. Rustic]
 gi|238625130|gb|ACR47836.1| hypothetical protein RPR_06840 [Rickettsia peacockii str. Rustic]
          Length = 157

 Score = 44.3 bits (103), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 47/102 (46%), Gaps = 1/102 (0%)

Query: 21  NSARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           +S+ F N    +   ++ IT      D ++ +   FG++ IK   C    D   +     
Sbjct: 55  DSSEFKNYTNGKIIALNNITATSEEIDFKVGEEKYFGNIKIKLHKCIKNLDPYNEDNYLL 114

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           ++I+E   D     +F GWM + S +++  +H IY+I+   C
Sbjct: 115 MTITEYKIDEDPNLLFQGWMISSSISLSTFEHPIYEIFAKDC 156


>gi|157803899|ref|YP_001492448.1| hypothetical protein A1E_03660 [Rickettsia canadensis str. McKiel]
 gi|157785162|gb|ABV73663.1| hypothetical protein A1E_03660 [Rickettsia canadensis str. McKiel]
          Length = 157

 Score = 43.9 bits (102), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 1/102 (0%)

Query: 21  NSARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           NS+ F N    +   ++KIT      +  + +   FG++ IK   C    D   +     
Sbjct: 55  NSSEFKNYANGKIIVLNKITATSKEMNFTVGEEQYFGNIKIKLHKCIKNLDPYNEDNYLL 114

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           ++I+E   D     +F GWM + S +++  +H IY+I+   C
Sbjct: 115 MTITEYKIDEDPNLLFQGWMTSSSISLSTFEHPIYEIFAKDC 156


>gi|67458961|ref|YP_246585.1| hypothetical protein RF_0569 [Rickettsia felis URRWXCal2]
 gi|67004494|gb|AAY61420.1| unknown [Rickettsia felis URRWXCal2]
          Length = 157

 Score = 42.7 bits (99), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 42/88 (47%)

Query: 34  GMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRS 93
            ++KIT      + ++ +   FG++ IK   C    D   +     ++I+E   D     
Sbjct: 69  ALNKITATSEEINFKVGEEKYFGNIKIKLHKCIKNLDPYNEDNYLLMTITEYKIDEDPNL 128

Query: 94  IFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           +F GWM + S +++  +H IY+I+   C
Sbjct: 129 LFQGWMISSSISLSTFEHPIYEIFAKDC 156


>gi|218680000|ref|ZP_03527897.1| hypothetical protein RetlC8_14346 [Rhizobium etli CIAT 894]
          Length = 40

 Score = 42.0 bits (97), Expect = 0.047,   Method: Composition-based stats.
 Identities = 15/24 (62%), Positives = 19/24 (79%)

Query: 99  MFADSPAMNAIDHSIYDIWLMQCK 122
           MFA SP +NA++H IYD+WL  CK
Sbjct: 1   MFAASPGLNAVEHPIYDVWLKDCK 24


>gi|229586626|ref|YP_002845127.1| hypothetical protein RAF_ORF0454 [Rickettsia africae ESF-5]
 gi|228021676|gb|ACP53384.1| Unknown [Rickettsia africae ESF-5]
          Length = 157

 Score = 42.0 bits (97), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 47/102 (46%), Gaps = 1/102 (0%)

Query: 21  NSARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           +S+ F N    +   ++ IT      D+++ +   F ++ IK   C    D   +     
Sbjct: 55  DSSEFKNYTNGKIIALNNITATSEEIDLKVGEEKYFCNIKIKLHKCIKNLDPYNEDNYLL 114

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           ++I+E   D     +F GWM + S +++  +H IY+I+   C
Sbjct: 115 MTITEYKIDEDPNLLFQGWMISSSISLSTFEHPIYEIFAKDC 156


>gi|262277373|ref|ZP_06055166.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
 gi|262224476|gb|EEY74935.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
          Length = 127

 Score = 41.6 bits (96), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 43/98 (43%), Gaps = 5/98 (5%)

Query: 27  NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEI- 85
           N  AE   +DKIT R+ T  + +          I    C     +      A V I ++ 
Sbjct: 31  NNYAEIKIIDKITSRLSTKKINLKTLKNIKDFEIFIDKCVLDTRKGFLETSALVQIKDVK 90

Query: 86  --FTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
               DR+   +F+ WMFA + ++N I+H  YDI L  C
Sbjct: 91  NQTKDRVF--LFNNWMFASNSSINEIEHPNYDISLKSC 126


>gi|58039577|ref|YP_191541.1| hypothetical protein GOX1117 [Gluconobacter oxydans 621H]
 gi|58001991|gb|AAW60885.1| Hypothetical protein GOX1117 [Gluconobacter oxydans 621H]
          Length = 229

 Score = 40.8 bits (94), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 78/224 (34%), Gaps = 30/224 (13%)

Query: 4   RVLL-----LILFFVFSHAKFANSARFAN--KVAEFAGMDKITGRVL--------TFDVE 48
           RVLL     +IL    S A+ A           A + G  +   RVL           + 
Sbjct: 8   RVLLCGTAGMILLAGISGARAATGVAPPAMYPAATWQGQSQAVVRVLDRLDAHLELLTIP 67

Query: 49  INQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNA 108
           +  SA +  L +    C SR    A    A + + +    +  R  F GWM A  P++  
Sbjct: 68  VGGSATYHGLSVGVEACVSRPQTLAADAGALLHLKDSSDPQ--RPPFDGWMLAQEPSVAT 125

Query: 109 IDHSIYDIWLMQCKDPINDSISNSESISKKALSEYSSTDITSQG----SEKSSGSSSNKT 164
               +YD+ ++ C        +    + K  +   +   +   G    S+  S S     
Sbjct: 126 YGSPLYDVRVVSCAGAPTAPQAGPLPVVKAPVLASAEVPVEEGGDAPASQPGSASGGPVP 185

Query: 165 LEKESSQPLE--------NNLSMDLKGRPI-QELGNNLSDSGLN 199
           L  +S  P+          +L+  +  +P  Q L    +D GL 
Sbjct: 186 LAPDSHNPIPLAPPSGAAPSLAPAMPAQPSGQPLSPPEADPGLE 229


>gi|157964439|ref|YP_001499263.1| hypothetical protein RMA_0506 [Rickettsia massiliae MTU5]
 gi|157844215|gb|ABV84716.1| hypothetical protein RMA_0506 [Rickettsia massiliae MTU5]
          Length = 162

 Score = 37.7 bits (86), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 1/102 (0%)

Query: 21  NSARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           +SA F N    +   ++ IT      D ++ +   FG++ IK   C    D   +     
Sbjct: 60  DSAEFKNYTNGKIIALNNITATSEEIDFKVGEEKYFGNIKIKLHRCIKNLDPYNEDNYLL 119

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           ++I+E   D     +F GWM + S +++  +H IY+I+   C
Sbjct: 120 MTITEYKIDEDPNLLFQGWMISSSISLSMFEHPIYEIFAKDC 161


>gi|116695836|ref|YP_841412.1| LysR family transcriptional regulator [Ralstonia eutropha H16]
 gi|113530335|emb|CAJ96682.1| transcriptional regulator, LysR-family [Ralstonia eutropha H16]
          Length = 334

 Score = 37.0 bits (84), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 2/78 (2%)

Query: 47  VEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAM 106
           + +      GS ++ P+V   R+  +  RI   V +S++FTD +   I  G+    SP  
Sbjct: 119 IRLTAPPSLGSRVLVPLVRGFRE--QYPRITFDVVLSDLFTDLVEAKIDVGFRVGTSPGQ 176

Query: 107 NAIDHSIYDIWLMQCKDP 124
           N +   + D+ L+ C  P
Sbjct: 177 NLVARRLCDLPLVICAAP 194


>gi|290883006|dbj|BAI82197.1| major piroplasm surface protein [Theileria orientalis]
          Length = 237

 Score = 35.8 bits (81), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 10/120 (8%)

Query: 17  AKFANSARFA------NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDD 70
           +KFA +  FA       KV +F G  K+T +V   D E+  S +     +K  V    DD
Sbjct: 117 SKFAEAGLFAPDAFGTGKVYDFVGNFKVT-KVKFEDKEVGDSKKAKYTAVK--VYVGTDD 173

Query: 71  REAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           ++  R+D F +  E F +   + I   W   +    N   H++ + W +  K P+ D  S
Sbjct: 174 KKIVRLDYFYTGDERFKEVYFKLIDGKWKTLEQSEANKDLHAMNNAWPLDYK-PLVDKFS 232


>gi|219964729|gb|ACL68412.1| piroplasm surface antigen [Theileria sergenti]
          Length = 283

 Score = 35.8 bits (81), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 10/120 (8%)

Query: 17  AKFANSARFA------NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDD 70
           +KFA +  FA       KV +F G  K+T +V   D E+  S +     +K  V    DD
Sbjct: 149 SKFAEAGLFAPDAFGTGKVYDFVGNFKVT-KVKFEDKEVGDSKKAKYTAVKVYV--GTDD 205

Query: 71  REAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           ++  R+D F +  E F +   + +   W   +    N   H++ D W +  K P+ D  S
Sbjct: 206 KKIVRLDYFYTGDERFKEVYFKLVDGKWKKLEQSEANKDLHAMNDAWPLDYK-PLVDKFS 264


>gi|290883012|dbj|BAI82200.1| major piroplasm surface protein [Theileria orientalis]
          Length = 237

 Score = 35.8 bits (81), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 10/120 (8%)

Query: 17  AKFANSARFA------NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDD 70
           +KFA +  FA       KV +F G  K+T +V   D E+  S +     +K  V    DD
Sbjct: 117 SKFAEAGLFAPDAFGTGKVYDFVGNFKVT-KVKFEDKEVGDSKKAKYTAVK--VYVGTDD 173

Query: 71  REAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           ++  R+D F +  E F +   + I   W   +    N   H++ + W +  K P+ D  S
Sbjct: 174 KKIVRLDYFYTGDERFKEVYFKLIDGKWKKLEQSEANKDLHAMNNAWPLDYK-PLVDKFS 232


>gi|290883008|dbj|BAI82198.1| major piroplasm surface protein [Theileria orientalis]
 gi|290883010|dbj|BAI82199.1| major piroplasm surface protein [Theileria orientalis]
          Length = 238

 Score = 35.4 bits (80), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 10/120 (8%)

Query: 17  AKFANSARFA------NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDD 70
           +KFA +  FA       KV +F G  K+T +V   D E+  S +     +K  V    DD
Sbjct: 117 SKFAEAGLFAPDAFGTGKVYDFVGNFKVT-KVKFEDKEVGDSKKAKYTAVK--VYVGTDD 173

Query: 71  REAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           ++  R+D F +  E F +   + I   W   +    N   H++ + W +  K P+ D  S
Sbjct: 174 KKIVRLDYFYTGDERFKEVYFKLIDGKWKKLEQSEANKDLHAMNNAWPLDYK-PLVDKFS 232


>gi|312386687|dbj|BAJ34663.1| major piroplasm surface protein [Theileria orientalis]
          Length = 259

 Score = 35.0 bits (79), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 10/120 (8%)

Query: 17  AKFANSARFA------NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDD 70
           +KFA +  FA       KV +F G  K+T +V   D E+  S +     +K  V    DD
Sbjct: 140 SKFAEAGLFAPDAFGTGKVYDFVGNFKVT-KVKFEDKEVGDSKKAKYTAVKVYV--GTDD 196

Query: 71  REAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           ++  R+D F +  E F +   + I   W   +    N   H++ + W +  K P+ D  S
Sbjct: 197 KKIVRLDYFYTGDERFKEVYFKLIDGKWKKLEQSEANKDLHAMNNAWPLDYK-PLVDKFS 255


>gi|2077952|dbj|BAA19876.1| major piroplasm surface protein [Theileria buffeli]
          Length = 268

 Score = 35.0 bits (79), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 10/120 (8%)

Query: 17  AKFANSARFA------NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDD 70
           +KFA +  FA       KV +F G  K+T +V   D E+  S +     +K  V    DD
Sbjct: 134 SKFAEAGLFAPDAFGTGKVYDFVGNFKVT-KVKFEDKEVGDSKKAKYTAVKVYV--GTDD 190

Query: 71  REAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           ++  R+D F +  E F +   + I   W   +    N   H++ + W +  K P+ D  S
Sbjct: 191 KKIVRVDYFYTGDERFKEVYFKLIDGKWKKLEQSEANKDLHAMNNAWPLDYK-PLVDKFS 249


>gi|312386689|dbj|BAJ34664.1| major piroplasm surface protein [Theileria orientalis]
 gi|312386763|dbj|BAJ34701.1| major piroplasm surface protein [Theileria orientalis]
          Length = 259

 Score = 35.0 bits (79), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 10/120 (8%)

Query: 17  AKFANSARFA------NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDD 70
           +KFA +  FA       KV +F G  K+T +V   D E+  S +     +K  V    DD
Sbjct: 140 SKFAEAGLFAPDAFGTGKVYDFVGNFKVT-KVKFEDKEVGDSKKAKYTAVKVYV--GTDD 196

Query: 71  REAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           ++  R+D F +  E F +   + I   W   +    N   H++ + W +  K P+ D  S
Sbjct: 197 KKIVRLDYFYTGDERFKEVYFKLIDGKWKKLEQSEANKDLHAMNNAWPLDYK-PLVDKFS 255


>gi|312386665|dbj|BAJ34652.1| major piroplasm surface protein [Theileria orientalis]
          Length = 259

 Score = 35.0 bits (79), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 10/120 (8%)

Query: 17  AKFANSARFA------NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDD 70
           +KFA +  FA       KV +F G  K+T +V   D E+  S +     +K  V    DD
Sbjct: 140 SKFAEAGLFAPDAFGTGKVYDFVGNFKVT-KVKFEDKEVGDSKKAKYTAVKVYV--GTDD 196

Query: 71  REAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           ++  R+D F +  E F +   + I   W   +    N   H++ + W +  K P+ D  S
Sbjct: 197 KKIVRLDYFYTGDERFKEVYFKLIDGKWKKLEQSEANKDLHAMNNAWPLDYK-PLVDKFS 255


>gi|229002134|dbj|BAH57859.1| major piroplasm surface protein [Theileria orientalis]
          Length = 259

 Score = 35.0 bits (79), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 10/120 (8%)

Query: 17  AKFANSARFA------NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDD 70
           +KFA +  FA       KV +F G  K+T +V   D E+  S +     +K  V    DD
Sbjct: 140 SKFAEAGLFAPDAFGTGKVYDFVGNFKVT-KVKFEDKEVGDSKKAKYTAVKVYV--GTDD 196

Query: 71  REAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           ++  R+D F +  E F +   + +   W   +    N   H++ + W +  K P+ D  S
Sbjct: 197 KKIVRLDYFYTGDERFKEVYFKLVDGKWKKLEQSEANKDLHAMNNAWPLDYK-PLVDKFS 255


>gi|324021526|dbj|BAJ78417.1| major piroplasm surface protein [Theileria orientalis]
          Length = 259

 Score = 35.0 bits (79), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 53/121 (43%), Gaps = 12/121 (9%)

Query: 17  AKFANSARFA------NKVAEFAGMDKITG-RVLTFDVEINQSAQFGSLIIKPMVCYSRD 69
           +KFA +  FA       KV +F G  KI   R    DV  ++ A++ ++     V    D
Sbjct: 140 SKFAEAGLFAADAFGTGKVYDFVGPFKIQKVRFENLDVGDSKKAKYTAV----KVYVGTD 195

Query: 70  DREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSI 129
           D++  R+D F +  E F +   + +   W   +    N   H+  D W ++ K P+ D  
Sbjct: 196 DKKIVRLDYFYTGDERFKEVYFKLVDGKWKKLEQSEANKDLHATNDAWSLEYK-PLVDKF 254

Query: 130 S 130
           S
Sbjct: 255 S 255


>gi|290883018|dbj|BAI82203.1| major piroplasm surface protein [Theileria orientalis]
 gi|290883020|dbj|BAI82204.1| major piroplasm surface protein [Theileria orientalis]
 gi|290883022|dbj|BAI82205.1| major piroplasm surface protein [Theileria orientalis]
          Length = 238

 Score = 35.0 bits (79), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 10/120 (8%)

Query: 17  AKFANSARFA------NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDD 70
           +KFA +  FA       KV +F G  K+T +V   D E+  S +     +K  V    DD
Sbjct: 117 SKFAEAGLFAPDAFGTGKVYDFVGNFKVT-KVKFEDKEVGDSKKAKYTAVK--VYVGTDD 173

Query: 71  REAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           ++  R+D F +  E F +   + +   W   +    N   H++ + W +  K P+ D  S
Sbjct: 174 KKIVRLDYFYTGDERFKEVYFKLVDGKWKKLEQSEANKDLHAMNNAWPLDYK-PLVDKFS 232


>gi|154420139|ref|XP_001583085.1| hypothetical protein [Trichomonas vaginalis G3]
 gi|121917324|gb|EAY22099.1| hypothetical protein TVAG_457340 [Trichomonas vaginalis G3]
          Length = 3355

 Score = 34.7 bits (78), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 8/95 (8%)

Query: 38   ITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFT-DRIVRSIFS 96
            IT  +  F V + +  +F    +  ++C S      QRID  + IS+I +  RI  +IF 
Sbjct: 3071 ITSILEKFPVNVTEMRRFEGPFVHLLICLS------QRIDFNIPISQIISICRICYTIFE 3124

Query: 97   GWMFADSPAMNAIDHSIYDIWLMQCKDP-INDSIS 130
               F+D    N++ H  Y +      D  I DSI+
Sbjct: 3125 EKSFSDDEYRNSVSHFAYSLLSHYTNDKVIRDSIN 3159


>gi|319412210|dbj|BAJ61812.1| major piroplasm surface protein [Theileria orientalis]
          Length = 259

 Score = 34.7 bits (78), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 10/120 (8%)

Query: 17  AKFANSARFA------NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDD 70
           +KFA +  FA       KV +F G  K+T +V   D E+  S +     +K  V    DD
Sbjct: 140 SKFAEAGLFAPDAFGTGKVYDFVGNFKVT-KVKFEDKEVGDSKKAKYTAVKVYV--GTDD 196

Query: 71  REAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           ++  R+D F +  E F +   + +   W   +    N   H++ + W +  K P+ D  S
Sbjct: 197 KKIVRLDYFYTGDERFKEVYFKLVDGKWKKLEQSEANKDLHAMNNAWPLDYK-PLVDKFS 255


>gi|312386721|dbj|BAJ34680.1| major piroplasm surface protein [Theileria orientalis]
 gi|312386747|dbj|BAJ34693.1| major piroplasm surface protein [Theileria orientalis]
 gi|319412190|dbj|BAJ61802.1| major piroplasm surface protein [Theileria orientalis]
 gi|319412192|dbj|BAJ61803.1| major piroplasm surface protein [Theileria orientalis]
 gi|319412206|dbj|BAJ61810.1| major piroplasm surface protein [Theileria orientalis]
 gi|319412212|dbj|BAJ61813.1| major piroplasm surface protein [Theileria orientalis]
 gi|319412220|dbj|BAJ61817.1| major piroplasm surface protein [Theileria orientalis]
          Length = 259

 Score = 34.7 bits (78), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 10/120 (8%)

Query: 17  AKFANSARFA------NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDD 70
           +KFA +  FA       KV +F G  K+T +V   D E+  S +     +K  V    DD
Sbjct: 140 SKFAEAGLFAPDAFGTGKVYDFVGNFKVT-KVKFEDKEVGDSKKAKYTAVKVYV--GTDD 196

Query: 71  REAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           ++  R+D F +  E F +   + +   W   +    N   H++ + W +  K P+ D  S
Sbjct: 197 KKIVRLDYFYTGDERFKEVYFKLVDGKWKKLEQSEANKDLHAMNNAWPLDYK-PLVDKFS 255


>gi|6970408|dbj|BAA90723.1| major piroplasm surface protein [Theileria sergenti]
          Length = 283

 Score = 34.7 bits (78), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 10/120 (8%)

Query: 17  AKFANSARFA------NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDD 70
           +KFA +  FA       KV +F G  K+T +V   D E+  S +     +K  V    DD
Sbjct: 149 SKFAEAGLFAPDAFGTGKVYDFVGNFKVT-KVKFEDKEVGDSKKAKYTAVKVYV--GTDD 205

Query: 71  REAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           ++  R+D F +  E F +   + I   W   +    N   H++ + W +  K P+ D  S
Sbjct: 206 KKIVRLDYFYTGDERFKEVYFKLIDGKWKKLEQSEANKDLHAMNNAWPLDYK-PLVDKFS 264


>gi|328772551|gb|EGF82589.1| hypothetical protein BATDEDRAFT_4191 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 366

 Score = 34.7 bits (78), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 47/102 (46%), Gaps = 7/102 (6%)

Query: 85  IFTD--RIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPI--NDSISNSESISKKAL 140
           +F D  +  R  F G MF D     +I     D+  M  KDP   ND  ++S S +  + 
Sbjct: 80  VFVDPEQFFRQQFGGDMFVDIIGEISIARDFKDV--MAAKDPSKSNDLTTDSNSSTINSE 137

Query: 141 SEYSSTDITSQGSEKSSGSSSNKTL-EKESSQPLENNLSMDL 181
           +E  STD T+Q  + S+     + L  KE  Q L +NL   L
Sbjct: 138 TEVPSTDATTQAKQDSALMYKQRRLIRKERIQKLSHNLVAKL 179


Searching..................................................done


Results from round 2




>gi|254780542|ref|YP_003064955.1| hypothetical protein CLIBASIA_02145 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040219|gb|ACT57015.1| hypothetical protein CLIBASIA_02145 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 210

 Score =  321 bits (824), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 210/210 (100%), Positives = 210/210 (100%)

Query: 1   MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLII 60
           MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLII
Sbjct: 1   MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLII 60

Query: 61  KPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ 120
           KPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ
Sbjct: 61  KPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ 120

Query: 121 CKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMD 180
           CKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMD
Sbjct: 121 CKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMD 180

Query: 181 LKGRPIQELGNNLSDSGLNEQDHNDVQISK 210
           LKGRPIQELGNNLSDSGLNEQDHNDVQISK
Sbjct: 181 LKGRPIQELGNNLSDSGLNEQDHNDVQISK 210


>gi|188580300|ref|YP_001923745.1| hypothetical protein Mpop_1034 [Methylobacterium populi BJ001]
 gi|179343798|gb|ACB79210.1| conserved hypothetical proteinn [Methylobacterium populi BJ001]
          Length = 219

 Score =  228 bits (580), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 64/187 (34%), Positives = 99/187 (52%), Gaps = 15/187 (8%)

Query: 4   RVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           R   L    +      A++ +  N  A F+G+DKITGR++TF+V I+++ QFG+L + P 
Sbjct: 10  RRTALGTLALALSVLPASADKIKNPTAVFSGLDKITGRIVTFEVAIDETVQFGALQMTPR 69

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
           VCYSR   E  +  AF+ + E+  D   R IF+GWMFA SP ++AI+H IYD+WL  CK 
Sbjct: 70  VCYSRPPTETPKTTAFLEVDEVTLDSKYRRIFTGWMFASSPGLHAIEHPIYDVWLTDCK- 128

Query: 124 PINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDL-- 181
                   ++ I++    E      + Q   K  G+   KT     +  +  N  +D+  
Sbjct: 129 ------GGTDVIAEAKEQEDVPALASRQEKPKKKGADPTKT-----ASQVNQNGQVDVEG 177

Query: 182 -KGRPIQ 187
            +G P+Q
Sbjct: 178 PRGVPVQ 184


>gi|170746752|ref|YP_001753012.1| hypothetical protein Mrad2831_0305 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653274|gb|ACB22329.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 218

 Score =  228 bits (580), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 65/190 (34%), Positives = 101/190 (53%), Gaps = 16/190 (8%)

Query: 1   MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLII 60
           +  R L   L  +   A  A + +  N  A F+G+DKITGR++ F+V ++++ QFG+L +
Sbjct: 7   LARRALAPSLALLVC-AGPAAADKIKNPTAVFSGLDKITGRIVNFEVAVDETVQFGALQL 65

Query: 61  KPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ 120
            P VCY+R   E+ +  AF+ + E+  D   R IF+GWMFA SP ++AI+H IYD+WL+ 
Sbjct: 66  TPRVCYTRPPTESAKTTAFLEVDEVTLDNKYRRIFTGWMFASSPGLHAIEHPIYDVWLVD 125

Query: 121 CKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMD 180
           CK         S+ I++    E            K  G  + KT     +Q L  N  +D
Sbjct: 126 CK-------GGSDVIAEAKEQEDVPAVAAKPEKAKRPGKDATKT-----AQQLNANGQVD 173

Query: 181 L---KGRPIQ 187
           +   +G P+Q
Sbjct: 174 VEAPRGVPVQ 183


>gi|315122870|ref|YP_004063359.1| hypothetical protein CKC_05630 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496272|gb|ADR52871.1| hypothetical protein CKC_05630 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 193

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 109/181 (60%), Positives = 130/181 (71%), Gaps = 3/181 (1%)

Query: 1   MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLII 60
           MK++VL L + F F+ A    SARF NK+AEFAGMDKITGR+L FDV+IN+S QFGSL I
Sbjct: 1   MKHKVLFLAVLFFFNTAGIVKSARFENKIAEFAGMDKITGRILRFDVDINRSVQFGSLKI 60

Query: 61  KPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ 120
            PMVCYSRDD+E QR+D+FVSISEI TD  VRSIFSGWMFADSPAMNAIDHSIYD+WL+Q
Sbjct: 61  TPMVCYSRDDKEIQRVDSFVSISEISTDHTVRSIFSGWMFADSPAMNAIDHSIYDVWLIQ 120

Query: 121 CKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSS---SNKTLEKESSQPLENNL 177
           CK+PI DS  NS   S        + +       K+S  S   S+  L+K  +Q  ENNL
Sbjct: 121 CKNPIKDSDKNSTRYSTPVPKMTVTENPDDNSIPKASSQSIEISDAHLDKNYNQKSENNL 180

Query: 178 S 178
           +
Sbjct: 181 N 181


>gi|170738647|ref|YP_001767302.1| hypothetical protein M446_0297 [Methylobacterium sp. 4-46]
 gi|168192921|gb|ACA14868.1| conserved hypothetical proteinn [Methylobacterium sp. 4-46]
          Length = 210

 Score =  224 bits (572), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 63/188 (33%), Positives = 104/188 (55%), Gaps = 15/188 (7%)

Query: 3   YRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKP 62
              L+L L  V + A  A + +  N  A F+G+DKITGR++TF+V ++++ QFG+L + P
Sbjct: 11  RAALVLSLAGVLAPA--AQADKIRNPTAVFSGLDKITGRIVTFEVSVDETVQFGALQLTP 68

Query: 63  MVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            VCY+R   E+ R  AF+ + E+  +   R IF+GWMFA SP ++AI+H IYD+WL+ CK
Sbjct: 69  RVCYTRPPTESARTTAFLEVDEVTLENKYRRIFTGWMFAASPGLHAIEHPIYDVWLVDCK 128

Query: 123 DPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMD-- 180
                    ++ I++    + +     +    +      N+  E   +QP+     +D  
Sbjct: 129 -------GGTDIIAEAKEQDDA---PVAAAKPERRRRDPNQQQEARRAQPVNRQGQVDVA 178

Query: 181 -LKGRPIQ 187
            L+G P+Q
Sbjct: 179 PLRGTPVQ 186


>gi|163850532|ref|YP_001638575.1| hypothetical protein Mext_1100 [Methylobacterium extorquens PA1]
 gi|218529229|ref|YP_002420045.1| hypothetical protein Mchl_1229 [Methylobacterium chloromethanicum
           CM4]
 gi|240137597|ref|YP_002962068.1| hypothetical protein MexAM1_META1p0870 [Methylobacterium extorquens
           AM1]
 gi|254560069|ref|YP_003067164.1| hypothetical protein METDI1582 [Methylobacterium extorquens DM4]
 gi|163662137|gb|ABY29504.1| conserved hypothetical proteinn [Methylobacterium extorquens PA1]
 gi|218521532|gb|ACK82117.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
 gi|240007565|gb|ACS38791.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens AM1]
 gi|254267347|emb|CAX23179.1| conserved hypothetical protein; putative exported protein
           [Methylobacterium extorquens DM4]
          Length = 219

 Score =  217 bits (552), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 62/168 (36%), Positives = 93/168 (55%), Gaps = 15/168 (8%)

Query: 23  ARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSI 82
            +  N  A F+G+DKITGR++TF+V I+++ QFG+L + P VCYSR   E  +  AF+ +
Sbjct: 29  DKIKNPTAVFSGLDKITGRIVTFEVAIDETVQFGALQMTPRVCYSRPPTETPKTTAFLEV 88

Query: 83  SEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSE 142
            E+  D   R IF+GWMFA SP ++AI+H IYD+WL  CK         S+ I++    E
Sbjct: 89  DEVTLDSKYRRIFTGWMFAASPGLHAIEHPIYDVWLTDCK-------GGSDVIAEAKEQE 141

Query: 143 YSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDL---KGRPIQ 187
                 + Q   +  G+   KT     S  +  N  +D+   +G P+Q
Sbjct: 142 DVPALASRQDKPRKKGADPTKT-----SAQVNQNGQVDVEGPRGVPVQ 184


>gi|220925866|ref|YP_002501168.1| hypothetical protein Mnod_6040 [Methylobacterium nodulans ORS 2060]
 gi|219950473|gb|ACL60865.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060]
          Length = 210

 Score =  216 bits (550), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 55/168 (32%), Positives = 95/168 (56%), Gaps = 13/168 (7%)

Query: 23  ARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSI 82
            +  N  A F+G+DKITGR+++F+V ++++ QFG+L + P VCY+R   E+ +  AF+ +
Sbjct: 29  DKIRNPTAVFSGLDKITGRIVSFEVAVDETVQFGALQLTPRVCYTRPPTESAKTTAFLEV 88

Query: 83  SEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSE 142
            E+  +   R IF+GWMFA SP ++AI+H IYD+WL+ CK         ++ I++    +
Sbjct: 89  DEVTLENKYRRIFTGWMFAASPGLHAIEHPIYDVWLVDCK-------GGTDIIAEAKEQD 141

Query: 143 YSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMD---LKGRPIQ 187
            +     +    +      N+  E   +QP+     +D   L+G P+Q
Sbjct: 142 DA---PVAAAKPERRRRDPNQREEARRAQPVNRQGQVDVTPLRGTPVQ 186


>gi|328543660|ref|YP_004303769.1| Cellulase-like protein [polymorphum gilvum SL003B-26A1]
 gi|326413404|gb|ADZ70467.1| Cellulase-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 183

 Score =  209 bits (533), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 61/155 (39%), Positives = 88/155 (56%), Gaps = 3/155 (1%)

Query: 7   LLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCY 66
           L+ L      A  A++ +  N VA F+G+DKITGR+++FDV I ++ QFG+L + P VCY
Sbjct: 18  LVALAAGIVTAGPAHADKIENPVAVFSGLDKITGRIISFDVYIGETVQFGALQVTPRVCY 77

Query: 67  SRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPIN 126
           SR   E  + DAFV + EI  +  VR IFSGWMFA SP ++A++H++YD+WL  C+    
Sbjct: 78  SRPQTETPQTDAFVQVDEITLNNEVRRIFSGWMFAASPGLHAVEHAVYDVWLTDCRM--T 135

Query: 127 DSISNSESISKKALSEYSSTDITS-QGSEKSSGSS 160
            S+   E  S   ++           G    SG  
Sbjct: 136 SSVPPPEGYSGPPVAASVPEGEDGLAGPGAGSGID 170


>gi|118589092|ref|ZP_01546499.1| hypothetical protein SIAM614_13608 [Stappia aggregata IAM 12614]
 gi|118438421|gb|EAV45055.1| hypothetical protein SIAM614_13608 [Stappia aggregata IAM 12614]
          Length = 193

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 56/172 (32%), Positives = 90/172 (52%), Gaps = 7/172 (4%)

Query: 6   LLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVC 65
           L +      +    A++ +  N VA F+G+DKITGR+++FDV I ++ QFG+L + P VC
Sbjct: 29  LGIAAMAAVTPLVSAHAEKIENPVAVFSGLDKITGRIISFDVYIGETVQFGALQVTPRVC 88

Query: 66  YSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPI 125
           Y+R   E+     FV + EI  +  VR I+SGWMFA SP ++A++H +YDIWL  CK  +
Sbjct: 89  YTRPQTESPLTTGFVQVDEITLNNEVRRIYSGWMFAASPGLHAVEHPVYDIWLTDCK--L 146

Query: 126 NDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNL 177
             ++   E  +   +     T   ++G +  +G            +P     
Sbjct: 147 ASTVPPPEDYAGPPI-----TGTVAEGEDPLAGPDDGLEHGPGIPRPKPFQG 193


>gi|225627393|ref|ZP_03785430.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|237815335|ref|ZP_04594333.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|225617398|gb|EEH14443.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|237790172|gb|EEP64382.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
          Length = 157

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 62/129 (48%), Positives = 86/129 (66%), Gaps = 2/129 (1%)

Query: 4   RVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           ++ L+ +         A + R +N VA+F+G+DKITGR+ TFDV IN++ QFG+L + P 
Sbjct: 27  QIALITVLAGMGSLHAARAERISNPVAQFSGLDKITGRITTFDVYINETVQFGALQVTPK 86

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
           VCYSR + EA R DAFV++ EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK 
Sbjct: 87  VCYSRTEDEAPRTDAFVTVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCKQ 146

Query: 124 PINDSISNS 132
                +   
Sbjct: 147 --KSDVPPP 153


>gi|23501790|ref|NP_697917.1| hypothetical protein BR0904 [Brucella suis 1330]
 gi|62289847|ref|YP_221640.1| hypothetical protein BruAb1_0915 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699773|ref|YP_414347.1| hypothetical protein BAB1_0922 [Brucella melitensis biovar Abortus
           2308]
 gi|148559612|ref|YP_001258882.1| hypothetical protein BOV_0900 [Brucella ovis ATCC 25840]
 gi|161618862|ref|YP_001592749.1| hypothetical protein BCAN_A0917 [Brucella canis ATCC 23365]
 gi|163843175|ref|YP_001627579.1| hypothetical protein BSUIS_A0943 [Brucella suis ATCC 23445]
 gi|225852416|ref|YP_002732649.1| hypothetical protein BMEA_A0943 [Brucella melitensis ATCC 23457]
 gi|254689153|ref|ZP_05152407.1| hypothetical protein Babob68_02995 [Brucella abortus bv. 6 str.
           870]
 gi|254693636|ref|ZP_05155464.1| hypothetical protein Babob3T_03019 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697288|ref|ZP_05159116.1| hypothetical protein Babob28_06109 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701668|ref|ZP_05163496.1| hypothetical protein Bsuib55_12531 [Brucella suis bv. 5 str. 513]
 gi|254704211|ref|ZP_05166039.1| hypothetical protein Bsuib36_09839 [Brucella suis bv. 3 str. 686]
 gi|254706887|ref|ZP_05168715.1| hypothetical protein BpinM_07851 [Brucella pinnipedialis
           M163/99/10]
 gi|254710005|ref|ZP_05171816.1| hypothetical protein BpinB_06966 [Brucella pinnipedialis B2/94]
 gi|254714006|ref|ZP_05175817.1| hypothetical protein BcetM6_11741 [Brucella ceti M644/93/1]
 gi|254716935|ref|ZP_05178746.1| hypothetical protein BcetM_11037 [Brucella ceti M13/05/1]
 gi|254730186|ref|ZP_05188764.1| hypothetical protein Babob42_03034 [Brucella abortus bv. 4 str.
           292]
 gi|256031500|ref|ZP_05445114.1| hypothetical protein BpinM2_12743 [Brucella pinnipedialis
           M292/94/1]
 gi|256044577|ref|ZP_05447481.1| hypothetical protein Bmelb1R_08773 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256061009|ref|ZP_05451166.1| hypothetical protein Bneo5_11692 [Brucella neotomae 5K33]
 gi|256113450|ref|ZP_05454291.1| hypothetical protein Bmelb3E_11952 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256159625|ref|ZP_05457387.1| hypothetical protein BcetM4_11713 [Brucella ceti M490/95/1]
 gi|256254905|ref|ZP_05460441.1| hypothetical protein BcetB_11530 [Brucella ceti B1/94]
 gi|256257403|ref|ZP_05462939.1| hypothetical protein Babob9C_08584 [Brucella abortus bv. 9 str.
           C68]
 gi|256369332|ref|YP_003106840.1| hypothetical protein BMI_I903 [Brucella microti CCM 4915]
 gi|260168633|ref|ZP_05755444.1| hypothetical protein BruF5_09729 [Brucella sp. F5/99]
 gi|260563928|ref|ZP_05834414.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|261213902|ref|ZP_05928183.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261218741|ref|ZP_05933022.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261222087|ref|ZP_05936368.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261317553|ref|ZP_05956750.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321760|ref|ZP_05960957.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261752220|ref|ZP_05995929.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261754879|ref|ZP_05998588.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261758106|ref|ZP_06001815.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265988587|ref|ZP_06101144.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265994838|ref|ZP_06107395.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265998052|ref|ZP_06110609.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|297248252|ref|ZP_06931970.1| hypothetical protein BAYG_01190 [Brucella abortus bv. 5 str. B3196]
 gi|23347721|gb|AAN29832.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62195979|gb|AAX74279.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615874|emb|CAJ10878.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
           2308]
 gi|148370869|gb|ABQ60848.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gi|161335673|gb|ABX61978.1| Hypothetical protein BCAN_A0917 [Brucella canis ATCC 23365]
 gi|163673898|gb|ABY38009.1| Hypothetical protein BSUIS_A0943 [Brucella suis ATCC 23445]
 gi|225640781|gb|ACO00695.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|255999492|gb|ACU47891.1| hypothetical protein BMI_I903 [Brucella microti CCM 4915]
 gi|260153944|gb|EEW89036.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260915509|gb|EEX82370.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260920671|gb|EEX87324.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260923830|gb|EEX90398.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294450|gb|EEX97946.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261296776|gb|EEY00273.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261738090|gb|EEY26086.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261741973|gb|EEY29899.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261744632|gb|EEY32558.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262552520|gb|EEZ08510.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262765951|gb|EEZ11740.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|264660784|gb|EEZ31045.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|297175421|gb|EFH34768.1| hypothetical protein BAYG_01190 [Brucella abortus bv. 5 str. B3196]
          Length = 156

 Score =  201 bits (511), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 62/129 (48%), Positives = 86/129 (66%), Gaps = 2/129 (1%)

Query: 4   RVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           ++ L+ +         A + R +N VA+F+G+DKITGR+ TFDV IN++ QFG+L + P 
Sbjct: 26  QIALITVLAGMGSLHAARAERISNPVAQFSGLDKITGRITTFDVYINETVQFGALQVTPK 85

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
           VCYSR + EA R DAFV++ EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK 
Sbjct: 86  VCYSRTEDEAPRTDAFVTVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCKQ 145

Query: 124 PINDSISNS 132
                +   
Sbjct: 146 --KSDVPPP 152


>gi|153009606|ref|YP_001370821.1| hypothetical protein Oant_2276 [Ochrobactrum anthropi ATCC 49188]
 gi|151561494|gb|ABS14992.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188]
          Length = 156

 Score =  201 bits (510), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 65/132 (49%), Positives = 86/132 (65%), Gaps = 2/132 (1%)

Query: 2   KYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIK 61
             +V L+ L    S  + A + R  N VAEF+G+DKITGR+ TFDV IN++ QFG+L + 
Sbjct: 24  AVQVALISLIATTSSFQAAMAERITNPVAEFSGLDKITGRITTFDVYINETVQFGALQVT 83

Query: 62  PMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           P VCYSR + EA R D FV + EI  DR +R IF+GWMFADSP +NA++H IYD+WL  C
Sbjct: 84  PKVCYSRTENEAPRTDGFVEVEEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDC 143

Query: 122 KDPINDSISNSE 133
           K      +   +
Sbjct: 144 KQ--KSEVPPPD 153


>gi|306843802|ref|ZP_07476400.1| Hypothetical protein BIBO1_0463 [Brucella sp. BO1]
 gi|306275880|gb|EFM57596.1| Hypothetical protein BIBO1_0463 [Brucella sp. BO1]
          Length = 151

 Score =  201 bits (510), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 62/129 (48%), Positives = 86/129 (66%), Gaps = 2/129 (1%)

Query: 4   RVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           ++ L+ +         A + R +N VA+F+G+DKITGR+ TFDV IN++ QFG+L + P 
Sbjct: 21  QLALITVLAGIGSLHAARAERISNPVAQFSGLDKITGRITTFDVYINETVQFGALQVTPK 80

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
           VCYSR + EA R DAFV++ EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK 
Sbjct: 81  VCYSRTEDEAPRTDAFVTVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCKQ 140

Query: 124 PINDSISNS 132
                +   
Sbjct: 141 --KSDVPPP 147


>gi|17987348|ref|NP_539982.1| hypothetical protein BMEI1065 [Brucella melitensis bv. 1 str. 16M]
 gi|189024089|ref|YP_001934857.1| hypothetical protein BAbS19_I08620 [Brucella abortus S19]
 gi|260545406|ref|ZP_05821147.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260566541|ref|ZP_05837011.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260754652|ref|ZP_05867000.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260757875|ref|ZP_05870223.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260761698|ref|ZP_05874041.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883678|ref|ZP_05895292.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261314352|ref|ZP_05953549.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261325009|ref|ZP_05964206.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|265991001|ref|ZP_06103558.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265999496|ref|ZP_06111709.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|294852259|ref|ZP_06792932.1| hypothetical protein BAZG_01178 [Brucella sp. NVSL 07-0026]
 gi|17983032|gb|AAL52246.1| retrovirus-related pol polyprotein [Brucella melitensis bv. 1 str.
           16M]
 gi|189019661|gb|ACD72383.1| hypothetical protein BAbS19_I08620 [Brucella abortus S19]
 gi|260096813|gb|EEW80688.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260156059|gb|EEW91139.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260668193|gb|EEX55133.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260672130|gb|EEX58951.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674760|gb|EEX61581.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260873206|gb|EEX80275.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261300989|gb|EEY04486.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261303378|gb|EEY06875.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|263001785|gb|EEZ14360.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094290|gb|EEZ18151.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|294820848|gb|EFG37847.1| hypothetical protein BAZG_01178 [Brucella sp. NVSL 07-0026]
          Length = 151

 Score =  201 bits (510), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 62/129 (48%), Positives = 86/129 (66%), Gaps = 2/129 (1%)

Query: 4   RVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           ++ L+ +         A + R +N VA+F+G+DKITGR+ TFDV IN++ QFG+L + P 
Sbjct: 21  QIALITVLAGMGSLHAARAERISNPVAQFSGLDKITGRITTFDVYINETVQFGALQVTPK 80

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
           VCYSR + EA R DAFV++ EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK 
Sbjct: 81  VCYSRTEDEAPRTDAFVTVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCKQ 140

Query: 124 PINDSISNS 132
                +   
Sbjct: 141 --KSDVPPP 147


>gi|306840398|ref|ZP_07473163.1| Hypothetical protein BIBO2_0198 [Brucella sp. BO2]
 gi|306289636|gb|EFM60840.1| Hypothetical protein BIBO2_0198 [Brucella sp. BO2]
          Length = 156

 Score =  200 bits (509), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 62/129 (48%), Positives = 86/129 (66%), Gaps = 2/129 (1%)

Query: 4   RVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           ++ L+ +         A + R +N VA+F+G+DKITGR+ TFDV IN++ QFG+L + P 
Sbjct: 26  QLALITVLAGMGSLHAARAERISNPVAQFSGLDKITGRITTFDVYINETVQFGALQVTPK 85

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
           VCYSR + EA R DAFV++ EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK 
Sbjct: 86  VCYSRTEDEAPRTDAFVTVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCKQ 145

Query: 124 PINDSISNS 132
                +   
Sbjct: 146 --KSDVPPP 152


>gi|239831781|ref|ZP_04680110.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824048|gb|EEQ95616.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 162

 Score =  200 bits (509), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 66/135 (48%), Positives = 90/135 (66%), Gaps = 4/135 (2%)

Query: 1   MKYRVLLLILFFVFSHAKF--ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSL 58
           +K  V L ++ F+ + + F  A + R  N VAEF+G+DKITGR+ TFDV IN++ QFG+L
Sbjct: 27  IKRAVQLALISFMATASCFQAAMAERITNPVAEFSGLDKITGRITTFDVYINETVQFGAL 86

Query: 59  IIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWL 118
            + P VCYSR + EA R D FV + EI  DR +R IF+GWMFADSP +NA++H IYD+WL
Sbjct: 87  QVTPKVCYSRTENEAPRTDGFVQVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWL 146

Query: 119 MQCKDPINDSISNSE 133
             CK      +   +
Sbjct: 147 KDCKQ--KSEVPPPD 159


>gi|254719007|ref|ZP_05180818.1| hypothetical protein Bru83_05609 [Brucella sp. 83/13]
 gi|306840106|ref|ZP_07472892.1| Hypothetical protein BROD_2979 [Brucella sp. NF 2653]
 gi|306404834|gb|EFM61127.1| Hypothetical protein BROD_2979 [Brucella sp. NF 2653]
          Length = 156

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 62/129 (48%), Positives = 86/129 (66%), Gaps = 2/129 (1%)

Query: 4   RVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           ++ L+ +         A + R +N VA+F+G+DKITGR+ TFDV IN++ QFG+L + P 
Sbjct: 26  QLALVTVLAGMGSLHAARAERISNPVAQFSGLDKITGRITTFDVYINETVQFGALQVTPK 85

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
           VCYSR + EA R DAFV++ EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK 
Sbjct: 86  VCYSRTEDEAPRTDAFVTVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCKQ 145

Query: 124 PINDSISNS 132
                +   
Sbjct: 146 --KSDVPPP 152


>gi|265983997|ref|ZP_06096732.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|264662589|gb|EEZ32850.1| conserved hypothetical protein [Brucella sp. 83/13]
          Length = 151

 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 62/129 (48%), Positives = 86/129 (66%), Gaps = 2/129 (1%)

Query: 4   RVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           ++ L+ +         A + R +N VA+F+G+DKITGR+ TFDV IN++ QFG+L + P 
Sbjct: 21  QLALVTVLAGMGSLHAARAERISNPVAQFSGLDKITGRITTFDVYINETVQFGALQVTPK 80

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
           VCYSR + EA R DAFV++ EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK 
Sbjct: 81  VCYSRTEDEAPRTDAFVTVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCKQ 140

Query: 124 PINDSISNS 132
                +   
Sbjct: 141 --KSDVPPP 147


>gi|254502067|ref|ZP_05114218.1| hypothetical protein SADFL11_2105 [Labrenzia alexandrii DFL-11]
 gi|222438138|gb|EEE44817.1| hypothetical protein SADFL11_2105 [Labrenzia alexandrii DFL-11]
          Length = 169

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 55/176 (31%), Positives = 94/176 (53%), Gaps = 10/176 (5%)

Query: 1   MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLII 60
           M + + +L      + A+ A S +  N VA F+G+DKITGR++ FDV + ++ QFG+L +
Sbjct: 1   MAFGLGMLAFQPQTALAQ-AESEKIENPVAVFSGLDKITGRIINFDVYVGETVQFGALQV 59

Query: 61  KPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ 120
            P VC++R   E+     FV + EI  +  VR IFSGWM+A SP ++A++H +YDIWL  
Sbjct: 60  TPRVCHTRPQTESPLTTGFVQVDEITLNNEVRRIFSGWMYAASPGLHAVEHPVYDIWLTD 119

Query: 121 CKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSS--NKTLEKESSQPLE 174
           C+  +   +   E      +       + ++G +  +G     +       ++P +
Sbjct: 120 CR--LASKVPPPEDYDGPPIK-----GVVAEGEDPLAGPDDGVDTGPGIPRAKPFQ 168


>gi|222148330|ref|YP_002549287.1| hypothetical protein Avi_1785 [Agrobacterium vitis S4]
 gi|221735318|gb|ACM36281.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 171

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 65/127 (51%), Positives = 86/127 (67%), Gaps = 2/127 (1%)

Query: 8   LILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYS 67
           L + F  +    A++AR +N VA F+G+DKITGR+  FDV +N++ QFG+L + P  CYS
Sbjct: 47  LTVAFSITATVPADAARISNAVAVFSGLDKITGRITEFDVYLNETVQFGALQVTPKACYS 106

Query: 68  RDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPIND 127
           RD+ EAQ +DAFV + EI  DR +R IFSGWMFADSPA+NAI+H IYD+WL  CK     
Sbjct: 107 RDETEAQHVDAFVQVDEITLDRRIRQIFSGWMFADSPALNAIEHPIYDVWLKDCKQ--TS 164

Query: 128 SISNSES 134
            +     
Sbjct: 165 DVPKPAK 171


>gi|227821674|ref|YP_002825644.1| hypothetical protein NGR_c11050 [Sinorhizobium fredii NGR234]
 gi|227340673|gb|ACP24891.1| hypothetical protein NGR_c11050 [Sinorhizobium fredii NGR234]
          Length = 150

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 61/133 (45%), Positives = 87/133 (65%), Gaps = 1/133 (0%)

Query: 3   YRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKP 62
             + +L+   + S  + A + R +N VA F+G+DKITGR+ TFDV I ++ QFG+L + P
Sbjct: 17  TGLAVLLALPLISAGEPARATRLSNAVAVFSGIDKITGRITTFDVYIGETVQFGALQVTP 76

Query: 63  MVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            VCYSRD+ EA +   FV + EI  DR +R IF+GWMFADSP +NA++H +YD+WL  CK
Sbjct: 77  HVCYSRDETEAPKTTTFVDVDEITLDRKIRRIFTGWMFADSPGLNAVEHPVYDVWLQSCK 136

Query: 123 DPINDSISNSESI 135
            P +D      + 
Sbjct: 137 -PTSDVPPPDTAA 148


>gi|116251846|ref|YP_767684.1| hypothetical protein RL2086 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115256494|emb|CAK07578.1| conserved hypothetical exported protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 146

 Score =  198 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 61/123 (49%), Positives = 82/123 (66%)

Query: 16  HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQR 75
               AN+AR  N VA F+G+DKITGR+ TFDV +N++ QFG+L + P  CYSRD  EAQ+
Sbjct: 24  PPVAANAARIENPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKACYSRDQSEAQK 83

Query: 76  IDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESI 135
           ID FV + EI  DR +R IF+GWMFA SP +NA++H IYD+WL  CK   +    +    
Sbjct: 84  IDGFVEVDEITLDRKIRRIFTGWMFAASPGLNAVEHPIYDVWLKDCKTSSDVPAPDGTKA 143

Query: 136 SKK 138
           + +
Sbjct: 144 TAR 146


>gi|218462710|ref|ZP_03502801.1| hypothetical protein RetlK5_26127 [Rhizobium etli Kim 5]
          Length = 146

 Score =  198 bits (503), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 61/131 (46%), Positives = 84/131 (64%)

Query: 8   LILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYS 67
           L+          A++ R  N VA F+G+DKITGR+ TFDV +N++ QFG+L + P VCYS
Sbjct: 16  LLALTALLPIGAAHATRIENPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKVCYS 75

Query: 68  RDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPIND 127
           RD  EAQ+ID FV + EI  DR +R IF+GWMFA SP +NA++H IYD+WL  CK   + 
Sbjct: 76  RDQAEAQKIDGFVEVDEITLDRKIRRIFTGWMFAASPGLNAVEHPIYDVWLKDCKTSSDV 135

Query: 128 SISNSESISKK 138
              +    + +
Sbjct: 136 PAPDGTKATAR 146


>gi|327193632|gb|EGE60515.1| hypothetical protein RHECNPAF_1440013 [Rhizobium etli CNPAF512]
          Length = 146

 Score =  197 bits (502), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 61/123 (49%), Positives = 82/123 (66%)

Query: 16  HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQR 75
               AN+AR  N VA F+G+DKITGR+ TFDV +N++ QFG+L + P  CYSRD  EAQ+
Sbjct: 24  PPVAANAARIENPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKACYSRDQAEAQK 83

Query: 76  IDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESI 135
           ID FV + EI  DR +R IF+GWMFA SP +NA++H IYD+WL  CK   +    +    
Sbjct: 84  IDGFVEVDEITLDRKIRRIFTGWMFAASPGLNAVEHPIYDVWLKDCKTSSDVPAPDGTKA 143

Query: 136 SKK 138
           + +
Sbjct: 144 TAR 146


>gi|218508641|ref|ZP_03506519.1| hypothetical protein RetlB5_14231 [Rhizobium etli Brasil 5]
          Length = 146

 Score =  197 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 61/123 (49%), Positives = 82/123 (66%)

Query: 16  HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQR 75
               AN+AR  N VA F+G+DKITGR+ TFDV +N++ QFG+L + P  CYSRD  EAQ+
Sbjct: 24  PPVAANAARIENPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKACYSRDQAEAQK 83

Query: 76  IDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESI 135
           ID FV + EI  DR +R IF+GWMFA SP +NA++H IYD+WL  CK   +    +    
Sbjct: 84  IDGFVEVDEITLDRKIRRIFTGWMFAASPGLNAVEHPIYDVWLKDCKTSSDVPAPDRTKA 143

Query: 136 SKK 138
           + +
Sbjct: 144 TAR 146


>gi|150396172|ref|YP_001326639.1| hypothetical protein Smed_0949 [Sinorhizobium medicae WSM419]
 gi|150027687|gb|ABR59804.1| conserved hypothetical protein [Sinorhizobium medicae WSM419]
          Length = 150

 Score =  197 bits (502), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 60/125 (48%), Positives = 83/125 (66%), Gaps = 2/125 (1%)

Query: 13  VFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE 72
           V S  + A +AR  N VA F+G+DKITGR+ +FDV I ++ QFG+L + P VCYSRD+ E
Sbjct: 27  VVSTTEPAQAARLPNAVAVFSGIDKITGRITSFDVYIGETVQFGALQVTPRVCYSRDETE 86

Query: 73  AQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNS 132
           A +   FV + EI  DR +R IF+GWMFADSP +NA++H +YD+WL  CK      +   
Sbjct: 87  APKTTTFVEVDEITLDRKIRRIFTGWMFADSPGLNAVEHPVYDVWLQSCKT--TSEVPPP 144

Query: 133 ESISK 137
           ++  K
Sbjct: 145 DTAEK 149


>gi|190891554|ref|YP_001978096.1| hypothetical protein RHECIAT_CH0001952 [Rhizobium etli CIAT 652]
 gi|218515121|ref|ZP_03511961.1| hypothetical protein Retl8_16241 [Rhizobium etli 8C-3]
 gi|190696833|gb|ACE90918.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 146

 Score =  197 bits (500), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 62/124 (50%), Positives = 81/124 (65%), Gaps = 2/124 (1%)

Query: 16  HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQR 75
               AN+AR  N VA F+G+DKITGR+ TFDV +N++ QFG+L + P  CYSRD  EAQ+
Sbjct: 24  PPIAANAARIENPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKACYSRDQAEAQK 83

Query: 76  IDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESI 135
           ID FV + EI  DR +R IF+GWMFA SP +NA++H IYD+WL  CK      +   +  
Sbjct: 84  IDGFVEVDEITLDRKIRRIFTGWMFAASPGLNAVEHPIYDVWLKDCKT--TSDVPAPDGT 141

Query: 136 SKKA 139
              A
Sbjct: 142 KTTA 145


>gi|326408925|gb|ADZ65990.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326538641|gb|ADZ86856.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 121

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 61/114 (53%), Positives = 81/114 (71%), Gaps = 2/114 (1%)

Query: 19  FANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDA 78
            A + R +N VA+F+G+DKITGR+ TFDV IN++ QFG+L + P VCYSR + EA R DA
Sbjct: 6   AARAERISNPVAQFSGLDKITGRITTFDVYINETVQFGALQVTPKVCYSRTEDEAPRTDA 65

Query: 79  FVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNS 132
           FV++ EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK      +   
Sbjct: 66  FVTVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCKQ--KSDVPPP 117


>gi|90417714|ref|ZP_01225626.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337386|gb|EAS51037.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 135

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 61/126 (48%), Positives = 83/126 (65%), Gaps = 3/126 (2%)

Query: 1   MKYRVLLLILFFV---FSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGS 57
           M  R+   ILF V    +    +   R ANKVA F+G+DKITGR+ +FDV I+++ QFG+
Sbjct: 1   MNRRLCASILFAVTTGLALVPASAQQRIANKVAVFSGLDKITGRITSFDVYIDETVQFGA 60

Query: 58  LIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIW 117
           L + P VCY+  + EA + DAFV + EI   R +R IFSGWMFA SP +NA++H +YD+W
Sbjct: 61  LQVTPKVCYTSAEGEAAKTDAFVKVDEITLQRDIRQIFSGWMFAASPGLNAVEHPVYDVW 120

Query: 118 LMQCKD 123
           L  CK 
Sbjct: 121 LKSCKS 126


>gi|15965070|ref|NP_385423.1| hypothetical protein SMc01347 [Sinorhizobium meliloti 1021]
 gi|307301141|ref|ZP_07580910.1| Protein of unknown function DUF2155 [Sinorhizobium meliloti BL225C]
 gi|307317874|ref|ZP_07597312.1| Protein of unknown function DUF2155 [Sinorhizobium meliloti AK83]
 gi|15074249|emb|CAC45896.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306896636|gb|EFN27384.1| Protein of unknown function DUF2155 [Sinorhizobium meliloti AK83]
 gi|306904096|gb|EFN34682.1| Protein of unknown function DUF2155 [Sinorhizobium meliloti BL225C]
          Length = 150

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 59/125 (47%), Positives = 85/125 (68%), Gaps = 2/125 (1%)

Query: 13  VFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE 72
           V S  + A +AR +N VA F+G+DKITGR+ +FDV I ++ QFG+L + P VC+SRD+ E
Sbjct: 27  VTSAVETAQAARLSNAVAVFSGIDKITGRITSFDVYIGETVQFGALQVTPRVCHSRDETE 86

Query: 73  AQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNS 132
           A +   FV + EI  DR +R IF+GWMFADSP +NA++H +YD+WL  CK      +   
Sbjct: 87  APKTTTFVEVDEITLDRKIRRIFTGWMFADSPGLNAVEHPVYDVWLQSCKS--TSEVPPP 144

Query: 133 ESISK 137
           ++ +K
Sbjct: 145 DTAAK 149


>gi|222085635|ref|YP_002544165.1| hypothetical protein Arad_1920 [Agrobacterium radiobacter K84]
 gi|221723083|gb|ACM26239.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 146

 Score =  194 bits (494), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 62/122 (50%), Positives = 85/122 (69%), Gaps = 2/122 (1%)

Query: 17  AKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRI 76
            + A +AR +N VA F+G+DKITGR+ TFDV +N++ QFG+L + P  CYSRDD E Q++
Sbjct: 27  PQAAEAARISNPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKACYSRDDTEQQKV 86

Query: 77  DAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESIS 136
           D FV + EI  DR +R IF+GWMFADSP +NA++H IYD+WL +CK      I   ++  
Sbjct: 87  DGFVEVDEITLDRRIRRIFTGWMFADSPGLNAVEHPIYDVWLKECKQ--KSDIPPPDNAG 144

Query: 137 KK 138
            K
Sbjct: 145 AK 146


>gi|159184714|ref|NP_354334.2| hypothetical protein Atu1328 [Agrobacterium tumefaciens str. C58]
 gi|159140002|gb|AAK87119.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 145

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 65/132 (49%), Positives = 87/132 (65%), Gaps = 3/132 (2%)

Query: 4   RVLLLILFFVFSHA---KFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLII 60
           R L + LF   S         +AR  N+VA F+G+DKITGR+ +FDV I+++ QFG+L +
Sbjct: 11  RALTVSLFAAVSAVLIVSPVAAARLENRVAVFSGIDKITGRITSFDVYIDETVQFGALQV 70

Query: 61  KPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ 120
            P VCYSRD  E Q+IDAFV + EI  DR +R IF+GWMFADSP +NA++H IYD+WL  
Sbjct: 71  TPKVCYSRDQTETQKIDAFVEVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLTG 130

Query: 121 CKDPINDSISNS 132
           CK        ++
Sbjct: 131 CKQDSEVPAPST 142


>gi|218661471|ref|ZP_03517401.1| hypothetical protein RetlI_19085 [Rhizobium etli IE4771]
          Length = 125

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 61/124 (49%), Positives = 81/124 (65%), Gaps = 2/124 (1%)

Query: 16  HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQR 75
               A++ R  N VA F+G+DKITGR+ TFDV +N++ QFG+L + P VCYSRD  EAQ+
Sbjct: 3   PIGAAHATRIENPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKVCYSRDQAEAQK 62

Query: 76  IDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESI 135
           ID FV + EI  DR +R IF+GWMFA SP +NA++H IYD+WL  CK      +   +  
Sbjct: 63  IDGFVEVDEITLDRKIRRIFTGWMFAASPGLNAVEHPIYDVWLKDCKTS--SDVPAPDGT 120

Query: 136 SKKA 139
              A
Sbjct: 121 KPTA 124


>gi|209549131|ref|YP_002281048.1| hypothetical protein Rleg2_1532 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534887|gb|ACI54822.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 146

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 60/123 (48%), Positives = 83/123 (67%)

Query: 16  HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQR 75
               A++AR  N VA F+G+DKITGR+ TFDV +N++ QFG+L + P  CYSRD  EAQ+
Sbjct: 24  PPVAAHAARIENPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKACYSRDQAEAQK 83

Query: 76  IDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESI 135
           ID FV + EI  DR +R IF+GWMFA SP +NA++H IYD+WL  CK   +    ++   
Sbjct: 84  IDGFVEVDEITLDRKIRRIFTGWMFAASPGLNAVEHPIYDVWLKDCKANSDVPAPDNAKA 143

Query: 136 SKK 138
           + +
Sbjct: 144 TAR 146


>gi|86357492|ref|YP_469384.1| hypothetical protein RHE_CH01866 [Rhizobium etli CFN 42]
 gi|86281594|gb|ABC90657.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 146

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 61/118 (51%), Positives = 81/118 (68%), Gaps = 2/118 (1%)

Query: 21  NSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
           ++AR  N VA F+G+DKITGR+ TFDV +N++ QFG+L + P  CYSRD  EAQ+ID FV
Sbjct: 29  HAARIDNPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKACYSRDQAEAQKIDGFV 88

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKK 138
            + EI  DR +R IF+GWMFADSP +NA++H IYD+WL  CK      +   +S    
Sbjct: 89  EVDEITLDRKIRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK--ATSDVPAPDSAKAP 144


>gi|307947206|ref|ZP_07662541.1| putative signal peptide protein [Roseibium sp. TrichSKD4]
 gi|307770870|gb|EFO30096.1| putative signal peptide protein [Roseibium sp. TrichSKD4]
          Length = 180

 Score =  194 bits (493), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 84/155 (54%), Gaps = 4/155 (2%)

Query: 14  FSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREA 73
            + ++   S +  N VA F+G+DKITGR++ FDV I ++ QFG+L + P VCY+R   E+
Sbjct: 26  LAQSQP-QSQKIENPVAVFSGLDKITGRIINFDVYIGETVQFGALQVTPRVCYTRPQTES 84

Query: 74  QRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSE 133
                F+ + EI  +  VR IFSGWM+A SP ++A++H +YDIWL  CK     ++   E
Sbjct: 85  PLTTGFIQVDEITLNNEVRRIFSGWMYAASPGLHAVEHGVYDIWLTNCKR--TSTVPPPE 142

Query: 134 SISKKALSEYSSTDITS-QGSEKSSGSSSNKTLEK 167
                 + + +S D     G +    +      + 
Sbjct: 143 GYDGPPVEQVTSEDQDPLAGPDDGVDTILAPRPKP 177


>gi|163868079|ref|YP_001609283.1| hypothetical protein Btr_0884 [Bartonella tribocorum CIP 105476]
 gi|161017730|emb|CAK01288.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 138

 Score =  194 bits (492), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 49/123 (39%), Positives = 75/123 (60%)

Query: 1   MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLII 60
           ++  + L+ +    S      + R +N +A FAG+DKITGR   F+V + +  Q+G+L +
Sbjct: 8   LRIHIFLIGILVFLSLNSGGRAERISNGIAVFAGLDKITGRTTRFEVSLGEVYQYGALQV 67

Query: 61  KPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ 120
            P  CY+    E  R   FV ++E+  D+ +R IF+GWMFADSP +NA++H IYD+WL  
Sbjct: 68  TPRACYTSSKDEPTRTTGFVEVNEVTLDKKIRRIFTGWMFADSPGLNAVEHPIYDVWLKD 127

Query: 121 CKD 123
           CK 
Sbjct: 128 CKQ 130


>gi|325292687|ref|YP_004278551.1| hypothetical protein AGROH133_05769 [Agrobacterium sp. H13-3]
 gi|325060540|gb|ADY64231.1| hypothetical protein AGROH133_05769 [Agrobacterium sp. H13-3]
          Length = 145

 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 64/132 (48%), Positives = 89/132 (67%), Gaps = 3/132 (2%)

Query: 4   RVLLLILFFVFSHA---KFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLII 60
           R L + LF   S        ++AR  N+VA F+G+DKITGR+ +FDV I+++ QFG+L +
Sbjct: 11  RALTVSLFAAVSAVILVSPVSAARLENRVAVFSGIDKITGRITSFDVYIDETVQFGALQV 70

Query: 61  KPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ 120
            P VCYSRD  EAQ+IDAF+ + EI  DR ++ IF+GWMFADSP +NA++H IYD+WL  
Sbjct: 71  TPKVCYSRDQTEAQKIDAFIEVDEITLDRKIKRIFTGWMFADSPGLNAVEHPIYDVWLTG 130

Query: 121 CKDPINDSISNS 132
           CK        ++
Sbjct: 131 CKQDSEVPAPST 142


>gi|254469527|ref|ZP_05082932.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gi|211961362|gb|EEA96557.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
          Length = 181

 Score =  192 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 61/152 (40%), Positives = 87/152 (57%), Gaps = 3/152 (1%)

Query: 16  HAKFANSAR-FANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQ 74
           ++  A +     N VA F G+DKITGR+ TFDV I+++ QFG+L + P VC SR   EA 
Sbjct: 26  YSLPAQAQTPIHNPVAVFKGLDKITGRITTFDVYIDETVQFGALQVTPRVCNSRPLTEAS 85

Query: 75  RIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSES 134
           +  AF+ + E+  D  VR IFSGWMFA +P ++A++HS+YDIWL+ CK     S+   E 
Sbjct: 86  QTTAFIEVDELTLDSKVRRIFSGWMFASNPGVHAVEHSVYDIWLINCKK--TTSVPPPEG 143

Query: 135 ISKKALSEYSSTDITSQGSEKSSGSSSNKTLE 166
            +  A+   S  D  +     SSG       +
Sbjct: 144 YAGPAVELVSEEDELAGKDFVSSGEIPVPRPK 175


>gi|241204456|ref|YP_002975552.1| hypothetical protein Rleg_1727 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858346|gb|ACS56013.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 146

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 78/116 (67%), Gaps = 2/116 (1%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
           R  N VA F+G+DKITGR+ TFDV +N++ QFG+L + P  CYSRD  EAQ+ID FV + 
Sbjct: 32  RIENPVAVFSGLDKITGRITTFDVYVNETVQFGALQVTPKACYSRDQSEAQKIDGFVEVD 91

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKA 139
           EI  DR +R IF+GWMFA SP +NA++H IYD+WL  CK   N  +   +     A
Sbjct: 92  EITLDRKIRRIFTGWMFAASPGLNAVEHPIYDVWLKDCK--ANSDVPAPDGAKATA 145


>gi|163759361|ref|ZP_02166447.1| hypothetical protein HPDFL43_06335 [Hoeflea phototrophica DFL-43]
 gi|162283765|gb|EDQ34050.1| hypothetical protein HPDFL43_06335 [Hoeflea phototrophica DFL-43]
          Length = 145

 Score =  191 bits (484), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 59/139 (42%), Positives = 86/139 (61%), Gaps = 4/139 (2%)

Query: 1   MKYRVLLLILFFVFSHAKFANS--ARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSL 58
           +      L++    S    A +  AR  N VA F+G+DKITGR+ TFDV + ++ QFG+L
Sbjct: 8   LARASFALVIVATASVVGLAQASAARIENPVAVFSGIDKITGRITTFDVYVGETVQFGAL 67

Query: 59  IIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWL 118
            + P VCYSRD+ EA +   FV + EI  DR +R +F+GWMFADSP +NA+DH++YD+WL
Sbjct: 68  QVTPKVCYSRDESEAPKTTTFVEVDEITLDRKIRRLFTGWMFADSPGLNAVDHAVYDVWL 127

Query: 119 MQCKDPINDSISNSESISK 137
            +CK  +   +      + 
Sbjct: 128 KECK--LQSDVPPPAPEAT 144


>gi|240850282|ref|YP_002971675.1| hypothetical protein Bgr_06800 [Bartonella grahamii as4aup]
 gi|240267405|gb|ACS50993.1| hypothetical protein Bgr_06800 [Bartonella grahamii as4aup]
          Length = 141

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 51/123 (41%), Positives = 74/123 (60%)

Query: 5   VLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMV 64
           + L+ +    S      + R +N +A FAG+DKITGR   F+V + +  Q+G+L + P  
Sbjct: 15  IFLMGVLVFLSLNSGVRAERISNGIAVFAGLDKITGRTTRFEVTLGKIYQYGALQVTPRA 74

Query: 65  CYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
           CY+    E  R   FV ++E+  D+ VR IF+GWMFADSP +NA++H IYD+WL  CK  
Sbjct: 75  CYTSSKDEPTRTTGFVEVNEVTLDKKVRRIFTGWMFADSPGLNAVEHPIYDVWLKDCKQN 134

Query: 125 IND 127
             D
Sbjct: 135 SQD 137


>gi|49475388|ref|YP_033429.1| hypothetical protein BH05970 [Bartonella henselae str. Houston-1]
 gi|49238194|emb|CAF27404.1| hypothetical protein BH05970 [Bartonella henselae str. Houston-1]
          Length = 141

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 50/121 (41%), Positives = 72/121 (59%)

Query: 5   VLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMV 64
              + +    S      + R +N +A FAG+DKITGR   F+V + +  Q+G+L + P V
Sbjct: 15  ACFMGIVGTLSSMDGVQAERVSNGIAVFAGLDKITGRTTRFEVSLGEVYQYGALQVTPRV 74

Query: 65  CYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
           CY+    E  R   FV ++E+  D+ VR IF+GWMFADSP +NA++H IYD+WL  CK  
Sbjct: 75  CYTSSKDEPTRTTGFVEVNEVTLDKKVRRIFTGWMFADSPGLNAVEHPIYDVWLKDCKQS 134

Query: 125 I 125
            
Sbjct: 135 S 135


>gi|13470480|ref|NP_102049.1| cellulase-like protein [Mesorhizobium loti MAFF303099]
 gi|14021222|dbj|BAB47835.1| cellulase-like protein [Mesorhizobium loti MAFF303099]
          Length = 198

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 60/158 (37%), Positives = 96/158 (60%), Gaps = 3/158 (1%)

Query: 21  NSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
            S R  N VAEFAG+DKITGR++TFDV I+++ QFG+L + P VCYSR   E  + D+FV
Sbjct: 44  GSDRITNPVAEFAGIDKITGRIITFDVYIDETVQFGALQVTPRVCYSRPQNEEPKTDSFV 103

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKAL 140
            + EI  DR +R IF+GWMFA+SP +NA++H++YD+WL +CK   +    ++        
Sbjct: 104 EVDEITLDRKIRRIFTGWMFAESPGLNAVEHAVYDVWLKECKQKSDVPAPDATKADAPK- 162

Query: 141 SEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLS 178
               ++   +     +  ++S    + + +QP  ++ +
Sbjct: 163 --ADASKPVATKPAAAKPAASPDAEQPDPTQPDTSDAN 198


>gi|110634070|ref|YP_674278.1| cellulase-like protein [Mesorhizobium sp. BNC1]
 gi|110285054|gb|ABG63113.1| cellulase-like protein [Chelativorans sp. BNC1]
          Length = 141

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 56/114 (49%), Positives = 80/114 (70%), Gaps = 2/114 (1%)

Query: 19  FANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDA 78
            A++ R  N VAEF+G+DKITGR+  FDV ++++ QFG+L + P VCYS  + E  + DA
Sbjct: 27  PAHAERIKNPVAEFSGIDKITGRITNFDVYMDETVQFGALQVTPRVCYSSPETEEPKTDA 86

Query: 79  FVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNS 132
           FV ++EI  DR +R IF+GWMFA+SP +NAI+H++YD+WL  CK   N  +   
Sbjct: 87  FVEVNEITLDRQIRRIFTGWMFAESPGVNAIEHAVYDVWLKSCKQ--NSDVPPP 138


>gi|114704669|ref|ZP_01437577.1| hypothetical protein FP2506_07031 [Fulvimarina pelagi HTCC2506]
 gi|114539454|gb|EAU42574.1| hypothetical protein FP2506_07031 [Fulvimarina pelagi HTCC2506]
          Length = 113

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 56/113 (49%), Positives = 76/113 (67%), Gaps = 1/113 (0%)

Query: 21  NSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
              R  N VA F+G+DKITGR+  FDV I+++ QFG+L + P VC +  + EA + DAFV
Sbjct: 2   AQQRLENPVAVFSGLDKITGRLTDFDVFIDETVQFGALQVTPRVCKTSAEGEATQTDAFV 61

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSE 133
            + EI  DR +R IFSGWMFA SP +NA++H +YD+WL  CK   +D  + SE
Sbjct: 62  EVDEITLDREIRRIFSGWMFAASPGLNAVEHPVYDVWLKSCKT-ESDVPAPSE 113


>gi|260460719|ref|ZP_05808969.1| cellulase-like protein [Mesorhizobium opportunistum WSM2075]
 gi|259033296|gb|EEW34557.1| cellulase-like protein [Mesorhizobium opportunistum WSM2075]
          Length = 197

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 62/152 (40%), Positives = 90/152 (59%), Gaps = 6/152 (3%)

Query: 21  NSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
            S R  N VAEFAG+DKITGR++TFDV I+++ QFG+L + P VCYSR   E  + D+FV
Sbjct: 41  GSDRITNPVAEFAGIDKITGRIITFDVYIDETVQFGALQVTPRVCYSRPQNEEPKTDSFV 100

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKAL 140
            + EI  DR +R IF+GWMFA+SP +NA++H++YD+WL  CK        +         
Sbjct: 101 EVDEITLDRKIRRIFTGWMFAESPGLNAVEHAVYDVWLKACKQ------KSDVPAPDATK 154

Query: 141 SEYSSTDITSQGSEKSSGSSSNKTLEKESSQP 172
            + +  D +     K + +  N  +  +  QP
Sbjct: 155 PDATKADASEPAVAKPAAAKPNAEVSPDVEQP 186


>gi|49474317|ref|YP_032359.1| hypothetical protein BQ07260 [Bartonella quintana str. Toulouse]
 gi|49239821|emb|CAF26212.1| hypothetical protein BQ07260 [Bartonella quintana str. Toulouse]
          Length = 141

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 47/121 (38%), Positives = 71/121 (58%)

Query: 5   VLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMV 64
              + +  + S      + R +N +  FAG+DKITGR   F+V + +  Q+G+L + P V
Sbjct: 15  ACFMGIVVLLSSMGGVPAERVSNAIVVFAGLDKITGRTTLFEVSLGEVYQYGALQVTPRV 74

Query: 65  CYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
           CY+    E      FV ++EI  ++ VR IF+GWMFADSP +NA++H +YD+WL  CK  
Sbjct: 75  CYTGSKDEPTHTTGFVEVNEITLEKKVRRIFTGWMFADSPGLNAVEHPVYDVWLKDCKRS 134

Query: 125 I 125
            
Sbjct: 135 S 135


>gi|319405550|emb|CBI79169.1| conserved exported hypothetical protein [Bartonella sp. AR 15-3]
          Length = 139

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 53/127 (41%), Positives = 80/127 (62%), Gaps = 1/127 (0%)

Query: 3   YRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKP 62
           Y  LL+ +  +F+      + R +N++  F G+DKITG+V +F+V I Q  Q+G+L + P
Sbjct: 13  YTYLLVGIAVLFT-VSCVQAERISNEIVIFTGLDKITGQVTSFEVHIGQVYQYGALQVIP 71

Query: 63  MVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            VCY+    EA R   FV ++E+  ++  R IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 72  RVCYTSSKNEAARTIGFVEVNEMTLEKKTRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK 131

Query: 123 DPINDSI 129
              +  I
Sbjct: 132 KSSDTLI 138


>gi|319404107|emb|CBI77697.1| conserved exported hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 140

 Score =  181 bits (459), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 52/121 (42%), Positives = 78/121 (64%), Gaps = 1/121 (0%)

Query: 3   YRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKP 62
           Y  LL  +  +F+   F  + R +N++  F G+DKITG+V +F+V I Q  Q+G+L + P
Sbjct: 13  YTFLLGGIAVLFT-VSFVQAERISNEIVIFTGLDKITGQVTSFEVHIGQVYQYGALQVIP 71

Query: 63  MVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            VCY+    E  R  +F+ +SE+  ++  R IF+GWMFADSP +NA++H IYD+WL  CK
Sbjct: 72  RVCYTSSKNEPARTTSFIEVSEMTLEKKTRRIFTGWMFADSPGLNAVEHPIYDVWLKDCK 131

Query: 123 D 123
            
Sbjct: 132 K 132


>gi|304391690|ref|ZP_07373632.1| putative signal peptide protein [Ahrensia sp. R2A130]
 gi|303295919|gb|EFL90277.1| putative signal peptide protein [Ahrensia sp. R2A130]
          Length = 142

 Score =  181 bits (459), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 56/140 (40%), Positives = 79/140 (56%), Gaps = 11/140 (7%)

Query: 4   RVLLLILFFVFSHAKFANSA---------RFANKVAEFAGMDKITGRVLTFDVEINQSAQ 54
           R+L+  L    +    A +          R ANKVA FAG+DKITGR+ TFDV ++++ +
Sbjct: 2   RILMAALMATVASTALAQTDGFTEEEQISRIANKVAVFAGLDKITGRITTFDVYMDETVK 61

Query: 55  FGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIY 114
           FG L + P  CYS    E  +  +F+ + EI  DR +R IFSGWMFA+SP +NAI+H + 
Sbjct: 62  FGQLELTPRACYSSSAAETPKTTSFIEVDEITLDRRIRRIFSGWMFAESPGLNAIEHPVN 121

Query: 115 DIWLMQCKDPINDSISNSES 134
           D+WL  CK      +     
Sbjct: 122 DVWLKACKQ--TSDVPPPPP 139


>gi|75675950|ref|YP_318371.1| hypothetical protein Nwi_1758 [Nitrobacter winogradskyi Nb-255]
 gi|74420820|gb|ABA05019.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 397

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 57/157 (36%), Positives = 82/157 (52%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A + R  NK A F+G+DKITGR++ FD +I ++ QFG+L +K   CY+R   EA   DAF
Sbjct: 233 APAERIVNKKAVFSGLDKITGRIIHFDEDIGETVQFGALRVKTSACYTRPATEAANTDAF 292

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKA 139
           V + EI     V+ IFSGWMFA SP ++ ++H IYD+WL  CKDP    I+      K  
Sbjct: 293 VEVDEITLQGEVKRIFSGWMFASSPGLHGVEHPIYDVWLTDCKDPETTVIAEQPDQPKPT 352

Query: 140 LSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENN 176
               +     S    +             + +  ++N
Sbjct: 353 PPPPARRSRQSTRQSRQPAPPPQPAPVPPAQRQPQSN 389


>gi|319408372|emb|CBI82025.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 118

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 51/109 (46%), Positives = 71/109 (65%)

Query: 15  SHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQ 74
           S      + R +N V  FAG+DKITGR + F+V I +  Q+G+L + P VCY+  + E  
Sbjct: 2   SSVNGVQAERVSNAVVVFAGLDKITGRTIRFEVSIGEVYQYGALRVTPRVCYTSSEGEPT 61

Query: 75  RIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
           R + FV + EI  ++ +R IF+GWMFADSP +NA++H IYDIWL  CK 
Sbjct: 62  RTNGFVEVDEITLNKEMRRIFTGWMFADSPGLNAVEHPIYDIWLKDCKQ 110


>gi|300022476|ref|YP_003755087.1| hypothetical protein Hden_0952 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299524297|gb|ADJ22766.1| Protein of unknown function DUF2155 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 215

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 50/161 (31%), Positives = 80/161 (49%), Gaps = 4/161 (2%)

Query: 9   ILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSR 68
            +  +   A  A + R  N VA F+ +DK+T R+  F+VE+N++ +FG+L + P  CYSR
Sbjct: 55  AVVCLLGPASPARADRIENGVAVFSALDKVTARISKFEVELNKTVEFGALRVTPRSCYSR 114

Query: 69  DDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDS 128
              E  +   FV + E   D   + IF+GWMFA+SP +  ++H  YD+WL  C+ P   S
Sbjct: 115 PPTEEPKTTTFVEVDETQLDGTEKRIFTGWMFAESPGIYGLEHPTYDVWLTDCEKP-RRS 173

Query: 129 ISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKES 169
           ++  +    +A SE +                S+   E   
Sbjct: 174 VAEKKPAPAEAPSEGNDAATAEAPPPAG---DSDLPPEFRR 211


>gi|319783248|ref|YP_004142724.1| hypothetical protein Mesci_3554 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169136|gb|ADV12674.1| Protein of unknown function DUF2155 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 196

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 61/150 (40%), Positives = 91/150 (60%), Gaps = 1/150 (0%)

Query: 23  ARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSI 82
            R  N VAEFAG+DKITGR++TFDV I+++ QFG+L + P VCYSR   EA + D+FV +
Sbjct: 42  DRVTNAVAEFAGIDKITGRIITFDVYIDETVQFGALQVTPRVCYSRPQAEAPKTDSFVEV 101

Query: 83  SEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSE 142
            EI  DR +R IF+GWMFA+SP +NA++H++YD+WL  CK   +    +           
Sbjct: 102 DEITLDRKIRRIFTGWMFAESPGLNAVEHAVYDVWLKACKQKSDVPAPDGAKADATKAEA 161

Query: 143 YSSTDITSQGSEKSSGSSSNKTLEKESSQP 172
                   + +     ++ + T E ++S+P
Sbjct: 162 PKPAAAKPEAATTPDVTTPDVT-EPDASEP 190


>gi|319898785|ref|YP_004158878.1| hypothetical protein BARCL_0615 [Bartonella clarridgeiae 73]
 gi|319402749|emb|CBI76296.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 147

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 52/123 (42%), Positives = 79/123 (64%)

Query: 3   YRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKP 62
           + + L+    + S      + R +N++  F+G+DKITGRV +F+V I Q  Q+G+L I P
Sbjct: 21  FYIYLVGGIAILSAVSRVLAERVSNEIGIFSGLDKITGRVTSFEVHIGQVYQYGALQIIP 80

Query: 63  MVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            VCY+  + E  R  +FV ++E+  ++  R IF+GWMFADSP +NA++HSIYD+WL  CK
Sbjct: 81  RVCYTSSENEPARTTSFVEVNEMTLEKKTRRIFTGWMFADSPGLNAVEHSIYDVWLKDCK 140

Query: 123 DPI 125
              
Sbjct: 141 KSS 143


>gi|312116102|ref|YP_004013698.1| hypothetical protein Rvan_3418 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311221231|gb|ADP72599.1| Protein of unknown function DUF2155 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 145

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 46/133 (34%), Positives = 73/133 (54%)

Query: 7   LLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCY 66
           +L    + +    A++ R AN  A FA +DK+TGRV   ++ + ++  FG+L I P  CY
Sbjct: 13  VLAGLALVAPGTPASADRIANSTAVFAALDKVTGRVQPLEIPMGRTVTFGALTITPRACY 72

Query: 67  SRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPIN 126
           +R   E     AF+ + E+  D     IF+GW FA+SP ++A++H  +D+WL  CK P  
Sbjct: 73  TRPSTETPLTSAFIEVDEVVLDGSSHRIFTGWTFAESPGLHAVEHPTFDVWLTSCKTPSA 132

Query: 127 DSISNSESISKKA 139
           D  +   S + K 
Sbjct: 133 DISAGRRSNAPKP 145


>gi|115525001|ref|YP_781912.1| hypothetical protein RPE_2995 [Rhodopseudomonas palustris BisA53]
 gi|115518948|gb|ABJ06932.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 308

 Score =  177 bits (449), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 55/147 (37%), Positives = 80/147 (54%), Gaps = 1/147 (0%)

Query: 22  SARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVS 81
           + +  NK A F+G+DKITGR++ FD +I ++ QFG+L +K   CY+R   EA   DAFV 
Sbjct: 161 AQKIVNKKAVFSGLDKITGRIINFDADIGETVQFGALRVKTDACYTRPSTEATNTDAFVE 220

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALS 141
           + EI     V+ IFSGWMFA SP ++ I+H IYDIWL  CK P     +  E+  K   +
Sbjct: 221 VDEITLQGEVKRIFSGWMFAASPGLHGIEHPIYDIWLTDCKGPETVVAAQPEA-PKPPPA 279

Query: 142 EYSSTDITSQGSEKSSGSSSNKTLEKE 168
           +  +     +   +    S  +     
Sbjct: 280 QKRAPKQQPRPQPQVYPQSPPQNPLPP 306


>gi|121602347|ref|YP_988869.1| hypothetical protein BARBAKC583_0556 [Bartonella bacilliformis
           KC583]
 gi|120614524|gb|ABM45125.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 132

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 48/118 (40%), Positives = 76/118 (64%)

Query: 5   VLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMV 64
           V L+ +  V        + R +N +A F+G+DKITGR   F+V I++  QFG+L + P +
Sbjct: 15  VFLMGMVGVLLWVGNMQAKRVSNTIAVFSGLDKITGRTTRFEVPIDRVYQFGALQVTPRI 74

Query: 65  CYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           CY+  + E  R  +F+ ++E+  D+  + IF+GW+FADSP +NA++H IYD+WL  CK
Sbjct: 75  CYTSSEDEPARPASFIEVNEVTLDKKTQRIFTGWIFADSPGLNAVEHPIYDVWLKDCK 132


>gi|209885432|ref|YP_002289289.1| hypothetical protein OCAR_6311 [Oligotropha carboxidovorans OM5]
 gi|209873628|gb|ACI93424.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 297

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 53/114 (46%), Positives = 76/114 (66%)

Query: 22  SARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVS 81
           + +  NK A F+G+DKITGR++TFD +I ++ QFG+L +K   CY+R   EA   DAFV 
Sbjct: 148 AIKIPNKKAVFSGLDKITGRIITFDQDIGETVQFGALRVKTDACYTRPATEAANTDAFVE 207

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESI 135
           + EI     V+ IFSGWMFA SP ++A++H IYD+WL+ CK P     + +E +
Sbjct: 208 VDEITLQNEVKRIFSGWMFAASPGLHAVEHPIYDVWLIDCKSPEQPVTAQNEPV 261


>gi|298291312|ref|YP_003693251.1| hypothetical protein Snov_1322 [Starkeya novella DSM 506]
 gi|296927823|gb|ADH88632.1| Protein of unknown function DUF2155 [Starkeya novella DSM 506]
          Length = 233

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 69/110 (62%)

Query: 22  SARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVS 81
             +  NK A F+G+DKITGR+++FDV +N++ QFG+L I P  CY+R + E Q    FV 
Sbjct: 120 EQKIENKTAVFSGLDKITGRIISFDVSVNETVQFGALRITPRACYTRPETEQQNTTGFVE 179

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISN 131
           + EI  D  V+ +F GWMFA SP ++ ++H IYD+WL  CK       S 
Sbjct: 180 VQEITLDGKVQPLFGGWMFASSPGLHGVEHPIYDVWLTDCKQTAPVIASP 229


>gi|319407121|emb|CBI80758.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 121

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 72/113 (63%)

Query: 11  FFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDD 70
             V     F  + R +N++  F G+DKITG+V +F+V I Q  Q+G+L + P VCY+   
Sbjct: 1   MAVLFTVSFLQAERISNEIVIFTGLDKITGQVTSFEVHIGQVYQYGALQVIPRVCYTSSK 60

Query: 71  REAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
            E  R  +F+ +SE+  ++  R IF+GWMFADSP +NA++H IYD+WL  CK 
Sbjct: 61  NEPARTTSFIEVSEMTLEKKTRRIFTGWMFADSPGLNAVEHPIYDVWLKDCKK 113


>gi|217976383|ref|YP_002360530.1| hypothetical protein Msil_0187 [Methylocella silvestris BL2]
 gi|217501759|gb|ACK49168.1| conserved hypothetical protein [Methylocella silvestris BL2]
          Length = 240

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 55/170 (32%), Positives = 85/170 (50%), Gaps = 9/170 (5%)

Query: 19  FANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDA 78
            A + R  + +A F+G+DKITGR++TF+V  +++ QFG+L I    CY+R   EA +   
Sbjct: 34  PAQADRIKHPIAVFSGLDKITGRIITFEVATDETVQFGTLQITERACYTRPATEAPQTTT 93

Query: 79  FVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKK 138
           FV + E+      + IFSGWMFA SP ++ I+H IYDIWL  CK            +S  
Sbjct: 94  FVEVDEVDAKNDYKRIFSGWMFAASPGLHGIEHPIYDIWLTDCK------GGKEIVVSPS 147

Query: 139 ALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDLKGRPIQE 188
           A +E +     +        +   +   +    P++N     L   P Q+
Sbjct: 148 AAAEPTPPPPENASPTPKKATKPRRVQPQLPQPPVDNFGEAPL---PFQD 194


>gi|144898205|emb|CAM75069.1| conserved hypothetical protein, secreted [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 127

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 68/122 (55%)

Query: 2   KYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIK 61
           ++ +    L ++ + A    +   +  +A   G+DKIT RV+T +  + +  +FG+L + 
Sbjct: 4   RWSIAGAALLWLTAPAIAQQAPELSLDMAVLGGLDKITARVVTIEAPVGEPVRFGTLEVV 63

Query: 62  PMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
              C  R   E+    AF+ I +I   +  + +F GWMFA SPA++A++H +YD+W++ C
Sbjct: 64  ARACKKRRPEESPESAAFLDIWDIKQGQPAQGVFRGWMFASSPALSAMEHPVYDVWVLDC 123

Query: 122 KD 123
           + 
Sbjct: 124 RK 125


>gi|85716172|ref|ZP_01047147.1| hypothetical protein NB311A_05700 [Nitrobacter sp. Nb-311A]
 gi|85697005|gb|EAQ34888.1| hypothetical protein NB311A_05700 [Nitrobacter sp. Nb-311A]
          Length = 306

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 57/132 (43%), Positives = 77/132 (58%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A + +  NK A F+G+DKITGR++ FD +I ++ QFG+L +K   CY+R   EA   DAF
Sbjct: 144 APAEKVINKKAVFSGLDKITGRIIHFDEDIGETVQFGALRVKTDACYTRPATEAANTDAF 203

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKA 139
           V + EI     V+ IFSGWMFA SP ++ ++H IYD+WL  CKDP    I+      K  
Sbjct: 204 VEVDEITLQGEVKRIFSGWMFAASPGLHGVEHPIYDVWLTDCKDPETTVIAAQPDQPKPP 263

Query: 140 LSEYSSTDITSQ 151
                S   T Q
Sbjct: 264 PPARRSRQSTRQ 275


>gi|299133762|ref|ZP_07026956.1| Protein of unknown function DUF2155 [Afipia sp. 1NLS2]
 gi|298591598|gb|EFI51799.1| Protein of unknown function DUF2155 [Afipia sp. 1NLS2]
          Length = 306

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 53/113 (46%), Positives = 74/113 (65%)

Query: 22  SARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVS 81
           + +  NK A F+G+DKITGR++TFD +I ++ QFG+L +K   CY+R   EA   DAFV 
Sbjct: 153 AVKIPNKKAVFSGLDKITGRIITFDEDIGETVQFGALRVKTDACYTRPATEAANTDAFVE 212

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSES 134
           + EI     V+ IFSGWMFA SP ++A++H IYD+WL  CK P     + +E 
Sbjct: 213 VDEITLQNEVKRIFSGWMFAASPGLHAVEHPIYDVWLTDCKGPEQPVTAQNEP 265


>gi|90424380|ref|YP_532750.1| hypothetical protein RPC_2883 [Rhodopseudomonas palustris BisB18]
 gi|90106394|gb|ABD88431.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 309

 Score =  174 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 51/127 (40%), Positives = 79/127 (62%), Gaps = 3/127 (2%)

Query: 22  SARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVS 81
           + +  NK A F+G+DKITGR++ FD +I ++ QFG+L +K   CY+R   EA   DAFV 
Sbjct: 160 AQKIVNKKASFSGLDKITGRIINFDADIGETVQFGALRVKTDACYTRPATEAANTDAFVE 219

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSI---SNSESISKK 138
           + EI     V+ IFSGWMFA SP ++ ++H IYDIWL  CK P    +    +++ ++ +
Sbjct: 220 VDEITLQGEVKRIFSGWMFAASPGLHGVEHPIYDIWLTDCKGPETTVVAAQPDAKPVAAQ 279

Query: 139 ALSEYSS 145
              + ++
Sbjct: 280 PAQKRAA 286


>gi|182678917|ref|YP_001833063.1| hypothetical protein Bind_1951 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182634800|gb|ACB95574.1| conserved hypothetical protein [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 247

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 52/144 (36%), Positives = 79/144 (54%), Gaps = 9/144 (6%)

Query: 16  HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQR 75
              FA + R  + +A F+G+DKITGR+++F+V  +++ QFGSL I    CY+R   E  +
Sbjct: 26  PCGFARADRIKHPIAVFSGLDKITGRIISFEVATDETVQFGSLQITERACYTRPSTETPQ 85

Query: 76  IDAFVSISEIFT---DRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD-----PIND 127
              FV + EI      +  + IF+GWMFA SP ++A++H +YDIWL  CK      P  D
Sbjct: 86  TITFVEVDEIDAADKTKTPKQIFAGWMFAASPGLHALEHPVYDIWLNDCKGGKEVLPSPD 145

Query: 128 SISNSESISKKALSEYSSTDITSQ 151
           + +   +    A  E S  D +  
Sbjct: 146 TAAGLPATPDNA-KEASDIDPSEA 168


>gi|316934413|ref|YP_004109395.1| hypothetical protein Rpdx1_3081 [Rhodopseudomonas palustris DX-1]
 gi|315602127|gb|ADU44662.1| Protein of unknown function DUF2155 [Rhodopseudomonas palustris
           DX-1]
          Length = 324

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 76/118 (64%)

Query: 22  SARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVS 81
           + +  NK A F G+DKITGR ++FD +I ++ QFG+L +K   CY+R   EA   DAFV 
Sbjct: 161 AQKIVNKKASFTGLDKITGRTISFDADIGETVQFGALRVKTDACYTRPSTEATNTDAFVE 220

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKA 139
           + EI     V+ IFSGWMFA SP ++A++H IYDIWL  CK P   ++++++    K 
Sbjct: 221 VDEITLQGEVKRIFSGWMFAASPGLHAVEHPIYDIWLTDCKGPETPNVASAQPEPPKP 278


>gi|92117356|ref|YP_577085.1| hypothetical protein Nham_1811 [Nitrobacter hamburgensis X14]
 gi|91800250|gb|ABE62625.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 306

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 50/109 (45%), Positives = 72/109 (66%)

Query: 22  SARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVS 81
           + +  NK A F+G+DKITGR++ FD ++ ++ QFG+L +K   CY+R   EA   DAFV 
Sbjct: 145 AQKVINKKAVFSGLDKITGRIIHFDEDVGETVQFGALRVKTDACYTRPATEAANTDAFVE 204

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           + EI     V+ IFSGWMFA SP ++ ++H +YD+WL  CKDP    I+
Sbjct: 205 VDEITLQGEVKRIFSGWMFAASPGLHGVEHPVYDVWLTDCKDPETTVIA 253


>gi|154247423|ref|YP_001418381.1| hypothetical protein Xaut_3495 [Xanthobacter autotrophicus Py2]
 gi|154161508|gb|ABS68724.1| conserved hypothetical protein [Xanthobacter autotrophicus Py2]
          Length = 228

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 47/112 (41%), Positives = 71/112 (63%)

Query: 22  SARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVS 81
           + + AN  A +AG+DKITGR+  FDV I ++AQFG+L + P VCY+R   E Q   +F  
Sbjct: 117 TQKIANAFAVYAGLDKITGRITAFDVAIGETAQFGALQVTPRVCYTRPATETQNTTSFTE 176

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSE 133
           ++E+      + IF+GWMFA SP ++A++H IYD+WL+ CK     +    +
Sbjct: 177 VNEVTLQGQAKRIFTGWMFASSPGLHAVEHPIYDVWLIGCKALAPVTARGQQ 228


>gi|192291083|ref|YP_001991688.1| hypothetical protein Rpal_2704 [Rhodopseudomonas palustris TIE-1]
 gi|192284832|gb|ACF01213.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 329

 Score =  170 bits (432), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 54/109 (49%), Positives = 73/109 (66%)

Query: 22  SARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVS 81
           + +  NK A FAG+DKITGR + FD +I ++ QFG+L +K   CY+R   EA   DAFV 
Sbjct: 164 AQKIVNKKASFAGLDKITGRTINFDADIGETVQFGALRVKTDACYTRPSTEAANTDAFVE 223

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           + EI     V+ IFSGWMFA SP ++A++H IYDIWL  CKDP   +++
Sbjct: 224 VDEITLQGEVKRIFSGWMFAASPGLHAVEHPIYDIWLTDCKDPETSNVA 272


>gi|39935492|ref|NP_947768.1| hypothetical protein RPA2426 [Rhodopseudomonas palustris CGA009]
 gi|39649344|emb|CAE27867.1| hypothetical protein RPA2426 [Rhodopseudomonas palustris CGA009]
          Length = 329

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 54/109 (49%), Positives = 73/109 (66%)

Query: 22  SARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVS 81
           + +  NK A FAG+DKITGR + FD +I ++ QFG+L +K   CY+R   EA   DAFV 
Sbjct: 164 AQKIVNKKASFAGLDKITGRTINFDADIGETVQFGALRVKTDACYTRPSTEAANTDAFVE 223

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           + EI     V+ IFSGWMFA SP ++A++H IYDIWL  CKDP   +++
Sbjct: 224 VDEITLQGEVKRIFSGWMFAASPGLHAVEHPIYDIWLTDCKDPETSNVA 272


>gi|86750143|ref|YP_486639.1| hypothetical protein RPB_3026 [Rhodopseudomonas palustris HaA2]
 gi|86573171|gb|ABD07728.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 326

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 53/109 (48%), Positives = 71/109 (65%)

Query: 22  SARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVS 81
           + +  NK A F G+DKITGR + FD +I ++ QFG+L +K   CY+R   EA   DAFV 
Sbjct: 178 AQKIVNKKASFTGLDKITGRTINFDADIGETVQFGALRVKTDACYTRPSTEAANTDAFVE 237

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           + EI     V+ IFSGWMFA SP ++A++H IYDIWL  CK+P    +S
Sbjct: 238 VDEITLQGEVKRIFSGWMFAASPGLHAVEHPIYDIWLTDCKNPETPVVS 286


>gi|148255598|ref|YP_001240183.1| hypothetical protein BBta_4221 [Bradyrhizobium sp. BTAi1]
 gi|146407771|gb|ABQ36277.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 316

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 53/120 (44%), Positives = 75/120 (62%)

Query: 22  SARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVS 81
           + +  NK A F+G+DKITGR++ FD +I ++ QFG+L +K   CY+R   EA   DAFV 
Sbjct: 151 AQKIVNKKASFSGLDKITGRIINFDEDIGETVQFGALRVKTDACYTRPATEAANTDAFVQ 210

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALS 141
           + EI     V+ IFSGWMFA SP ++ ++H IYDIWL+ CK+P    +S +      A  
Sbjct: 211 VDEITLQGEVKRIFSGWMFAASPGLHGVEHPIYDIWLVDCKEPQTTVVSTAPDQKPAAQQ 270


>gi|91976894|ref|YP_569553.1| hypothetical protein RPD_2422 [Rhodopseudomonas palustris BisB5]
 gi|91683350|gb|ABE39652.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 316

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 53/119 (44%), Positives = 78/119 (65%), Gaps = 1/119 (0%)

Query: 22  SARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVS 81
           + +  NK A F G+DKITGR ++FD +I ++ QFG+L +K   CY+R   EA   DAFV 
Sbjct: 168 AQKIVNKKASFTGLDKITGRTISFDADIGETVQFGALRVKTDACYTRPSTEAANTDAFVE 227

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKAL 140
           + EI     V+ I+SGWMFA SP ++A++H IYDIWL  CK+P   ++ N++  + K +
Sbjct: 228 VDEITLQGEVKRIYSGWMFAASPGLHAVEHPIYDIWLTDCKNPET-TVVNAQPEAPKPV 285


>gi|154253733|ref|YP_001414557.1| cellulase-like protein [Parvibaculum lavamentivorans DS-1]
 gi|154157683|gb|ABS64900.1| cellulase-like protein [Parvibaculum lavamentivorans DS-1]
          Length = 135

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 47/131 (35%), Positives = 70/131 (53%), Gaps = 5/131 (3%)

Query: 6   LLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVC 65
           L      +   A  A + ++   VA F+G+DK T RV +F V++++ AQFGSL +    C
Sbjct: 7   LAAASAILCLSAAPAFADKY--PVAVFSGLDKTTARVTSFSVKVDEPAQFGSLEVLVRAC 64

Query: 66  YSRDDREAQRIDAFVSISEIFTDRI---VRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
             R   E  +  AF+ I +I  D        IF GWMFA+SP +N ++H +YDIW+  CK
Sbjct: 65  DKRPPEEPPQTAAFLEIRQIDRDDDSVQPAPIFEGWMFAESPGLNGLEHPVYDIWVTDCK 124

Query: 123 DPINDSISNSE 133
                + + SE
Sbjct: 125 TASGGASTGSE 135


>gi|27379396|ref|NP_770925.1| hypothetical protein blr4285 [Bradyrhizobium japonicum USDA 110]
 gi|27352547|dbj|BAC49550.1| blr4285 [Bradyrhizobium japonicum USDA 110]
          Length = 360

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 50/109 (45%), Positives = 71/109 (65%)

Query: 22  SARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVS 81
           + +  NK A F+G+DKITGR++ FD +I ++ QFG+L +K   CY+R   EA   DAFV 
Sbjct: 188 AQKIVNKKATFSGLDKITGRIINFDEDIGETVQFGALRVKTDACYTRPATEAANTDAFVE 247

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           + EI     V+ IFSGWM+A SP ++ ++H IYDIWL  CK+P     +
Sbjct: 248 VDEITLQGEVKRIFSGWMYAASPGLHGVEHPIYDIWLTDCKEPQQTIAT 296


>gi|323137691|ref|ZP_08072767.1| Protein of unknown function DUF2155 [Methylocystis sp. ATCC 49242]
 gi|322396988|gb|EFX99513.1| Protein of unknown function DUF2155 [Methylocystis sp. ATCC 49242]
          Length = 256

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 49/190 (25%), Positives = 91/190 (47%), Gaps = 19/190 (10%)

Query: 3   YRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKP 62
           +R    +    F+ +  A +    +  A FAG+DK TGR++ FDV I+++ QFG+L + P
Sbjct: 5   FRFGAALGVAGFALSGVAVAEPIRHPTATFAGLDKTTGRIINFDVAIDETVQFGALQVTP 64

Query: 63  MVCYSRDDREAQRIDAFVSISEIFT-------------------DRIVRSIFSGWMFADS 103
            VC +R   E  +  +FV + E+                      +  + IFSGWMFA S
Sbjct: 65  RVCNTRPQTETPQTTSFVEVDELILKPERQGRPEAKPEQAKTDGKQEAKRIFSGWMFAAS 124

Query: 104 PAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNK 163
           P ++ ++H +YD+WL+ CK     + + + + ++ + +  ++      G ++ S      
Sbjct: 125 PGLHGVEHPVYDVWLVDCKGGKESAPAPAAAAAEPSAAPDAAAPAAETGKKRRSRKVEPA 184

Query: 164 TLEKESSQPL 173
                 +QP+
Sbjct: 185 APAPVENQPI 194


>gi|146340455|ref|YP_001205503.1| putative signal peptide [Bradyrhizobium sp. ORS278]
 gi|146193261|emb|CAL77277.1| conserved hypothetical protein; putative signal peptide
           [Bradyrhizobium sp. ORS278]
          Length = 321

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 54/112 (48%), Positives = 74/112 (66%)

Query: 22  SARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVS 81
           + +  NK A F+G+DKITGR++ FD EI ++ QFG+L +K   CY+R   EA   DAFV 
Sbjct: 153 AQKIVNKKASFSGLDKITGRIINFDEEIGETVQFGALRVKTDACYTRPASEAANTDAFVQ 212

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSE 133
           + EI     V+ IFSGWMFA SP ++ ++H IYDIWL+ CK+P N   S + 
Sbjct: 213 VDEITLQGEVKRIFSGWMFAASPGLHGVEHPIYDIWLVDCKEPQNTVASAAP 264


>gi|307295108|ref|ZP_07574950.1| Protein of unknown function DUF2155 [Sphingobium chlorophenolicum
           L-1]
 gi|306879582|gb|EFN10800.1| Protein of unknown function DUF2155 [Sphingobium chlorophenolicum
           L-1]
          Length = 218

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 36/150 (24%), Positives = 62/150 (41%), Gaps = 4/150 (2%)

Query: 25  FANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREA-QRIDAFVSIS 83
              +VA    ++K  G      ++  ++ + G  I++   C +    E  Q   AFV + 
Sbjct: 56  MNERVAVIGLLNKRNGITTDLQMKPGEALRVGDAIVRLQACETTAPWENVQETGAFVQLD 115

Query: 84  EI-FTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSE 142
                D   R  FSGW+F + P  N + H IYD+W+  C     ++  ++  +  K   E
Sbjct: 116 VRSTADNKWRRNFSGWLFRERPDRNVVQHPIYDVWVRSCTMSWPETGPDTVKLGDKG--E 173

Query: 143 YSSTDITSQGSEKSSGSSSNKTLEKESSQP 172
            S+             +SS +T E  +S P
Sbjct: 174 ASAGGPAQASPASGENASSAQTPEPPASTP 203


>gi|288958846|ref|YP_003449187.1| hypothetical protein AZL_020050 [Azospirillum sp. B510]
 gi|288911154|dbj|BAI72643.1| hypothetical protein AZL_020050 [Azospirillum sp. B510]
          Length = 134

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 33/115 (28%), Positives = 56/115 (48%)

Query: 7   LLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCY 66
             +L  +   A    +       A+   +DK+T R  TF + + ++    SL I    C 
Sbjct: 18  ATLLASLAGQAAPVPTQMIERPAAKLQWLDKVTARTSTFTMRVGETKAMSSLRITLRACR 77

Query: 67  SRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
                E     AF+ ++EI        +FSGWMF+ SPA++A+++ IYD+W++ C
Sbjct: 78  ENPPIETPESAAFLEVTEIKPGEQAEQVFSGWMFSSSPALSAMENPIYDVWVLGC 132


>gi|114569813|ref|YP_756493.1| hypothetical protein Mmar10_1263 [Maricaulis maris MCS10]
 gi|114340275|gb|ABI65555.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 158

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 38/101 (37%), Positives = 54/101 (53%), Gaps = 5/101 (4%)

Query: 27  NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIF 86
             V    G+DK+T R   F+VEI  + QFG+L I    C  R   E     AF+ I++  
Sbjct: 57  GTVVVLRGLDKVTARTRDFEVEIGDTVQFGALSITAQYCRKRPPEETPETYAFLQINDRR 116

Query: 87  TDR-----IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           TD          +FSGWMFA  PA N ++H +YD+W++ C+
Sbjct: 117 TDGFGVDVEGEQVFSGWMFASRPAQNPLEHPVYDVWVIDCR 157


>gi|296447987|ref|ZP_06889893.1| Protein of unknown function DUF2155 [Methylosinus trichosporium
           OB3b]
 gi|296254497|gb|EFH01618.1| Protein of unknown function DUF2155 [Methylosinus trichosporium
           OB3b]
          Length = 236

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 52/152 (34%), Positives = 79/152 (51%), Gaps = 7/152 (4%)

Query: 25  FANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISE 84
             +  A FAG+DK TGR++ FDV I+++ QFGSL I P VC +R   EA +  +FV + +
Sbjct: 33  IRHPTAVFAGLDKTTGRIINFDVAIDETVQFGSLQITPRVCNTRPQTEAPQTTSFVEVDD 92

Query: 85  IFT-DRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSEY 143
                   + IFSGWMFA SP ++ ++HS+YD+WL  CK          ++ +    +  
Sbjct: 93  QDPAKNEAKRIFSGWMFAASPGLHGVEHSVYDVWLTDCK----GGKEIVQAPASAEPAAA 148

Query: 144 SSTDITSQGSEKSSGSSSNKTLEKESSQPLEN 175
                T    EK    S  + +E  +  P+E 
Sbjct: 149 DPAAATPAPVEKKRSRS--RKVEPVAPTPIEA 178


>gi|83858504|ref|ZP_00952026.1| hypothetical protein OA2633_03356 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853327|gb|EAP91179.1| hypothetical protein OA2633_03356 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 157

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 36/102 (35%), Positives = 55/102 (53%), Gaps = 5/102 (4%)

Query: 27  NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIF 86
             V    G+DK+T R   F+  I +  +FG+L I    C  R   E   + AF+ I +  
Sbjct: 56  GSVVVLRGLDKVTARTRDFEAPIGEEVRFGALSITVPYCRKRPPEEPPEVYAFLEIEDRR 115

Query: 87  TDR-----IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
           TD          +FSGWMFA +PA+NA++H +YD+W++ C+ 
Sbjct: 116 TDGFGVQAEGELMFSGWMFASNPALNALEHPVYDVWVIDCRS 157


>gi|260426797|ref|ZP_05780776.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260421289|gb|EEX14540.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 119

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 41/121 (33%), Positives = 60/121 (49%), Gaps = 4/121 (3%)

Query: 4   RVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           R L L L  + + A  A  A  +   A   G+DK+TGR    ++   Q+AQFG + I   
Sbjct: 3   RALALSLC-LSATALSAQEATSSGSGAVLRGLDKLTGRASDIELGTGQTAQFGRIEISLA 61

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
            C      +A    AF+++ E          F GWM A SPA+NA+DH  YD+W+++C  
Sbjct: 62  ECRYPVGNQAGDAFAFLTVREA---GHPDPAFRGWMVASSPALNAMDHQRYDVWVLRCTS 118

Query: 124 P 124
            
Sbjct: 119 S 119


>gi|294084611|ref|YP_003551369.1| cellulase-like protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664184|gb|ADE39285.1| cellulase-like protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 139

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 64/121 (52%), Gaps = 2/121 (1%)

Query: 4   RVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           +++   +    S+A    +     K+    G+DKIT R+ T    I+   +FG+L +   
Sbjct: 17  KIIFAAMVLYVSYAMPVAAEWIDGKIVVLQGLDKITARITTLTTAIDTPLRFGTLQLTVN 76

Query: 64  VCYSRDDREAQRIDAFVSISEIFTD--RIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
            C  R   E     AF++I +   D     +S+F+GWMF+ SPA++A++H +YDI L+ C
Sbjct: 77  RCAFRPPEEPPENVAFLTILDRGHDLSLAPKSVFTGWMFSSSPAVSAMEHPVYDITLLSC 136

Query: 122 K 122
           +
Sbjct: 137 R 137


>gi|83593772|ref|YP_427524.1| cellulase-like protein [Rhodospirillum rubrum ATCC 11170]
 gi|83576686|gb|ABC23237.1| cellulase-like protein [Rhodospirillum rubrum ATCC 11170]
          Length = 163

 Score =  155 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 37/142 (26%), Positives = 61/142 (42%)

Query: 10  LFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRD 69
           L  + +    A +       A    +DK T RV    + +    + GSL I    C  R 
Sbjct: 19  LCLMLAATAPAGAEDINADTARLGWLDKTTARVGESSIAVGGDLRLGSLTITVRSCVRRV 78

Query: 70  DREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSI 129
             +     AF+ I E       + IF GWMFA SP+++A+DH++YD+W+++C+ P +   
Sbjct: 79  PPDDPESAAFLDIVERAEGVAAKQIFEGWMFASSPSLSAMDHAVYDVWVLRCEIPADRDA 138

Query: 130 SNSESISKKALSEYSSTDITSQ 151
            +S        +     D    
Sbjct: 139 GDSGKPESAPEAAPIPVDPGGA 160


>gi|255263053|ref|ZP_05342395.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255105388|gb|EET48062.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 119

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 3/120 (2%)

Query: 4   RVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           R +  ++      A        A   A    +DKITGRV   +++   +A+ G L +   
Sbjct: 3   RFVSAMILLCALAAPVGAQQVTAGSGAMLRILDKITGRVADVELDTGGTARQGRLSVTLA 62

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
            C       +    A +++ E         +F GWM A +PA+NA++H  YD+W+M+CK 
Sbjct: 63  ECRYPSGNRSGNAYALLTVIEA---GTPDPVFRGWMIASAPALNAMEHPRYDVWVMRCKS 119


>gi|83311840|ref|YP_422104.1| hypothetical protein amb2741 [Magnetospirillum magneticum AMB-1]
 gi|82946681|dbj|BAE51545.1| Uncharacterized protein [Magnetospirillum magneticum AMB-1]
          Length = 167

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 35/102 (34%), Positives = 57/102 (55%)

Query: 21  NSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
           + A  +   A   G+DK+T RV+T +  +      G+L I    C  R   +     AF+
Sbjct: 61  SGADLSFDTAVLQGLDKVTARVVTVEAPVGAPVHVGALEIIVRACKKRRPEDQPESAAFL 120

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            I E+  D+   ++F GWMFA SPA++A++H +YDIW++ C+
Sbjct: 121 DIWELHKDQPASALFRGWMFASSPALSAMEHPVYDIWVLDCR 162


>gi|114799292|ref|YP_760947.1| hypothetical protein HNE_2252 [Hyphomonas neptunium ATCC 15444]
 gi|114739466|gb|ABI77591.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 184

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 43/174 (24%), Positives = 68/174 (39%), Gaps = 20/174 (11%)

Query: 4   RVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           R L L    V +    + S       A    +DKITGR     V++ +   +GSL +   
Sbjct: 6   RFLALASLSVLAALPASASTMAQKNEATLRALDKITGRSTDIVVKVGEPVVYGSLRVDLK 65

Query: 64  VCYSRDDREAQRIDAFVSI------------------SEIFTDRIVRSIFSGWMFADSPA 105
            CY     E     AF+ I                      ++     +FSGWM+A SP 
Sbjct: 66  ACYQAPPEEVPESAAFLRIASTQPVAVETMEAAVAAKDVPPSEADSPILFSGWMYASSPG 125

Query: 106 MNAIDHSIYDIWLMQCKDPINDSISNSE--SISKKALSEYSSTDITSQGSEKSS 157
           +NA++H +YDIW+++C  P    +        S++ L E     +T   +    
Sbjct: 126 LNALEHPVYDIWVIRCTAPDPVKLPERAIIPESEEPLYEDMPAGVTESETPPDE 179


>gi|254459519|ref|ZP_05072935.1| conserved hypothetical protein [Rhodobacterales bacterium HTCC2083]
 gi|206676108|gb|EDZ40595.1| conserved hypothetical protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 120

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 57/122 (46%), Gaps = 3/122 (2%)

Query: 3   YRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKP 62
                L   F+ + A  A  A  +   AE   +DK++G+   +D+      + G L I  
Sbjct: 2   RFFNALAGLFLCASAVHAQQAVSSGTGAELRVLDKVSGQSSNYDLASGSKMEIGQLTIAL 61

Query: 63  MVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
             C   +   A    A++ ++E         IF GWM A SPA+NA++H  YD+W+++CK
Sbjct: 62  RACRYPEGAPANDAFAYIEVNE---TESATGIFGGWMIASSPALNAMEHPRYDVWVLRCK 118

Query: 123 DP 124
             
Sbjct: 119 TS 120


>gi|260575570|ref|ZP_05843568.1| conserved hypothetical protein [Rhodobacter sp. SW2]
 gi|259022213|gb|EEW25511.1| conserved hypothetical protein [Rhodobacter sp. SW2]
          Length = 145

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 46/147 (31%), Positives = 69/147 (46%), Gaps = 11/147 (7%)

Query: 7   LLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCY 66
           LL+L  + S A  A              +DK++G     ++   QSA  G L I+   C 
Sbjct: 4   LLLLAVLASPA--AAQEVADAPGGILRWLDKVSGETADIELSRGQSAVSGRLTIQLDACR 61

Query: 67  SRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPIN 126
              D  A    A ++I+E   D++   +FSGWM A SPA++A+DH  YD+W+++C  P  
Sbjct: 62  YPVDNPASNAFAHLTITE---DKVATPVFSGWMVAASPALSALDHRRYDVWVLRCITPTT 118

Query: 127 DSISNSE------SISKKALSEYSSTD 147
           D I   E      +    AL E +  D
Sbjct: 119 DQIEVPEDAPVEDAAEPPALPEDAPVD 145


>gi|83949686|ref|ZP_00958419.1| hypothetical protein ISM_01290 [Roseovarius nubinhibens ISM]
 gi|83837585|gb|EAP76881.1| hypothetical protein ISM_01290 [Roseovarius nubinhibens ISM]
          Length = 129

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 54/107 (50%), Gaps = 3/107 (2%)

Query: 17  AKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRI 76
              A  A    + A    +DK+ G V   ++    SA+FG L I    C   +   A   
Sbjct: 24  VSAAQEAASLGQGAILRALDKVNGSVTDLELGNASSARFGRLTINLGECRFPEGDPAGDA 83

Query: 77  DAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
            AF++I E   D   +  FSGWM A SPA++A+DH  YD+W+M+CK 
Sbjct: 84  YAFLTIQE---DGQTQPQFSGWMIASSPALSALDHPRYDVWVMRCKT 127


>gi|149201009|ref|ZP_01877984.1| hypothetical protein RTM1035_15327 [Roseovarius sp. TM1035]
 gi|149145342|gb|EDM33368.1| hypothetical protein RTM1035_15327 [Roseovarius sp. TM1035]
          Length = 111

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 39/113 (34%), Positives = 57/113 (50%), Gaps = 3/113 (2%)

Query: 10  LFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRD 69
           +  + +    A       + A   G+DKI G     ++   QS  FGSL +    C    
Sbjct: 1   MLCLGAGVGTAQEVAAVAQGALLRGLDKINGSAQDLELANGQSGVFGSLDVVLGECRYPQ 60

Query: 70  DREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           D  A    A+++ISE     +   IFSGWM A SPA+NA++H  YDIW+++CK
Sbjct: 61  DDPAADAYAYLTISEQAGGAV---IFSGWMLASSPALNALEHPRYDIWVLRCK 110


>gi|126732550|ref|ZP_01748348.1| hypothetical protein SSE37_10642 [Sagittula stellata E-37]
 gi|126706996|gb|EBA06064.1| hypothetical protein SSE37_10642 [Sagittula stellata E-37]
          Length = 124

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 52/122 (42%), Gaps = 3/122 (2%)

Query: 2   KYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIK 61
           K   + ++       A  A     +   A   G+DK+  +V  F +   ++   G L + 
Sbjct: 5   KAFQVAVLAALCLGGAAQAQEEVNSGTGAVLRGLDKLNAKVADFTLSNGENHVMGLLEVV 64

Query: 62  PMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
              C            AF++I E     + + +F GWM A SPA+  +DH  YD+W+++C
Sbjct: 65  LRECRYPVGDPTGNAYAFLTIREA---GVAQPVFEGWMVASSPALYPLDHPRYDVWVLRC 121

Query: 122 KD 123
             
Sbjct: 122 TT 123


>gi|114767025|ref|ZP_01445933.1| hypothetical protein 1100011001191_R2601_18438 [Pelagibaca
           bermudensis HTCC2601]
 gi|114540809|gb|EAU43873.1| hypothetical protein R2601_18438 [Roseovarius sp. HTCC2601]
          Length = 119

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 33/104 (31%), Positives = 50/104 (48%), Gaps = 3/104 (2%)

Query: 21  NSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
             A      A   G+DK+TGR    ++   ++AQF    I    C   +   A    AF+
Sbjct: 19  QEATNTGTGAVLRGLDKLTGRAYDIEMRAGETAQFARTEISLQECRYPEGDPAGDAFAFL 78

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
           ++ E         +F GWM A SPA+NA+DH  YD+W+++C   
Sbjct: 79  TVREA---GNAEPVFRGWMIASSPALNAMDHQRYDVWVLRCTTS 119


>gi|83954273|ref|ZP_00962993.1| hypothetical protein NAS141_18244 [Sulfitobacter sp. NAS-14.1]
 gi|83841310|gb|EAP80480.1| hypothetical protein NAS141_18244 [Sulfitobacter sp. NAS-14.1]
          Length = 141

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 57/121 (47%), Gaps = 5/121 (4%)

Query: 4   RVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           R +L++L  + +  +    A     +     +DK++G     ++   ++A+ G+L +   
Sbjct: 26  RKILMMLAIMAAPVQAQQVASAEGGI--LRALDKVSGVSRDVEMRRGETARVGNLNVTMN 83

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
            C       A    A + I E         +F+GWM A +PA++A++H  YDIW+++C  
Sbjct: 84  ECRYPSGNPAGDAYAELEIVE---TGDENRLFAGWMIASAPALSALEHPRYDIWVIRCTT 140

Query: 124 P 124
            
Sbjct: 141 S 141


>gi|163795175|ref|ZP_02189143.1| hypothetical protein BAL199_05889 [alpha proteobacterium BAL199]
 gi|159179573|gb|EDP64102.1| hypothetical protein BAL199_05889 [alpha proteobacterium BAL199]
          Length = 142

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 44/133 (33%), Positives = 62/133 (46%), Gaps = 3/133 (2%)

Query: 5   VLLLILFFVFSHAKFANSAR---FANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIK 61
            LLL +    S     ++         VA+  G+DK+T R+ T  V +  S  FG+L I 
Sbjct: 8   ALLLCVAIALSPQDAQSADEPDWLPRPVAKLQGLDKVTARISTVTVPVGDSVVFGTLHIT 67

Query: 62  PMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
              C       A    AF+ I +   D   R IF GWMFA SPA+N++DH +YD+W++ C
Sbjct: 68  AQTCQEHPPTLAPESAAFLIIEDQPPDEAPRRIFDGWMFASSPALNSVDHPVYDVWMLAC 127

Query: 122 KDPINDSISNSES 134
                   S S  
Sbjct: 128 SSDSTAGQSPSAG 140


>gi|163741338|ref|ZP_02148730.1| hypothetical protein RG210_17800 [Phaeobacter gallaeciensis 2.10]
 gi|161385691|gb|EDQ10068.1| hypothetical protein RG210_17800 [Phaeobacter gallaeciensis 2.10]
          Length = 120

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 55/121 (45%), Gaps = 4/121 (3%)

Query: 4   RVLLLILFFVFS-HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKP 62
           R+L  +L    S     A  A      A   G+DK+ G+    ++ +  SA+   +I+  
Sbjct: 2   RLLSAVLACGLSIGTASAQGAAENGSSAVLRGLDKVNGQTQDLEIPVGGSAEIFGVIVSL 61

Query: 63  MVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
             C    D       A++++            F GWM A SPA+NA+DHS YD+W+M+C 
Sbjct: 62  RECRYPADNPTGDAYAYLTVR---NPNDATVYFDGWMIASSPALNALDHSRYDVWVMRCT 118

Query: 123 D 123
            
Sbjct: 119 S 119


>gi|83943116|ref|ZP_00955576.1| hypothetical protein EE36_13083 [Sulfitobacter sp. EE-36]
 gi|83846124|gb|EAP84001.1| hypothetical protein EE36_13083 [Sulfitobacter sp. EE-36]
          Length = 117

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 5/121 (4%)

Query: 4   RVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           R +L++L  + +  +    A           +DK++G     ++   ++A+ G+L +   
Sbjct: 2   RKILMMLAIMAAPVQAQQVASAEG--GVLRALDKVSGVSRDVEMRRGETARVGNLNVTMN 59

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
            C       A    A + I E         +F+GWM A +PA++A++H  YDIW+++C  
Sbjct: 60  ECRYPSGNPAGDAYAELEIVE---TGDENRLFAGWMIASAPALSALEHPRYDIWVIRCTT 116

Query: 124 P 124
            
Sbjct: 117 S 117


>gi|163736132|ref|ZP_02143551.1| hypothetical protein RGBS107_13411 [Phaeobacter gallaeciensis
           BS107]
 gi|161390002|gb|EDQ14352.1| hypothetical protein RGBS107_13411 [Phaeobacter gallaeciensis
           BS107]
          Length = 120

 Score =  150 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 55/121 (45%), Gaps = 4/121 (3%)

Query: 4   RVLLLILFFVFS-HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKP 62
           R+L  +L    S     A  A      A   G+DK+ G+    ++ +  SA+   +I+  
Sbjct: 2   RLLSAVLACGLSIGTASAQGAADNGSSAVLRGLDKVNGQTQDLEIPVGGSAEIFGVIVSL 61

Query: 63  MVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
             C    D       A++++            F GWM A SPA+NA+DHS YD+W+M+C 
Sbjct: 62  RECRYPADNPTGDAYAYLTVR---NPNDATVYFDGWMIASSPALNALDHSRYDVWVMRCT 118

Query: 123 D 123
            
Sbjct: 119 S 119


>gi|86137322|ref|ZP_01055899.1| hypothetical protein MED193_05669 [Roseobacter sp. MED193]
 gi|85825657|gb|EAQ45855.1| hypothetical protein MED193_05669 [Roseobacter sp. MED193]
          Length = 133

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 30/109 (27%), Positives = 51/109 (46%), Gaps = 3/109 (2%)

Query: 21  NSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
                    A   G+DK+ G     +V+I  SA+   LI+    C            A++
Sbjct: 28  QVPAETGDSAVLRGLDKVNGHHTDIEVQIGGSAEIYGLIVTLTECRYPAANPTGDAYAYL 87

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSI 129
           +I +     +    F GWM A SPA++A+DH+ YD+W+++CK  + +  
Sbjct: 88  TIRDPLNGEV---FFDGWMIASSPALSALDHARYDVWVIRCKSSVGEGS 133


>gi|84499427|ref|ZP_00997715.1| hypothetical protein OB2597_05850 [Oceanicola batsensis HTCC2597]
 gi|84392571|gb|EAQ04782.1| hypothetical protein OB2597_05850 [Oceanicola batsensis HTCC2597]
          Length = 127

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 45/105 (42%), Gaps = 2/105 (1%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           A         A   G+DK+ G      V    +   G L I    C       A    AF
Sbjct: 25  AQEDVSVGTGAVLRGLDKMNGETRDVSVPSGTAVMVGKLSITMWECRYPAGNPAGDAYAF 84

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
           ++I+E         IFSGWM A SPA+NA+DH  YD+W++ C   
Sbjct: 85  MTITEPAKSSD--PIFSGWMVASSPALNALDHFRYDVWVLSCTTS 127


>gi|254511429|ref|ZP_05123496.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221535140|gb|EEE38128.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 119

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 31/112 (27%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 13  VFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE 72
           V +    A     +   A   G+DK++G+ L  ++   Q+     L +    C    +  
Sbjct: 11  VIATGATAQQKAESGPGAMLRGLDKVSGQTLDVEIRNGQTETVFGLDVALGDCRYPAENP 70

Query: 73  AQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
                A+++I E       + +F GWM A SPA+NA+DH+ YD+W+++C  P
Sbjct: 71  TGDAFAYLTIWE---QGKAQQLFDGWMVATSPALNALDHARYDVWVIRCMTP 119


>gi|260432985|ref|ZP_05786956.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416813|gb|EEX10072.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 119

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 52/99 (52%), Gaps = 3/99 (3%)

Query: 26  ANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEI 85
           +   A   G+DK++G+ +  +++  ++A    L +    C    +       AF++I E 
Sbjct: 24  SGAGAVLRGLDKVSGQTVDVEMQPGETASIFGLDVALGDCRYPTENPTGDAFAFLTIWEK 83

Query: 86  FTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
                   +F GWM A SPA+NA+DHS YD+W+++C  P
Sbjct: 84  ---GEAEQLFDGWMIATSPALNALDHSRYDVWVIRCITP 119


>gi|149916369|ref|ZP_01904889.1| hypothetical protein RAZWK3B_12282 [Roseobacter sp. AzwK-3b]
 gi|149809823|gb|EDM69675.1| hypothetical protein RAZWK3B_12282 [Roseobacter sp. AzwK-3b]
          Length = 121

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 4/107 (3%)

Query: 17  AKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRI 76
           A  A         A   G+DKI G  +   +   +SA+ G+L +    C       A   
Sbjct: 18  AASAQDVEI-GTGAALRGLDKINGDTVDMMLATGESAELGNLEVTLGECRYPAGDAASDA 76

Query: 77  DAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
            A++++ +    RI + +F GWM A SPA+NA++H  YD+W+++C+ 
Sbjct: 77  FAYITVRDP---RIGQPVFEGWMIASSPALNAMEHQRYDVWVLRCRT 120


>gi|259416815|ref|ZP_05740735.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259348254|gb|EEW60031.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 145

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 51/101 (50%), Gaps = 3/101 (2%)

Query: 23  ARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSI 82
                 +A   G+DK+ G+    DV+   S +   LI+    C    +  +    A+++I
Sbjct: 47  EATKGSIASLRGLDKVNGKSTDVDVQTGGSVEVFGLIVTMRECRYPTENPSGDAFAYLTI 106

Query: 83  SEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
            +    ++    F GWM A SPA++A+DH  YD+W+++CK 
Sbjct: 107 RDRQDGKV---FFDGWMIASSPALSALDHRRYDVWVLRCKS 144


>gi|85704727|ref|ZP_01035828.1| hypothetical protein ROS217_06595 [Roseovarius sp. 217]
 gi|85670545|gb|EAQ25405.1| hypothetical protein ROS217_06595 [Roseovarius sp. 217]
          Length = 119

 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 53/93 (56%), Gaps = 3/93 (3%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDR 89
           A   G+DKI G+    D+   +   FG+L ++   C   +   A    A+++I E     
Sbjct: 29  AILRGLDKINGQASDLDLANGEMGAFGTLDVELGECRYPEGNPAGDSYAYLTIREQNGGA 88

Query: 90  IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           +   +FSGWM A SPA+NA++H+ YDIW+++CK
Sbjct: 89  V---VFSGWMLASSPALNALEHARYDIWVLRCK 118


>gi|99081361|ref|YP_613515.1| hypothetical protein TM1040_1520 [Ruegeria sp. TM1040]
 gi|99037641|gb|ABF64253.1| hypothetical protein TM1040_1520 [Ruegeria sp. TM1040]
          Length = 145

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 30/118 (25%), Positives = 55/118 (46%), Gaps = 9/118 (7%)

Query: 12  FVFSHAKFANSARFANKVAE------FAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVC 65
            +       +  R     A         G+DK+ G+ +  +V+   +A+   LI+    C
Sbjct: 30  VIVQPRVPESRERVERIEATEGTLTSLRGLDKVNGKSVDVEVQTGGTAEIFGLIVTLREC 89

Query: 66  YSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
               +  +    A+++I +    ++    F GWM A SPA+NA+DH  YD+W+++CK 
Sbjct: 90  RYPTENPSGDAFAYLTIRDRQDGKV---FFDGWMIASSPALNALDHRRYDVWVLRCKS 144


>gi|56695909|ref|YP_166260.1| hypothetical protein SPO1008 [Ruegeria pomeroyi DSS-3]
 gi|56677646|gb|AAV94312.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 119

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 21  NSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
             A  +   A   G+DK++G+   F V    +A+   L +    C    +       A++
Sbjct: 19  GDAVTSGTGAMLRGLDKVSGQTEDFRVATGGTAEIYGLDVALGDCRYPVENPTGDAFAYL 78

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
           +I E       ++IF GWM A SPA++A+DHS YD+W+++C  P
Sbjct: 79  TIWER---GQRQAIFDGWMIASSPALSALDHSRYDVWVIRCMTP 119


>gi|294678127|ref|YP_003578742.1| hypothetical protein RCAP_rcc02605 [Rhodobacter capsulatus SB 1003]
 gi|294476947|gb|ADE86335.1| conserved hypothetical protein [Rhodobacter capsulatus SB 1003]
          Length = 122

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 62/122 (50%), Gaps = 3/122 (2%)

Query: 1   MKYRVLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLII 60
           ++  ++ ++L    + A+ A         A   G+DKI G      + + QS  +GSL +
Sbjct: 2   IRAALVAVLLTAGAAGAQEAPEGLAEAPGATLRGLDKIAGAATDLPLSVGQSLDYGSLSV 61

Query: 61  KPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ 120
           +   C    D  A    AF+ I++    R    +F GWM A +PA++A+DH  YD+W+++
Sbjct: 62  RLTDCRYPADDPASNAYAFLEITDTAIGRE---VFRGWMIAQNPALSALDHQRYDVWVLR 118

Query: 121 CK 122
           CK
Sbjct: 119 CK 120


>gi|254294263|ref|YP_003060286.1| hypothetical protein Hbal_1904 [Hirschia baltica ATCC 49814]
 gi|254042794|gb|ACT59589.1| conserved hypothetical protein [Hirschia baltica ATCC 49814]
          Length = 217

 Score =  144 bits (362), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 41/203 (20%), Positives = 86/203 (42%), Gaps = 26/203 (12%)

Query: 5   VLLLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMV 64
            + + +    +   FA   R      +   ++KITG+    ++E++++ QFG L +    
Sbjct: 10  FVAVGVLISATQTAFALDPR---PGVKVRALEKITGKATDIEIELDETVQFGGLGLTVRA 66

Query: 65  CYSRDD-REAQRIDAFVSISEIFTDRIVR-------SIFSGWMFADSPAMNAIDHSIYDI 116
           C+      +     A++ +  +  +            +FSGWMFA SP +NA++HS+YD+
Sbjct: 67  CHQSPPEDQPPEAAAYLEVISMGVNAETGTAKDDDPRLFSGWMFASSPGLNALEHSLYDV 126

Query: 117 WLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENN 176
           W++ C   +  +         K L  Y  +++      + +  SS+         P  ++
Sbjct: 127 WVISCSAALPGT-------EAKPLDLYEESNLGFDAIPEEALPSSDINESASMGLPSIDD 179

Query: 177 LS--------MDLKGRPIQELGN 191
            +         DL+  P++  G+
Sbjct: 180 FNPEPIFVEEADLEAVPVERSGS 202


>gi|254486361|ref|ZP_05099566.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214043230|gb|EEB83868.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 117

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 39/118 (33%), Positives = 56/118 (47%), Gaps = 4/118 (3%)

Query: 7   LLILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCY 66
           LLIL  V S    A  A  +        +DK++G      +   Q+A  G+L +    C 
Sbjct: 4   LLILLAVLSSPLHAEEA-TSAPGGVLRALDKVSGAAQDIVMFRGQTAHVGNLDVLMTDCR 62

Query: 67  SRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
                 A   DA+V + EI T      +FSGWM A SPA++A++H  YDIW ++C   
Sbjct: 63  FPKGNPAG--DAYVEL-EIKTTGRDDKLFSGWMIASSPALSALEHPRYDIWAIRCTTS 117


>gi|126741250|ref|ZP_01756929.1| hypothetical protein RSK20926_17467 [Roseobacter sp. SK209-2-6]
 gi|126717655|gb|EBA14378.1| hypothetical protein RSK20926_17467 [Roseobacter sp. SK209-2-6]
          Length = 126

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 27  NKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIF 86
             +A   G+DK+ G+    +V++ +SA+   L++    C    D       A++ I +  
Sbjct: 32  GSMAILRGLDKVNGQSTDVEVQVGRSAEVFGLLVTLAQCRYPVDNPTGDAFAYLIIRDPN 91

Query: 87  TDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
                   F GWM A SPA+NA+DHS YD+W+++C   
Sbjct: 92  NGA---QFFEGWMIASSPALNALDHSRYDVWVIRCSKS 126


>gi|254475589|ref|ZP_05088975.1| conserved hypothetical protein [Ruegeria sp. R11]
 gi|214029832|gb|EEB70667.1| conserved hypothetical protein [Ruegeria sp. R11]
          Length = 122

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 32/104 (30%), Positives = 51/104 (49%), Gaps = 3/104 (2%)

Query: 20  ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
                   + A   G+DK+ G+    +V +  SA+   +I+  M C    D       A+
Sbjct: 21  QQGDAVQGQSAILRGLDKVNGQTQDLEVPVGSSAEIFGVIVNVMDCRYPADNPTGDAFAY 80

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
           +++ +     +    F GWM A SPA+NA+DHS YDIW+M+C  
Sbjct: 81  LTVRDPNDGTV---FFDGWMIASSPALNALDHSRYDIWVMRCTS 121


>gi|89068966|ref|ZP_01156348.1| hypothetical protein OG2516_01791 [Oceanicola granulosus HTCC2516]
 gi|89045547|gb|EAR51611.1| hypothetical protein OG2516_01791 [Oceanicola granulosus HTCC2516]
          Length = 117

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 3/99 (3%)

Query: 26  ANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEI 85
           +        +DK TG V   +++  Q+AQ G + +    C       A    A +++   
Sbjct: 22  SAPGGVLRVLDKQTGHVEDLELQAGQTAQSGLVEVSLGACRYPAGNPAGDAYALLTV--- 78

Query: 86  FTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
                V  +F GWM A +PA+NA+DH  YD+W+++C   
Sbjct: 79  HYRGQVEPVFRGWMIASAPALNAMDHPRYDVWVLRCITS 117


>gi|254464893|ref|ZP_05078304.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206685801|gb|EDZ46283.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 125

 Score =  141 bits (356), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 28/108 (25%), Positives = 50/108 (46%), Gaps = 3/108 (2%)

Query: 14  FSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREA 73
           +   + A S+      A    +DK+ G  +  ++ +  SA+   L++    C    +   
Sbjct: 18  WGQEQVAQSSAAQGTAAVLRALDKVNGHSMDAEIAVGSSAEMFGLLVTVSDCRYPAENPT 77

Query: 74  QRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
               AF+++            F GWM A SPA+N +DHS YD+W+++C
Sbjct: 78  GDAYAFLTVR---NPGDSAVQFEGWMIASSPALNPLDHSRYDVWVIRC 122


>gi|84515419|ref|ZP_01002781.1| hypothetical protein SKA53_02136 [Loktanella vestfoldensis SKA53]
 gi|84510702|gb|EAQ07157.1| hypothetical protein SKA53_02136 [Loktanella vestfoldensis SKA53]
          Length = 131

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 51/109 (46%), Gaps = 3/109 (2%)

Query: 23  ARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSI 82
              +   A+   +DK+TG V   +V   Q+   G+L +    C    +  A    A + I
Sbjct: 21  EMLSGIGADIRILDKLTGAVTDLEVSNGQTDNVGALSVTLGDCRYPAENVASEGYAALVI 80

Query: 83  SEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISN 131
                   V  IF+GWM A SPA+NA+DH  YD+W+++C   +    + 
Sbjct: 81  ---HYRAEVAPIFAGWMLASSPALNALDHPRYDVWVLRCITSLGAGTAP 126


>gi|126727094|ref|ZP_01742931.1| hypothetical protein RB2150_00624 [Rhodobacterales bacterium
           HTCC2150]
 gi|126703522|gb|EBA02618.1| hypothetical protein RB2150_00624 [Rhodobacterales bacterium
           HTCC2150]
          Length = 119

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 5/121 (4%)

Query: 6   LLLILFFVFSHAKFANSAR--FANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           ++ +L  + +   FA  A    +   A    +DK++G+   FD+   QSA  G+L +   
Sbjct: 1   MIRVLAVIAALCPFAALAEDTTSTTTANMRALDKVSGQTWDFDISSGQSASLGNLTLFSK 60

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
            C    D  +     ++SI +   +R    +F GWM A SPA+NA DH+ YD+WL+ C  
Sbjct: 61  ECRYPTDDPSSNAYVYLSIQD---ERDGGELFRGWMVAASPALNAFDHARYDVWLLSCAL 117

Query: 124 P 124
           P
Sbjct: 118 P 118


>gi|77463761|ref|YP_353265.1| hypothetical protein RSP_0193 [Rhodobacter sphaeroides 2.4.1]
 gi|126462591|ref|YP_001043705.1| hypothetical protein Rsph17029_1826 [Rhodobacter sphaeroides ATCC
           17029]
 gi|332558617|ref|ZP_08412939.1| hypothetical protein RSWS8N_06160 [Rhodobacter sphaeroides WS8N]
 gi|77388179|gb|ABA79364.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
 gi|126104255|gb|ABN76933.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17029]
 gi|332276329|gb|EGJ21644.1| hypothetical protein RSWS8N_06160 [Rhodobacter sphaeroides WS8N]
          Length = 123

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 31/103 (30%), Positives = 49/103 (47%), Gaps = 3/103 (2%)

Query: 26  ANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEI 85
               A    +DK++G     +++  QSA  G L I+   C       A    A ++I + 
Sbjct: 23  EGTGALLRWLDKMSGETADVELQRGQSAVSGHLTIELDECRFPAGDPASDAYAHLTIRD- 81

Query: 86  FTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDS 128
              R    +F GWM A SPA++A+DH  YD+WL++C      +
Sbjct: 82  --SRAAEPVFDGWMIASSPALSALDHPRYDVWLLRCTTEAGSA 122


>gi|254440647|ref|ZP_05054140.1| hypothetical protein OA307_62 [Octadecabacter antarcticus 307]
 gi|198250725|gb|EDY75040.1| hypothetical protein OA307_62 [Octadecabacter antarcticus 307]
          Length = 106

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 43/104 (41%), Gaps = 3/104 (2%)

Query: 18  KFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRID 77
                            +DKITGR    +    Q+     + I    C      ++    
Sbjct: 3   PVCAQQAITASGGTLRVLDKITGRTQDLEFGNGQTQTVELMAITMTECRYPSGNQSGDAY 62

Query: 78  AFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           AF++I     +     +F GWM A +PA+NA+DH  YD+W ++C
Sbjct: 63  AFLTI---LYNNAADPVFRGWMIASAPALNALDHPRYDVWALRC 103


>gi|16126129|ref|NP_420693.1| hypothetical protein CC_1886 [Caulobacter crescentus CB15]
 gi|13423333|gb|AAK23861.1| hypothetical protein CC_1886 [Caulobacter crescentus CB15]
          Length = 223

 Score =  137 bits (346), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 56/118 (47%), Gaps = 9/118 (7%)

Query: 16  HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE-AQ 74
            A+ A  AR++  VA    +DK+T   + F+V I Q  ++ +LI     C +    E A 
Sbjct: 101 PAEPAKRARYS--VAILQALDKVTTETMRFEVPIGQPIRYKTLIFTVRACETAAADEVAP 158

Query: 75  RIDAFVSISEI------FTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPIN 126
              A+V +               R I+ GWM+A SP +N + H +YD WL+ CK  I 
Sbjct: 159 ESAAYVVVDTQPKAQAGRAAPPGRQIYKGWMYASSPGLNPLQHPVYDAWLIACKQSIP 216


>gi|296534672|ref|ZP_06897071.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
 gi|296264997|gb|EFH11223.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
          Length = 124

 Score =  137 bits (345), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 55/99 (55%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSIS 83
             A + A+   +DK+T RV   +  +NQ  QFG+L +    C +R   E     A++ + 
Sbjct: 26  WVAARTAKLQALDKVTARVTVLETPVNQPIQFGTLRVTVRACNARPPEEVPDAAAWLEVL 85

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
           +   D    + F GWMFA++P ++ ++H +YD+ +++C+
Sbjct: 86  DTRNDPNGAAAFRGWMFANAPGVSMLEHPVYDLRILECR 124


>gi|304570805|ref|YP_002517336.2| hypothetical protein CCNA_01963 [Caulobacter crescentus NA1000]
          Length = 194

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 56/118 (47%), Gaps = 9/118 (7%)

Query: 16  HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE-AQ 74
            A+ A  AR++  VA    +DK+T   + F+V I Q  ++ +LI     C +    E A 
Sbjct: 72  PAEPAKRARYS--VAILQALDKVTTETMRFEVPIGQPIRYKTLIFTVRACETAAADEVAP 129

Query: 75  RIDAFVSISEI------FTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPIN 126
              A+V +               R I+ GWM+A SP +N + H +YD WL+ CK  I 
Sbjct: 130 ESAAYVVVDTQPKAQAGRAAPPGRQIYKGWMYASSPGLNPLQHPVYDAWLIACKQSIP 187


>gi|254453527|ref|ZP_05066964.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198267933|gb|EDY92203.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
          Length = 105

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 47/105 (44%), Gaps = 4/105 (3%)

Query: 17  AKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRI 76
             FA  A  A+       +DKITGR    +    Q+   G L I    C      ++   
Sbjct: 2   PVFAQEATTASG-GTLRVLDKITGRTHDLEFGNGQTQTVGLLAITMTECRYPSGNQSGDA 60

Query: 77  DAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
              ++I     +     +F GWM A +PA+NA+DH  YD+W ++C
Sbjct: 61  YTLLTI---VYNNAADPVFRGWMIASAPALNALDHPRYDVWTLRC 102


>gi|94498773|ref|ZP_01305321.1| hypothetical protein SKA58_14272 [Sphingomonas sp. SKA58]
 gi|94421782|gb|EAT06835.1| hypothetical protein SKA58_14272 [Sphingomonas sp. SKA58]
          Length = 176

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 34/148 (22%), Positives = 58/148 (39%), Gaps = 2/148 (1%)

Query: 25  FANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREA-QRIDAFVSIS 83
            A + A    ++K  G      ++  ++ + G  I++   C +    E  Q   AFV + 
Sbjct: 19  MAERSAVLGLLNKRNGLTRDLTLKPGEAVRVGDAIVRLQACETTAPWENIQDTGAFVQLD 78

Query: 84  EIF-TDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSE 142
                D   R  FSGW+F D P  N + H IYD+W+  C     +S  ++  +  K    
Sbjct: 79  VRSSADNKWRRAFSGWLFRDRPDRNVVQHPIYDVWVRSCAMEWPESGPDTVKLGAKGEPV 138

Query: 143 YSSTDITSQGSEKSSGSSSNKTLEKESS 170
            +        S  ++   +  T E   S
Sbjct: 139 SARPASGENASSAAAPDPAASTSEPAPS 166


>gi|295689564|ref|YP_003593257.1| hypothetical protein Cseg_2176 [Caulobacter segnis ATCC 21756]
 gi|295431467|gb|ADG10639.1| Protein of unknown function DUF2155 [Caulobacter segnis ATCC 21756]
          Length = 221

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 57/126 (45%), Gaps = 10/126 (7%)

Query: 16  HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE-AQ 74
             + A   R+A  +A    +DK+T   + F+V + Q  ++ +L+     C +    E A 
Sbjct: 99  PPEPAKRQRYA--IAILQALDKVTTETMRFEVPVGQPIRYKTLVFTVRACETAAADEIAP 156

Query: 75  RIDAFVSISEI------FTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDS 128
              A+V +               R I+ GWM+A SP +N ++H +YD WL+ CK  I   
Sbjct: 157 ETTAYVIVDTQPKAQAGRPAPPGRQIYKGWMYASSPGLNPLEHPVYDAWLIACKQSIP-V 215

Query: 129 ISNSES 134
              ++ 
Sbjct: 216 APPAKP 221


>gi|241761853|ref|ZP_04759939.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241373767|gb|EER63327.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 214

 Score =  134 bits (337), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 33/145 (22%), Positives = 59/145 (40%), Gaps = 1/145 (0%)

Query: 15  SHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQ 74
           +          + +VA    ++K TG      +   +   F  LIIK   C      EA+
Sbjct: 70  APPPEKGLLPMSQRVAVLGVLNKKTGEWQDITLHTGEITHFPDLIIKLQACDETMPWEAE 129

Query: 75  R-IDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSE 133
               AFV +  +  +   + IFSGW++ ++P++N ++   YDIW   C        +  +
Sbjct: 130 HLTGAFVQVESLKYNHRWQRIFSGWLYKEAPSLNVLESPDYDIWPKSCTMRAPLGHAKEK 189

Query: 134 SISKKALSEYSSTDITSQGSEKSSG 158
             S  A+   S    + +G   S+ 
Sbjct: 190 EASPGAVPSVSKAMPSVKGKSTSAN 214


>gi|146277492|ref|YP_001167651.1| hypothetical protein Rsph17025_1452 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555733|gb|ABP70346.1| conserved hypothetical protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 123

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 30/103 (29%), Positives = 47/103 (45%), Gaps = 3/103 (2%)

Query: 26  ANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEI 85
               A    +DK++G     ++   QSA  G L I+   C       A    A ++I + 
Sbjct: 23  EGSGALLRWLDKMSGETADAELMRGQSAVSGHLTIELDECRYPAGDPASDAFAHLTIRD- 81

Query: 86  FTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDS 128
              R    +F GWM A SPA++++DH  YD+WL++C       
Sbjct: 82  --SRAAEPVFDGWMIASSPALSSLDHPRYDVWLLRCTTEAGSG 122


>gi|260752613|ref|YP_003225506.1| hypothetical protein Za10_0371 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258551976|gb|ACV74922.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 216

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 33/145 (22%), Positives = 59/145 (40%), Gaps = 1/145 (0%)

Query: 15  SHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQ 74
           +          + +VA    ++K TG      +   +   F  LIIK   C      EA+
Sbjct: 72  APPPEKGLLPMSQRVAVLGVLNKKTGEWQDITLHTGEITHFPDLIIKLQACDETMPWEAE 131

Query: 75  R-IDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSE 133
               AFV +  +  +   + IFSGW++ ++P++N ++   YDIW   C        +  +
Sbjct: 132 HLTGAFVQVESLKYNHRWQRIFSGWLYKEAPSLNVLESPDYDIWPKSCTMRAPLGHAKEK 191

Query: 134 SISKKALSEYSSTDITSQGSEKSSG 158
             S  A+   S    + +G   S+ 
Sbjct: 192 ETSPAAVPSVSKAMPSVKGKSASAN 216


>gi|220964072|gb|ACL95428.1| conserved hypothetical protein [Caulobacter crescentus NA1000]
          Length = 112

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 49/105 (46%), Gaps = 7/105 (6%)

Query: 29  VAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE-AQRIDAFVSISEI-- 85
           +A    +DK+T   + F+V I Q  ++ +LI     C +    E A    A+V +     
Sbjct: 1   MAILQALDKVTTETMRFEVPIGQPIRYKTLIFTVRACETAAADEVAPESAAYVVVDTQPK 60

Query: 86  ----FTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPIN 126
                     R I+ GWM+A SP +N + H +YD WL+ CK  I 
Sbjct: 61  AQAGRAAPPGRQIYKGWMYASSPGLNPLQHPVYDAWLIACKQSIP 105


>gi|283856366|ref|YP_003377799.1| hypothetical protein ZMO2007 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|283775365|gb|ADB28965.1| conserved hypothetical protein [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 214

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 33/145 (22%), Positives = 59/145 (40%), Gaps = 1/145 (0%)

Query: 15  SHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQ 74
           +          + +VA    ++K TG      +   +   F  LIIK   C      EA+
Sbjct: 70  APPPEKGLLPMSQRVAILGVLNKKTGEWQDITLHTGEITHFPDLIIKLQACDETMPWEAE 129

Query: 75  R-IDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSE 133
               AFV +  +  +   + IFSGW++ ++P++N ++   YDIW   C        +  +
Sbjct: 130 HLTGAFVQVESLKYNHRWQRIFSGWLYKEAPSLNVLESPDYDIWPKSCTMRAPLGHAKEK 189

Query: 134 SISKKALSEYSSTDITSQGSEKSSG 158
             S  A+   S    + +G   S+ 
Sbjct: 190 EASPGAVPSVSKAMPSVKGKSASAN 214


>gi|89055209|ref|YP_510660.1| hypothetical protein Jann_2718 [Jannaschia sp. CCS1]
 gi|88864758|gb|ABD55635.1| hypothetical protein Jann_2718 [Jannaschia sp. CCS1]
          Length = 184

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 48/105 (45%), Gaps = 4/105 (3%)

Query: 17  AKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRI 76
              +  A           +DK+ G+    ++ + Q+  FG + I+ + C           
Sbjct: 82  TSISQPATEVGTTVSLRALDKMLGQPTDIELSMGQTVVFGRVAIRVIECRYPAADPGGDA 141

Query: 77  DAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
            A + +     +    ++F GWM A SPA+NA++HS YD+W++ C
Sbjct: 142 FALLEV----LNMEGETLFDGWMIASSPALNALEHSRYDVWVLGC 182


>gi|110680058|ref|YP_683065.1| hypothetical protein RD1_2853 [Roseobacter denitrificans OCh 114]
 gi|109456174|gb|ABG32379.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 119

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 48/95 (50%), Gaps = 3/95 (3%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDR 89
           A+  G+D+I G      V   Q+A+   + I+   C       +    A + + +I +  
Sbjct: 28  AQLRGVDRINGETFEIIVPKGQTAKLDRISIRLNACRYPVGNPSGDAFASLEVRDIDSGA 87

Query: 90  IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
               IFSGWM A SPA++A+DH  YDIW+M+C   
Sbjct: 88  ---FIFSGWMIASSPALSAMDHPRYDIWVMRCTTS 119


>gi|119384014|ref|YP_915070.1| hypothetical protein Pden_1269 [Paracoccus denitrificans PD1222]
 gi|119373781|gb|ABL69374.1| conserved hypothetical protein [Paracoccus denitrificans PD1222]
          Length = 163

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 31/99 (31%), Positives = 51/99 (51%), Gaps = 3/99 (3%)

Query: 23  ARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSI 82
                  A+  G+DKITGR   F + + + A+FG L +    C            A ++I
Sbjct: 65  ETARGTGAQLRGLDKITGRTQDFTLAVGEVAEFGRLQLSLAECRYPAADPTSDAYAELTI 124

Query: 83  SEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           ++   +     +FSGWM A SPA++++D S YD+W++ C
Sbjct: 125 TDSQANA---RLFSGWMIASSPALSSLDDSRYDVWVISC 160


>gi|85375052|ref|YP_459114.1| hypothetical protein ELI_11125 [Erythrobacter litoralis HTCC2594]
 gi|84788135|gb|ABC64317.1| hypothetical protein ELI_11125 [Erythrobacter litoralis HTCC2594]
          Length = 157

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 50/116 (43%), Gaps = 4/116 (3%)

Query: 15  SHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQ 74
           +    + +     +VA    ++K        ++   +S + G +I++   C      E  
Sbjct: 31  AAPDVSGATPMEERVATLGLLNKRNNISQDLEMSPGESRRIGDIIVRLSACERTAPWEMP 90

Query: 75  -RIDAFVSIS---EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPIN 126
               AFV +    +   +   R IFSGWMF  SP++N ++H +YD+W+  C     
Sbjct: 91  QETGAFVQVLVEGKGEDEGEWRKIFSGWMFQRSPSLNVVEHPVYDVWVKDCAMSFP 146


>gi|91762149|ref|ZP_01264114.1| hypothetical protein PU1002_02751 [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91717951|gb|EAS84601.1| hypothetical protein PU1002_02751 [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 135

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 64/120 (53%), Gaps = 2/120 (1%)

Query: 4   RVLLLILFFVFS-HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKP 62
            + +LI FF+ S  +    +     K  E   +DK++ +     ++I +  +F SL+IK 
Sbjct: 15  FLFILIYFFLTSISSPLVANENSEGKFVEIKILDKVSSKTDLLKLKIGEELRFKSLLIKS 74

Query: 63  MVCYSRDDREAQRIDAFVSISE-IFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           + C + +  +   I +++ + + I  D     IF+GW F+ SPA+N  DH +YDIWL +C
Sbjct: 75  LKCKNSEFDDNPEITSYIQVKDTINNDNNEVFIFNGWTFSSSPAVNPFDHPVYDIWLTRC 134


>gi|329850493|ref|ZP_08265338.1| hypothetical protein ABI_34000 [Asticcacaulis biprosthecum C19]
 gi|328840808|gb|EGF90379.1| hypothetical protein ABI_34000 [Asticcacaulis biprosthecum C19]
          Length = 233

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 54/120 (45%), Gaps = 8/120 (6%)

Query: 19  FANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQ-RID 77
           +    R     A    +DK+    + F+  I Q  +F  LI     C    D EAQ  + 
Sbjct: 114 YVPKKRPRYGTAIIEALDKVNAESVRFEAPIGQPVRFKGLIYLVKACEMTADDEAQNDVM 173

Query: 78  AFVSI-------SEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSIS 130
           A++++       +        + IF GW F+ SP++N + H IYD W++ C+ P+  + S
Sbjct: 174 AYMTVRTNPVAATNTSIGSKSKQIFQGWSFSSSPSLNPMQHPIYDAWVIGCRKPLGGTTS 233


>gi|163731530|ref|ZP_02138977.1| hypothetical protein RLO149_19539 [Roseobacter litoralis Och 149]
 gi|161394984|gb|EDQ19306.1| hypothetical protein RLO149_19539 [Roseobacter litoralis Och 149]
          Length = 119

 Score =  131 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 56/121 (46%), Gaps = 4/121 (3%)

Query: 5   VLLLILFFVFSHAKFANSARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           +L   L FVF+ +             A+  G+D+I G      V   Q+A+   + I   
Sbjct: 2   ILRSCLAFVFTASAALAQQAATEATGAQLRGVDRINGDTFEIIVPRGQTAELERISITLN 61

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
            C       +    A +++ +I +      IFSGWM A SPA++A+DH  YDIW+M+C  
Sbjct: 62  SCRYPVGNPSGDAFASLNVRDINSGAN---IFSGWMIASSPALSAMDHPRYDIWVMRCTT 118

Query: 124 P 124
            
Sbjct: 119 S 119


>gi|167646524|ref|YP_001684187.1| hypothetical protein Caul_2562 [Caulobacter sp. K31]
 gi|167348954|gb|ABZ71689.1| conserved hypothetical protein [Caulobacter sp. K31]
          Length = 227

 Score =  131 bits (329), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 54/123 (43%), Gaps = 8/123 (6%)

Query: 12  FVFSHAKFANS-ARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDD 70
            V +  K A    R  + VA    +DK+T   + F+  + Q  ++ +L+     C +   
Sbjct: 98  VVVAPEKPAEPIKRSRSSVAIIQALDKVTTETMRFEAPVGQPIRYKTLVFTVRACETTTP 157

Query: 71  RE-AQRIDAFVSISEI------FTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
            E A    A+V +               R I+ GWM+A+SP +N + H +YD WL+ CK 
Sbjct: 158 DEDAPDSVAYVVVDTQPKALPGRVAPPGRQIYKGWMYANSPGLNPLQHPVYDAWLIACKT 217

Query: 124 PIN 126
              
Sbjct: 218 SAP 220


>gi|114771113|ref|ZP_01448553.1| hypothetical protein OM2255_03407 [alpha proteobacterium HTCC2255]
 gi|114548395|gb|EAU51281.1| hypothetical protein OM2255_03407 [alpha proteobacterium HTCC2255]
          Length = 131

 Score =  131 bits (329), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 32/118 (27%), Positives = 57/118 (48%), Gaps = 5/118 (4%)

Query: 6   LLLILFFVFSHAKFAN-SARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPM 63
           +L  LF +F+    A  S +  N   A    +D+++G V  F +   +    G++ +   
Sbjct: 3   VLTFLFIIFAQTVLAQGSIKVTNGSGALLRTLDRLSGNVTDFKITNGEEIILGNINVLMK 62

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
            C            AF+ IS   T+   +  F GWM + SPA++A++H  YD+W+++C
Sbjct: 63  ECRYPSQSIDSNAFAFLVISGQETE---KLFFEGWMISSSPALSALEHPRYDVWVLKC 117


>gi|84686584|ref|ZP_01014477.1| hypothetical protein 1099457000254_RB2654_07826 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84665497|gb|EAQ11974.1| hypothetical protein RB2654_07826 [Rhodobacterales bacterium
           HTCC2654]
          Length = 179

 Score =  130 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 48/101 (47%), Gaps = 3/101 (2%)

Query: 23  ARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSI 82
                  A   G+DK+ G  +  ++   ++ + G L +    C  R   +  + DAF  +
Sbjct: 81  EVTQGTGAVLRGLDKLAGTSIDLNLATGETGELGWLQVTMAEC--RYPNDNPQGDAFAHL 138

Query: 83  SEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
             I        +F GWM A SPA++A+DHS +D+W+M C  
Sbjct: 139 -VIRNGNDEEPLFDGWMIASSPALSALDHSRFDVWVMNCTT 178


>gi|126733140|ref|ZP_01748887.1| hypothetical protein RCCS2_03274 [Roseobacter sp. CCS2]
 gi|126716006|gb|EBA12870.1| hypothetical protein RCCS2_03274 [Roseobacter sp. CCS2]
          Length = 146

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 49/106 (46%), Gaps = 5/106 (4%)

Query: 19  FANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDA 78
                       +   +DK+TG+V    +E  Q+A  G L +K   C  R   E    DA
Sbjct: 46  AVMQDVATASGGDLRILDKLTGQVSDVSLETGQTATLGFLSVKLNEC--RYPIENPSGDA 103

Query: 79  FVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
           F  I     +     +FSGWM A +PA+NA+DH  YD+W ++C   
Sbjct: 104 FTQIVVRDNEGT---LFSGWMLASAPALNAMDHPRYDVWALRCMTS 146


>gi|159043941|ref|YP_001532735.1| hypothetical protein Dshi_1392 [Dinoroseobacter shibae DFL 12]
 gi|157911701|gb|ABV93134.1| conserved hypothetical protein [Dinoroseobacter shibae DFL 12]
          Length = 180

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 57/128 (44%), Gaps = 6/128 (4%)

Query: 19  FANSARFANKVA-EFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRID 77
           F    R +   A     +DK TGRV T ++   ++ Q G L I  + C      E    D
Sbjct: 57  FEQELRVSAAEAGLIRVLDKTTGRVETLEIPAGEARQSGRLSITLIECRF--PEENPASD 114

Query: 78  AFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISK 137
           AFV +     D     ++ GWM A SPA+ A+DH  YD+W ++C  P  +  +   +   
Sbjct: 115 AFVHLQITERDT---PLYDGWMIASSPALAALDHHRYDVWALRCATPGEEEATPEVAAGL 171

Query: 138 KALSEYSS 145
           ++    + 
Sbjct: 172 QSPRPTAR 179


>gi|296282309|ref|ZP_06860307.1| hypothetical protein CbatJ_01745 [Citromicrobium bathyomarinum
           JL354]
          Length = 173

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 29/113 (25%), Positives = 53/113 (46%), Gaps = 6/113 (5%)

Query: 25  FANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE-AQRIDAFVSI- 82
            A +VA    ++K       F+++  ++ + G ++I+   C      E  Q   AFV + 
Sbjct: 61  MAERVATIGLLNKRNNVSRDFEMKPGEATRVGDVVIRLRACEKTAPWELPQDEGAFVQVF 120

Query: 83  ----SEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISN 131
                   T+R    +FSGW+F +SP++N ++H IYD+W+  C         +
Sbjct: 121 VRERRGAETERSWNKVFSGWLFRNSPSLNVVEHPIYDVWVKSCAMSFPGEEED 173


>gi|163746707|ref|ZP_02154064.1| hypothetical protein OIHEL45_14929 [Oceanibulbus indolifex HEL-45]
 gi|161379821|gb|EDQ04233.1| hypothetical protein OIHEL45_14929 [Oceanibulbus indolifex HEL-45]
          Length = 146

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 3/99 (3%)

Query: 26  ANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEI 85
           +        +DKI+G  +  ++    +   G+L I  + C       A    A + I+E 
Sbjct: 51  SATGGVLRVLDKISGDTIDLEITKGDNQSLGNLQITMVDCRYPVGDPAANAYAALEITE- 109

Query: 86  FTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
                  ++FSGWM A +PA++A++H  YDIW+++C   
Sbjct: 110 --SGDSGTLFSGWMIAAAPALHALEHFRYDIWVLRCSTS 146


>gi|85710256|ref|ZP_01041321.1| hypothetical protein NAP1_15263 [Erythrobacter sp. NAP1]
 gi|85688966|gb|EAQ28970.1| hypothetical protein NAP1_15263 [Erythrobacter sp. NAP1]
          Length = 164

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 27/117 (23%), Positives = 51/117 (43%), Gaps = 2/117 (1%)

Query: 14  FSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE- 72
            +  +   S     +VA    ++K        ++   ++A+ G +I++   C      E 
Sbjct: 47  LTPLEVGESTPMDERVATIGLLNKRNNVSQDLELSPGETAEVGPVIVRLEACERTAPYEF 106

Query: 73  AQRIDAFVSISEIFTDRIV-RSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDS 128
            Q   AFV +  +         IFSGW+F ++P++N ++H IYD+W+  C       
Sbjct: 107 PQETGAFVQVDVLERGASEHARIFSGWLFKENPSLNVVEHPIYDVWVKDCAMSFPGD 163


>gi|254456041|ref|ZP_05069470.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207083043|gb|EDZ60469.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 135

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 62/121 (51%), Gaps = 6/121 (4%)

Query: 3   YRVLLLILFFV-FSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIK 61
           Y +L + LF   FS AK      F +       +DKI+ +     ++  +  +F  L IK
Sbjct: 18  YFILFIYLFLCNFSFAKNNTEGVFTD----LKILDKISSKNTLIQLKNGELVKFKDLSIK 73

Query: 62  PMVCYSRDDREAQRIDAFVSISEIFT-DRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ 120
            + C + +  +   I A++ + ++   D+    +F+GWMF+ SP++   DH +YD+WL+ 
Sbjct: 74  SLKCKNSEFDDNPEITAYIQVKDLTDQDKDEVFVFNGWMFSSSPSITPFDHPVYDVWLVN 133

Query: 121 C 121
           C
Sbjct: 134 C 134


>gi|71083428|ref|YP_266147.1| hypothetical protein SAR11_0725 [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71062541|gb|AAZ21544.1| conserved hypothetical protein [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 135

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 16  HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQR 75
            +    +     K  E   +DK++ +     ++I +  +F SL+IK + C + +  +   
Sbjct: 28  SSPLIANENNEGKFVEIKILDKVSSKTDLLKLKIGEELRFKSLLIKSLKCKNSEFDDNPE 87

Query: 76  IDAFVSISE-IFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           I  ++ + + I  D     IF+GW F+ SPA+N  DH +YDIWL +C
Sbjct: 88  ITVYIQVKDTIKNDNNEVFIFNGWTFSSSPAVNPFDHPVYDIWLTRC 134


>gi|149179614|ref|ZP_01858130.1| hypothetical protein PM8797T_18696 [Planctomyces maris DSM 8797]
 gi|148841545|gb|EDL55992.1| hypothetical protein PM8797T_18696 [Planctomyces maris DSM 8797]
          Length = 161

 Score =  122 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 47/106 (44%), Gaps = 3/106 (2%)

Query: 25  FANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQ-RIDAFVSI- 82
              + A    ++K        +++  +  + G +II+   C      E +    AFV + 
Sbjct: 54  MEERTATIGLLNKRNNLSQDLELKPGEQRRVGDVIIRLRACERTAPWEMEKDEGAFVQVL 113

Query: 83  -SEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPIND 127
             E  +    R +FSGW+F + P++N ++H IYD+W+  C      
Sbjct: 114 VRERGSTSDFRRVFSGWLFKNKPSINVVEHPIYDVWVKSCAMEFPG 159


>gi|149186415|ref|ZP_01864728.1| hypothetical protein ED21_23038 [Erythrobacter sp. SD-21]
 gi|148830004|gb|EDL48442.1| hypothetical protein ED21_23038 [Erythrobacter sp. SD-21]
          Length = 161

 Score =  122 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 25/106 (23%), Positives = 47/106 (44%), Gaps = 3/106 (2%)

Query: 25  FANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQ-RIDAFVSI- 82
              + A    ++K        +++  +  + G +II+   C      E +    AFV + 
Sbjct: 54  MEERTATIGLLNKRNNLSQDLELKPGEQRRVGDVIIRLRACERTAPWEMEKDEGAFVQVL 113

Query: 83  -SEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPIND 127
             E  +    R +FSGW+F + P++N ++H IYD+W+  C      
Sbjct: 114 VRERGSTSDFRRVFSGWLFKNKPSINVVEHPIYDVWVKSCAMEFPG 159


>gi|87198847|ref|YP_496104.1| hypothetical protein Saro_0825 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134528|gb|ABD25270.1| conserved hypothetical protein [Novosphingobium aromaticivorans DSM
           12444]
          Length = 217

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 56/133 (42%), Gaps = 6/133 (4%)

Query: 25  FANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE-AQRIDAFVS-- 81
             ++VA    ++K         ++  +S + G+ I+K   C      E      AFV   
Sbjct: 57  IKDRVATLGFLNKRNNITQDVVLKSGESRRIGNAIVKLATCEKTAPWEDPPETGAFVQLF 116

Query: 82  ISEIFTDRI---VRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKK 138
           + E  T +     R +FSGW+F ++P++N ++H +YD+W+  C          + S    
Sbjct: 117 VEERATTQEKLAWRKVFSGWLFRNAPSLNVVEHPVYDVWVKDCAMTFPGEEEPAPSARSA 176

Query: 139 ALSEYSSTDITSQ 151
           A    S +   S 
Sbjct: 177 AKPAGSPSAAASP 189


>gi|310816207|ref|YP_003964171.1| hypothetical protein EIO_1753 [Ketogulonicigenium vulgare Y25]
 gi|308754942|gb|ADO42871.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 121

 Score =  121 bits (303), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 46/97 (47%), Gaps = 3/97 (3%)

Query: 28  KVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFT 87
                  +DK+ G V   ++   QSA  G L++    C    D      DAF  I+ +  
Sbjct: 28  PGGTVRVLDKLNGSVTDLELTNGQSATVGRLVVTLGECRFPTDNPMG--DAFQMIT-LQF 84

Query: 88  DRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
           +  +  +F GWM A SPA++A D++ YD+W + C   
Sbjct: 85  EGNLEPVFMGWMIASSPAVSAFDNARYDVWPLSCITS 121


>gi|197105316|ref|YP_002130693.1| hypothetical protein PHZ_c1853 [Phenylobacterium zucineum HLK1]
 gi|196478736|gb|ACG78264.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 227

 Score =  120 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 31/134 (23%), Positives = 54/134 (40%), Gaps = 9/134 (6%)

Query: 13  VFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE 72
           V      A   R     A    +DK++   L F+  + +  ++  LI     C      E
Sbjct: 95  VAEKPVEAPIRRARYDTAVLQALDKVSAETLKFEAPVGRPVRWKGLIFTVRACERSAPDE 154

Query: 73  A-QRIDAFVSISEIFTDRIVR------SIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPI 125
             +   A+V+I      +  R        F GWM+A SP +N ++H+ YD W++ C+   
Sbjct: 155 PVEDAIAYVTIDSQPRPQPGRPTPPPRQAFRGWMYASSPGLNPMEHATYDAWVISCR--A 212

Query: 126 NDSISNSESISKKA 139
           N    ++E  +   
Sbjct: 213 NRPAPSAEGAAAPK 226


>gi|329890102|ref|ZP_08268445.1| hypothetical protein BDIM_17990 [Brevundimonas diminuta ATCC 11568]
 gi|328845403|gb|EGF94967.1| hypothetical protein BDIM_17990 [Brevundimonas diminuta ATCC 11568]
          Length = 231

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 7/106 (6%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEIN-QSAQFG-SLIIKPMVCYSRDDRE-AQRIDAFV 80
           R   ++A    +DK T   + F+VE+  +  +FG +L+ K   C      E  +   A++
Sbjct: 125 RQRRRIAVIQAVDKTTAETMRFEVEVGGRPVRFGKTLLFKARACEVSASDEMTEDAIAYM 184

Query: 81  SI----SEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            +      +      R +F GWMFA SP+++ + H +YD W++ CK
Sbjct: 185 EVGVQPRGLAAPTEARQVFKGWMFASSPSVSGLQHPVYDAWVVGCK 230


>gi|239947487|ref|ZP_04699240.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921763|gb|EER21787.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 157

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 1/102 (0%)

Query: 21  NSARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           NS+ F N    +   ++KIT      D ++ +   FG++ IK   C    D   +     
Sbjct: 55  NSSEFKNYTNGKIIALNKITATSEEIDFKVGEEKYFGNIKIKLHKCIKNLDPYNEDNYLL 114

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           ++I+E   D     +F GWM + S +++  +H IY+I+   C
Sbjct: 115 MTITEYKIDEDPNLLFQGWMISSSISLSTFEHPIYEIFAKDC 156


>gi|315499994|ref|YP_004088797.1| hypothetical protein Astex_3010 [Asticcacaulis excentricus CB 48]
 gi|315418006|gb|ADU14646.1| Protein of unknown function DUF2155 [Asticcacaulis excentricus CB
           48]
          Length = 272

 Score =  117 bits (294), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 23/116 (19%), Positives = 51/116 (43%), Gaps = 7/116 (6%)

Query: 24  RFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQ-RIDAFVSI 82
           R     A    +DK+TG  + F+  + +  ++  ++     C +    EA      ++ +
Sbjct: 156 RLRYSAAILTVLDKVTGEAIRFEAPVGKPKRYRGMVYTVKACETSAQDEAMSDTMTYLEV 215

Query: 83  SEIFTDR------IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNS 132
                          + +F GW +A +P +N ++H +YD+W++ C+ P+  +   S
Sbjct: 216 RTSPQPAANGTVPKPKDVFKGWTYASTPGVNGMEHPVYDVWVVSCRTPLPVTAVAS 271


>gi|157825620|ref|YP_001493340.1| hypothetical protein A1C_02685 [Rickettsia akari str. Hartford]
 gi|157799578|gb|ABV74832.1| hypothetical protein A1C_02685 [Rickettsia akari str. Hartford]
          Length = 160

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 48/101 (47%), Gaps = 1/101 (0%)

Query: 22  SARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
           S+ F N    +   ++KIT      + ++ +   FG++ IK   C    D   +     +
Sbjct: 56  SSEFKNYTNGKIIALNKITATSEEINFKVGEEKYFGNIKIKLHKCIKNLDPYNEDNYLLM 115

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           +I+E   D     +F GWM + S +++  +H IY+I++  C
Sbjct: 116 TITEYTIDEDPNLLFQGWMTSSSISLSTFEHPIYEIFVKDC 156


>gi|329114933|ref|ZP_08243689.1| Hypothetical protein APO_1737 [Acetobacter pomorum DM001]
 gi|326695830|gb|EGE47515.1| Hypothetical protein APO_1737 [Acetobacter pomorum DM001]
          Length = 195

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 28/162 (17%), Positives = 60/162 (37%), Gaps = 4/162 (2%)

Query: 12  FVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDR 71
            +   A +A         A    +D++   V    V +  +A + SL I P  C  R   
Sbjct: 28  ALAPPAVYAPDTWQGKNTAVVRVLDRLDAHVEVISVPVGTTAHYKSLDITPSRCLQRPPT 87

Query: 72  EAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISN 131
            +    A++++ +   +      F GWM A  PA+   +  +YD+ +++C+    + +  
Sbjct: 88  LSPDAAAWLAVQDKHPNGAA---FQGWMLAAEPALGVFESPVYDVRMVRCEGADTEPMLP 144

Query: 132 SESISKKALSEYSSTDITSQGSE-KSSGSSSNKTLEKESSQP 172
                   ++  +S   T        + S    + +   + P
Sbjct: 145 PLPKPVAPVAPPASGSDTVPAPAGDGASSGHAGSPDIPDAIP 186


>gi|302383315|ref|YP_003819138.1| hypothetical protein Bresu_2205 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302193943|gb|ADL01515.1| Protein of unknown function DUF2155 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 228

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 53/112 (47%), Gaps = 6/112 (5%)

Query: 17  AKFANSARFANKVAEFAGMDKITGRVLTFDVEIN-QSAQFGS-LIIKPMVCYSRDDRE-A 73
           A    + R   +VA    +DKIT   + F+VE+     +F + LI     C    D E  
Sbjct: 116 APETPTPRQRRRVAIVEAIDKITAESMRFEVEVGGPPVRFNNNLIFTARACEVSADNELV 175

Query: 74  QRIDAFVSIS---EIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122
               A++ I+           R IF GWMF+ +PA++ + H IYD W++ CK
Sbjct: 176 NDAIAYLDITLQPRATPAAAPRQIFRGWMFSSTPAISGLQHPIYDAWIVGCK 227


>gi|51473553|ref|YP_067310.1| hypothetical protein RT0348 [Rickettsia typhi str. Wilmington]
 gi|51459865|gb|AAU03828.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 155

 Score =  115 bits (289), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 28/101 (27%), Positives = 48/101 (47%), Gaps = 1/101 (0%)

Query: 22  SARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
           +A F N    +   ++KIT      D++  +   FG++ IK   C    D   Q     +
Sbjct: 54  NAEFKNYTNGKIIALNKITATSEEIDLKTGEEKYFGNIKIKLHKCIKNLDPYNQDNYLLM 113

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           +I+E   D     +F GWM + S +++  +HSIY+I+   C
Sbjct: 114 TITEYKIDEDPSLLFQGWMVSSSISLSTFEHSIYEIFAKDC 154


>gi|304321753|ref|YP_003855396.1| hypothetical protein PB2503_11034 [Parvularcula bermudensis
           HTCC2503]
 gi|303300655|gb|ADM10254.1| hypothetical protein PB2503_11034 [Parvularcula bermudensis
           HTCC2503]
          Length = 259

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 56/164 (34%), Gaps = 55/164 (33%)

Query: 15  SHAKFANSARFANKVAE-FAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE- 72
           +    A +      VA     +DKIT       + + ++A FG L + P  C  R   E 
Sbjct: 91  ALTYNAKTDNPLEPVAVTLRALDKITATFTDITIPLGETAAFGPLTLLPRTCDRRPPEEP 150

Query: 73  ----------AQRID-------------------------------------------AF 79
                     A   D                                           A 
Sbjct: 151 PETTVFLEVYAGDGDVQGQRARDARAEREAMQVEAPRSTLQLPGTQMSSGAEADTPPSAL 210

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
              + I T+ +   +F GWMFA SP++NA++H +YD+W++ CK 
Sbjct: 211 AQENVIDTEALGEDVFKGWMFASSPSLNAMEHPVYDVWVIDCKM 254


>gi|67458961|ref|YP_246585.1| hypothetical protein RF_0569 [Rickettsia felis URRWXCal2]
 gi|67004494|gb|AAY61420.1| unknown [Rickettsia felis URRWXCal2]
          Length = 157

 Score =  115 bits (288), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 43/92 (46%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDR 89
            +   ++KIT      + ++ +   FG++ IK   C    D   +     ++I+E   D 
Sbjct: 65  GKIIALNKITATSEEINFKVGEEKYFGNIKIKLHKCIKNLDPYNEDNYLLMTITEYKIDE 124

Query: 90  IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
               +F GWM + S +++  +H IY+I+   C
Sbjct: 125 DPNLLFQGWMISSSISLSTFEHPIYEIFAKDC 156


>gi|330813928|ref|YP_004358167.1| hypothetical protein SAR11G3_00953 [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487023|gb|AEA81428.1| hypothetical protein SAR11G3_00953 [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 131

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 35/130 (26%), Positives = 59/130 (45%), Gaps = 9/130 (6%)

Query: 1   MKYRVLLLILFFVFSHAKFANSARFAN--------KVAEFAGMDKITGRVLTFDVEINQS 52
           M  R+L     F+F    +A      +          A    +DKIT +  T  ++IN+ 
Sbjct: 1   MATRILAYFFLFIFLSPIYALGQGLKDVKILDSNANTANIVILDKITSKKNTHTIQINKK 60

Query: 53  AQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRS-IFSGWMFADSPAMNAIDH 111
            +F SL +    C   +   + +  AFV I +       +  I++GWMF+  P++N ++H
Sbjct: 61  YKFYSLEVLVKRCVLDNSDGSLKTSAFVQIQDPNKKNKDQVYIYNGWMFSGFPSINPMEH 120

Query: 112 SIYDIWLMQC 121
             YDIW+  C
Sbjct: 121 VNYDIWIESC 130


>gi|238651032|ref|YP_002916889.1| hypothetical protein RPR_06840 [Rickettsia peacockii str. Rustic]
 gi|238625130|gb|ACR47836.1| hypothetical protein RPR_06840 [Rickettsia peacockii str. Rustic]
          Length = 157

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 46/101 (45%), Gaps = 1/101 (0%)

Query: 22  SARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
           S+ F N    +   ++ IT      D ++ +   FG++ IK   C    D   +     +
Sbjct: 56  SSEFKNYTNGKIIALNNITATSEEIDFKVGEEKYFGNIKIKLHKCIKNLDPYNEDNYLLM 115

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           +I+E   D     +F GWM + S +++  +H IY+I+   C
Sbjct: 116 TITEYKIDEDPNLLFQGWMISSSISLSTFEHPIYEIFAKDC 156


>gi|34580588|ref|ZP_00142068.1| hypothetical protein [Rickettsia sibirica 246]
 gi|157828361|ref|YP_001494603.1| hypothetical protein A1G_02765 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933069|ref|YP_001649858.1| hypothetical protein RrIowa_0581 [Rickettsia rickettsii str. Iowa]
 gi|28261973|gb|EAA25477.1| unknown [Rickettsia sibirica 246]
 gi|157800842|gb|ABV76095.1| hypothetical protein A1G_02765 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908156|gb|ABY72452.1| hypothetical protein RrIowa_0581 [Rickettsia rickettsii str. Iowa]
          Length = 157

 Score =  115 bits (287), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 46/101 (45%), Gaps = 1/101 (0%)

Query: 22  SARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
           S+ F N    +   ++ IT      D ++ +   FG++ IK   C    D   +     +
Sbjct: 56  SSEFKNYTNGKIIALNNITATSEEIDFKVGEEKYFGNIKIKLHKCIKNLDPYNEDNYLLM 115

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           +I+E   D     +F GWM + S +++  +H IY+I+   C
Sbjct: 116 TITEYKIDEDPNLLFQGWMISSSISLSTFEHPIYEIFAKDC 156


>gi|15892410|ref|NP_360124.1| hypothetical protein RC0487 [Rickettsia conorii str. Malish 7]
 gi|15619561|gb|AAL03025.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 157

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 46/101 (45%), Gaps = 1/101 (0%)

Query: 22  SARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
           S+ F N    +   ++ IT      D ++ +   FG++ IK   C    D   +     +
Sbjct: 56  SSEFKNYTNGKIIALNNITATSEEIDFKVGEEKYFGNIKIKLHKCIKNLDPYNEDNYLLM 115

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           +I+E   D     +F GWM + S +++  +H IY+I+   C
Sbjct: 116 TITEYKIDEDPNVLFQGWMISSSISLSTFEHPIYEIFAKDC 156


>gi|258541331|ref|YP_003186764.1| hypothetical protein APA01_02320 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632409|dbj|BAH98384.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256635466|dbj|BAI01435.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256638521|dbj|BAI04483.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256641575|dbj|BAI07530.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256644630|dbj|BAI10578.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256647685|dbj|BAI13626.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256650738|dbj|BAI16672.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653729|dbj|BAI19656.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 195

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 29/157 (18%), Positives = 57/157 (36%), Gaps = 5/157 (3%)

Query: 12  FVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDR 71
            +   A +A         A    +DK+   V    V +  +A + SL I P  C  R   
Sbjct: 28  ALAPPAVYAPDTWQGKNTAVVRVLDKLDAHVEVLSVPVGTTAHYKSLDITPSRCLQRPPT 87

Query: 72  EAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISN 131
            +    A++++ +   +      F GWM A  P +   +  +YD+ +++C+    D+   
Sbjct: 88  LSPDAAAWLALQDKHPNGAT---FQGWMLAAEPTLGVFESPVYDVRMVRCEG--EDTQPM 142

Query: 132 SESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKE 168
              + K        T  +      +  +SS+      
Sbjct: 143 LPPLPKPVAPAAPPTSGSDTSPAPAGDNSSSNHAGNP 179


>gi|15604227|ref|NP_220743.1| hypothetical protein RP359 [Rickettsia prowazekii str. Madrid E]
 gi|6647974|sp|Q9ZDG9|Y359_RICPR RecName: Full=Uncharacterized protein RP359
 gi|3860919|emb|CAA14819.1| unknown [Rickettsia prowazekii]
 gi|292571968|gb|ADE29883.1| hypothetical protein rpr22_CDS352 [Rickettsia prowazekii Rp22]
          Length = 155

 Score =  114 bits (286), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 1/101 (0%)

Query: 22  SARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
           SA F N    +   ++KIT       ++  +   FG++ IK   C    D   Q     +
Sbjct: 54  SAEFKNYTNGKIIALNKITATSEEIGLKAGEEKYFGNIKIKLHKCIKNLDPYNQDNYLLM 113

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           +I+E   D     +F GWM + S +++  +H IY+I+   C
Sbjct: 114 TITEYKIDEDPTLLFQGWMVSSSISLSTFEHPIYEIFAKDC 154


>gi|254418951|ref|ZP_05032675.1| hypothetical protein BBAL3_1261 [Brevundimonas sp. BAL3]
 gi|196185128|gb|EDX80104.1| hypothetical protein BBAL3_1261 [Brevundimonas sp. BAL3]
          Length = 221

 Score =  113 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 50/113 (44%), Gaps = 7/113 (6%)

Query: 18  KFANSARFANKVAEFAGMDKITGRVLTFDVEIN-QSAQFG-SLIIKPMVCYSRDDRE-AQ 74
               + R   K A    +DK T   + F+VE+  +  +F  +LI     C      E  +
Sbjct: 109 PATPARRQRRKFAVIQAIDKTTAETMKFEVEVGGRPVRFNRNLIFSVRACEVSTPDELTE 168

Query: 75  RIDAFVSI----SEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
              A+V +             R I+ GWMFA SPA++ + +  YD W++ CK+
Sbjct: 169 DAIAYVDVSLQSRGANQPAEPRQIYRGWMFASSPAVSGLQNPNYDAWVVGCKN 221


>gi|229586626|ref|YP_002845127.1| hypothetical protein RAF_ORF0454 [Rickettsia africae ESF-5]
 gi|228021676|gb|ACP53384.1| Unknown [Rickettsia africae ESF-5]
          Length = 157

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 46/101 (45%), Gaps = 1/101 (0%)

Query: 22  SARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
           S+ F N    +   ++ IT      D+++ +   F ++ IK   C    D   +     +
Sbjct: 56  SSEFKNYTNGKIIALNNITATSEEIDLKVGEEKYFCNIKIKLHKCIKNLDPYNEDNYLLM 115

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           +I+E   D     +F GWM + S +++  +H IY+I+   C
Sbjct: 116 TITEYKIDEDPNLLFQGWMISSSISLSTFEHPIYEIFAKDC 156


>gi|157803899|ref|YP_001492448.1| hypothetical protein A1E_03660 [Rickettsia canadensis str. McKiel]
 gi|157785162|gb|ABV73663.1| hypothetical protein A1E_03660 [Rickettsia canadensis str. McKiel]
          Length = 157

 Score =  108 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 1/102 (0%)

Query: 21  NSARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79
           NS+ F N    +   ++KIT      +  + +   FG++ IK   C    D   +     
Sbjct: 55  NSSEFKNYANGKIIVLNKITATSKEMNFTVGEEQYFGNIKIKLHKCIKNLDPYNEDNYLL 114

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           ++I+E   D     +F GWM + S +++  +H IY+I+   C
Sbjct: 115 MTITEYKIDEDPNLLFQGWMTSSSISLSTFEHPIYEIFAKDC 156


>gi|91205215|ref|YP_537570.1| hypothetical protein RBE_0400 [Rickettsia bellii RML369-C]
 gi|157827446|ref|YP_001496510.1| hypothetical protein A1I_05755 [Rickettsia bellii OSU 85-389]
 gi|91068759|gb|ABE04481.1| unknown [Rickettsia bellii RML369-C]
 gi|157802750|gb|ABV79473.1| hypothetical protein A1I_05755 [Rickettsia bellii OSU 85-389]
          Length = 158

 Score =  103 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 44/91 (48%)

Query: 31  EFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRI 90
           E   ++K T +      ++ +   FG++ IK   C    D   +     ++I+E   D  
Sbjct: 67  EITALNKTTAKSEKLTFKVGEEQYFGNIKIKIHKCVKNLDPYNEDNYILMTITEYIIDED 126

Query: 91  VRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
            + +F GWM + S +++  +H IY+I+  +C
Sbjct: 127 PKLLFQGWMTSGSISLSTFEHPIYEIFAKEC 157


>gi|296114615|ref|ZP_06833268.1| hypothetical protein GXY_02521 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978971|gb|EFG85696.1| hypothetical protein GXY_02521 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 247

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/168 (14%), Positives = 55/168 (32%), Gaps = 11/168 (6%)

Query: 12  FVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDR 71
           ++     +         VA    +DK+   V   ++   Q A + SL +    C  R   
Sbjct: 32  WLAPPVMYPPDTWKGRGVAIVRILDKLDAHVQILNIPAGQDATYKSLTLHARACLERPPT 91

Query: 72  EAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISN 131
                 A++++ +          F GWM    PA+    + +YD+ ++ C       I  
Sbjct: 92  LPADTAAWLAVRDAHEGMTP---FDGWMLTQEPALGLFQNPLYDVQVVGCAGADVAPIPP 148

Query: 132 S--------ESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQ 171
                          A    ++    +   + ++  ++ +T   + + 
Sbjct: 149 PLAVVQQQATPADVPAAPSTAALGTAAMTPDGAASPATPQTATPQQAT 196


>gi|58039577|ref|YP_191541.1| hypothetical protein GOX1117 [Gluconobacter oxydans 621H]
 gi|58001991|gb|AAW60885.1| Hypothetical protein GOX1117 [Gluconobacter oxydans 621H]
          Length = 229

 Score = 91.3 bits (225), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 25/161 (15%), Positives = 56/161 (34%), Gaps = 8/161 (4%)

Query: 13  VFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDRE 72
           V   A +  +       A    +D++   +    + +  SA +  L +    C SR    
Sbjct: 32  VAPPAMYPAATWQGQSQAVVRVLDRLDAHLELLTIPVGGSATYHGLSVGVEACVSRPQTL 91

Query: 73  AQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNS 132
           A    A + + +    +  R  F GWM A  P++      +YD+ ++ C      + + +
Sbjct: 92  AADAGALLHLKDSSDPQ--RPPFDGWMLAQEPSVATYGSPLYDVRVVSC------AGAPT 143

Query: 133 ESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPL 173
              +       +    +++   +  G +        S  P+
Sbjct: 144 APQAGPLPVVKAPVLASAEVPVEEGGDAPASQPGSASGGPV 184


>gi|157964439|ref|YP_001499263.1| hypothetical protein RMA_0506 [Rickettsia massiliae MTU5]
 gi|157844215|gb|ABV84716.1| hypothetical protein RMA_0506 [Rickettsia massiliae MTU5]
          Length = 162

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 26/101 (25%), Positives = 46/101 (45%), Gaps = 1/101 (0%)

Query: 22  SARFANKV-AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFV 80
           SA F N    +   ++ IT      D ++ +   FG++ IK   C    D   +     +
Sbjct: 61  SAEFKNYTNGKIIALNNITATSEEIDFKVGEEKYFGNIKIKLHRCIKNLDPYNEDNYLLM 120

Query: 81  SISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           +I+E   D     +F GWM + S +++  +H IY+I+   C
Sbjct: 121 TITEYKIDEDPNLLFQGWMISSSISLSMFEHPIYEIFAKDC 161


>gi|162146736|ref|YP_001601195.1| hypothetical protein GDI_0914 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161785311|emb|CAP54857.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 334

 Score = 88.6 bits (218), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 24/158 (15%), Positives = 53/158 (33%), Gaps = 3/158 (1%)

Query: 16  HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQR 75
              +         VA    +D +   V +  + + Q   + +L I    C  R       
Sbjct: 28  PLVYPADTWQGRSVATVRVLDGLDSHVQSLTIPVGQDVTYRALTIHVGACRDRPATLVPD 87

Query: 76  IDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESI 135
              +++I +   D      F GWM A  P +      +Y + ++ C   I   I    ++
Sbjct: 88  SAGWLTIRDTRQDGRG---FDGWMLAGEPFLGVFQDPVYTVQIVSCTGDIVAPIPPPLTV 144

Query: 136 SKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPL 173
           +  A  + +      Q     +     ++ + +  +P+
Sbjct: 145 AATAAGQGAQAAPGVQVQGAQTQGVQIQSTQVQVPRPV 182


>gi|209543277|ref|YP_002275506.1| hypothetical protein Gdia_1108 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530954|gb|ACI50891.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 307

 Score = 85.1 bits (209), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 23/160 (14%), Positives = 49/160 (30%), Gaps = 6/160 (3%)

Query: 16  HAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQR 75
              +         VA    +D +   V +  + + Q   + +L I    C  R       
Sbjct: 28  PLVYPADTWQGRSVATVRVLDGLDSHVQSLTIPVGQDVTYRALTIHVGACRDRPATLVPD 87

Query: 76  IDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDPINDSISNS--- 132
              +++I +   D      F GWM A  P +      +Y + ++ C   I   I      
Sbjct: 88  SAGWLTIRDTRQDGRG---FDGWMLAGEPFLGVFQDPVYTVQIVSCTGDIVAPIPPPLTV 144

Query: 133 ESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQP 172
            + +    ++ +          +     S +    ++  P
Sbjct: 145 AATAAGQGAQAAPGVQVQGAQTQGVQIQSTQVQGAQAGNP 184


>gi|114328397|ref|YP_745554.1| hypothetical protein GbCGDNIH1_1733 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316571|gb|ABI62631.1| hypothetical secreted protein [Granulibacter bethesdensis CGDNIH1]
          Length = 237

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 38/99 (38%), Gaps = 3/99 (3%)

Query: 23  ARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSI 82
                   +   ++K++ RV    ++       G L +    C        Q   A++  
Sbjct: 141 PWQPGHSVQLQILEKLSDRVSRVTLKDGDRHTIGHLTVVMRNCLKHAAEAPQDFAAWL-- 198

Query: 83  SEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
            +I  D      FSGWM A  P +   +  +YD+ +M+C
Sbjct: 199 -DITADTEGAPRFSGWMLAKEPWVAVYESPLYDVRVMRC 236


>gi|262277373|ref|ZP_06055166.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
 gi|262224476|gb|EEY74935.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
          Length = 127

 Score = 74.7 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 28/105 (26%), Positives = 43/105 (40%), Gaps = 1/105 (0%)

Query: 18  KFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRID 77
           +     +  N  AE   +DKIT R+ T  + +          I    C     +      
Sbjct: 22  ELVKVLKNDNNYAEIKIIDKITSRLSTKKINLKTLKNIKDFEIFIDKCVLDTRKGFLETS 81

Query: 78  AFVSISEIFTDRIVR-SIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
           A V I ++      R  +F+ WMFA + ++N I+H  YDI L  C
Sbjct: 82  ALVQIKDVKNQTKDRVFLFNNWMFASNSSINEIEHPNYDISLKSC 126


>gi|218680000|ref|ZP_03527897.1| hypothetical protein RetlC8_14346 [Rhizobium etli CIAT 894]
          Length = 40

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/40 (40%), Positives = 24/40 (60%)

Query: 99  MFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKK 138
           MFA SP +NA++H IYD+WL  CK   +    +S   + +
Sbjct: 1   MFAASPGLNAVEHPIYDVWLKDCKTNSDVPAPDSAKATAR 40


>gi|148259192|ref|YP_001233319.1| hypothetical protein Acry_0172 [Acidiphilium cryptum JF-5]
 gi|146400873|gb|ABQ29400.1| hypothetical protein Acry_0172 [Acidiphilium cryptum JF-5]
          Length = 193

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 14/91 (15%), Positives = 27/91 (29%), Gaps = 3/91 (3%)

Query: 15  SHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQ 74
           +  K         + A    ++K  G V      +  S   G+L +    C  R      
Sbjct: 87  APPKQVKPIWDPRQAAILDVLEKADGAVNRIIAPVGSSFTEGALRVTIGACVVRPADMPP 146

Query: 75  RIDAFVSISEIFTDRIVRSIFSGWMFADSPA 105
               ++++           +F GW+    P 
Sbjct: 147 DAAVYMTVR---HGMAAPDLFRGWLIRSEPG 174


>gi|326402345|ref|YP_004282426.1| hypothetical protein ACMV_01970 [Acidiphilium multivorum AIU301]
 gi|325049206|dbj|BAJ79544.1| hypothetical protein ACMV_01970 [Acidiphilium multivorum AIU301]
          Length = 193

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 14/91 (15%), Positives = 27/91 (29%), Gaps = 3/91 (3%)

Query: 15  SHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQ 74
           +  K         + A    ++K  G V      +  S   G+L +    C  R      
Sbjct: 87  APPKQVKPIWDPRQAAILDVLEKADGAVNRIIAPVGSSFTEGALRVTIGACVVRPADMPP 146

Query: 75  RIDAFVSISEIFTDRIVRSIFSGWMFADSPA 105
               ++++           +F GW+    P 
Sbjct: 147 DAAVYMTVR---HGMAAPDLFRGWLIRSEPG 174


>gi|319790199|ref|YP_004151832.1| hypothetical protein Theam_1227 [Thermovibrio ammonificans HB-1]
 gi|317114701|gb|ADU97191.1| hypothetical protein Theam_1227 [Thermovibrio ammonificans HB-1]
          Length = 248

 Score = 52.7 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 40/96 (41%), Gaps = 15/96 (15%)

Query: 30  AEFAGMDKITGRVL-TFDVEINQSAQFGSLIIK---------PMVCYSRDDREAQRIDAF 79
           A    +DK TG+V+  F V   Q+  +G L IK             Y+    E Q     
Sbjct: 149 ATIDIVDKTTGKVVKEFKVSKGQTVNYGGLEIKILYIVPHLVLDNGYTSASNEPQNPAIL 208

Query: 80  VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYD 115
           V + E       ++I++G ++   P M  I+H  Y+
Sbjct: 209 VEVKE-----NGKTIYAGPIYQKFPTMYNINHPRYE 239


>gi|222054292|ref|YP_002536654.1| hypothetical protein Geob_1193 [Geobacter sp. FRC-32]
 gi|221563581|gb|ACM19553.1| conserved hypothetical protein [Geobacter sp. FRC-32]
          Length = 161

 Score = 48.5 bits (114), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 34/99 (34%), Gaps = 17/99 (17%)

Query: 28  KVAEFAGMDKITGRVLTFDVEINQSAQF--GSLIIKP----------MVCYSRDDREAQR 75
           K  + A  DK T +   + V I        G+L +K               +    E + 
Sbjct: 57  KAVKIAVTDKTTKKDTIYTVNIGAEVTLPGGNLTLKVDNFLPQFVMEGTTLTSQSNEPKN 116

Query: 76  IDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIY 114
             A V + E       + IF GW+F   P  +A  H  Y
Sbjct: 117 PAAQVRVIE-----NGKEIFKGWLFTLYPTTHAFQHPRY 150


>gi|148262371|ref|YP_001229077.1| hypothetical protein Gura_0288 [Geobacter uraniireducens Rf4]
 gi|146395871|gb|ABQ24504.1| hypothetical protein Gura_0288 [Geobacter uraniireducens Rf4]
          Length = 157

 Score = 44.6 bits (104), Expect = 0.009,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 33/99 (33%), Gaps = 17/99 (17%)

Query: 28  KVAEFAGMDKITGRVLTFDVEINQSAQF--GSLIIKP----------MVCYSRDDREAQR 75
           K  + A  DK T +   + V I         +L IK               +    E + 
Sbjct: 53  KAVKIAVTDKNTKKDTVYTVNIGSELALPNSNLTIKVENFLPHFMMEGTTLTSQSNEPKN 112

Query: 76  IDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIY 114
             A V + E       + IF GW+F   P  +A  H  Y
Sbjct: 113 PAAQVRVIE-----NGKEIFKGWLFTLYPTTHAFQHPRY 146


>gi|220913989|ref|YP_002489298.1| GCN5-related N-acetyltransferase [Arthrobacter chlorophenolicus A6]
 gi|219860867|gb|ACL41209.1| GCN5-related N-acetyltransferase [Arthrobacter chlorophenolicus A6]
          Length = 228

 Score = 41.6 bits (96), Expect = 0.071,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 32/93 (34%), Gaps = 2/93 (2%)

Query: 108 AIDHSIYDIWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEK 167
           A+DH ++ +W +Q KDP   +     +      +     +     +     +   +    
Sbjct: 60  AMDHPVHAVWAVQLKDPAQQANPTRPTNPAHPTNPAQQANPAQPTNPPQQ-TDPAQPRIP 118

Query: 168 ESSQPLENNLSMDLKGRPIQELGNNLSDSGLNE 200
             S+P     ++ LK  P       L  SG  E
Sbjct: 119 GHSKPALA-GTLLLKSIPASGAALPLQPSGDTE 150


>gi|291238160|ref|XP_002739003.1| PREDICTED: target of myb1-like [Saccoglossus kowalevskii]
          Length = 543

 Score = 40.8 bits (94), Expect = 0.12,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 43/126 (34%), Gaps = 21/126 (16%)

Query: 100 FADSPAMNAI------------DHSIYDIWLMQCKDPI-NDSISNSESISKKALSEYSST 146
           F  SP +  +            +    D   + C  PI     +  E       S   + 
Sbjct: 127 FRSSPDLQGVVQMYNELKQKGIEFPATD---LDCMSPIYTPDRTVPEPAVPPPQSRPPTR 183

Query: 147 DITSQGSEKSSGSSSNKTLEKESSQPLEN----NLSMDLKGRPIQELGNNLSDSGLNEQD 202
             T Q    +S +S  + ++   +   E        +D+ G  ++ +   L++   N  D
Sbjct: 184 QPTQQQRP-ASAASPAQFVQGPVNPTAEQMAKLRSELDVVGGNVRVMSEMLNEMQPNSSD 242

Query: 203 HNDVQI 208
            +DV++
Sbjct: 243 SSDVEL 248


>gi|238023013|ref|ZP_04603439.1| hypothetical protein GCWU000324_02935 [Kingella oralis ATCC 51147]
 gi|237865821|gb|EEP66959.1| hypothetical protein GCWU000324_02935 [Kingella oralis ATCC 51147]
          Length = 484

 Score = 40.4 bits (93), Expect = 0.14,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 34/83 (40%), Gaps = 10/83 (12%)

Query: 122 KDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKES-----SQPLENN 176
           + P   +++ + +    A  +       ++  +    +   +    ++     +QP++N 
Sbjct: 73  ETPSEPTVAPNPAKPTPAPQQTHPEKPKTELPQPKPQTQPAEKPTAKAALQLTAQPIDNE 132

Query: 177 LSMDLKGRP-----IQELGNNLS 194
           +S+ +  +P      QE+  NL+
Sbjct: 133 ISVTINAKPDFQAAEQEISVNLA 155


>gi|315153108|gb|EFT97124.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecalis TX0031]
          Length = 749

 Score = 40.0 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 33/83 (39%), Gaps = 1/83 (1%)

Query: 122 KDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDL 181
           ++P  D   N+     K     +S +        +SG   +K  E ++S   E +   D 
Sbjct: 582 EEPDKDKDPNASGEPDKDKEPDASGEPDKDKEPNASG-EPDKDKEPDASGEPEKDKDSDA 640

Query: 182 KGRPIQELGNNLSDSGLNEQDHN 204
            G+P ++     S+  +  +D N
Sbjct: 641 SGKPEKDKETKTSEGPIERKDQN 663


>gi|229548973|ref|ZP_04437698.1| 6-aminohexanoate-cyclic-dimer hydrolase [Enterococcus faecalis ATCC
           29200]
 gi|229305994|gb|EEN71990.1| 6-aminohexanoate-cyclic-dimer hydrolase [Enterococcus faecalis ATCC
           29200]
 gi|315156881|gb|EFU00898.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecalis TX0043]
 gi|315157668|gb|EFU01685.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecalis TX0312]
          Length = 749

 Score = 40.0 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 33/83 (39%), Gaps = 1/83 (1%)

Query: 122 KDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDL 181
           ++P  D   N+     K     +S +        +SG   +K  E ++S   E +   D 
Sbjct: 582 EEPDKDKDPNASGEPDKDKEPDASGEPDKDKEPNASG-EPDKDKEPDASGEPEKDKDSDA 640

Query: 182 KGRPIQELGNNLSDSGLNEQDHN 204
            G+P ++     S+  +  +D N
Sbjct: 641 SGKPEKDKETKTSEGPIERKDQN 663


>gi|156363424|ref|XP_001626044.1| predicted protein [Nematostella vectensis]
 gi|156212905|gb|EDO33944.1| predicted protein [Nematostella vectensis]
          Length = 1194

 Score = 40.0 bits (92), Expect = 0.21,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 49/133 (36%), Gaps = 14/133 (10%)

Query: 82  ISEIFTDRIVRSIFSGWMFADSPAMNAI-DHSIYDIWLMQCKDPINDSISNSESISKKAL 140
           ++ + T + +     G +  +S A+NA+     YDI           S    +  S    
Sbjct: 584 VTHMLTGKAISRAIRGHLLVNS-ALNAMLASKTYDI------TLPTKSNEVKDPASDPQQ 636

Query: 141 SEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDLKGRPIQ---ELGNNLSDSG 197
              S  D      +  +   ++   E +   PL      ++ G P Q   ++ N  S   
Sbjct: 637 DAASPLDTVDAELQLETVVEASPESESDEQTPLTRQ---EVNGAPFQPSTQISNVGSSQT 693

Query: 198 LNEQDHNDVQISK 210
           L+E   +DV ++K
Sbjct: 694 LDEIQEDDVTLAK 706


>gi|253698746|ref|YP_003019935.1| hypothetical protein GM21_0090 [Geobacter sp. M21]
 gi|251773596|gb|ACT16177.1| conserved hypothetical protein [Geobacter sp. M21]
          Length = 159

 Score = 40.0 bits (92), Expect = 0.23,   Method: Composition-based stats.
 Identities = 18/99 (18%), Positives = 33/99 (33%), Gaps = 17/99 (17%)

Query: 28  KVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMV------------CYSRDDREAQR 75
           K  E A  DK   +   + +++    +     +   V              +    E   
Sbjct: 55  KAVEIAVSDKQHNQQKVYTLQLGSEVKIPGSNLTLRVENFLPHFVMEGTTLTSQSNELVN 114

Query: 76  IDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIY 114
             A + I E       + I+ GW+F+  P  +A  H +Y
Sbjct: 115 PAAQIVIRE-----DAKEIYKGWLFSLYPTTHAFQHPLY 148


>gi|255971485|ref|ZP_05422071.1| predicted protein [Enterococcus faecalis T1]
 gi|255962503|gb|EET94979.1| predicted protein [Enterococcus faecalis T1]
          Length = 669

 Score = 39.6 bits (91), Expect = 0.24,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 33/83 (39%), Gaps = 1/83 (1%)

Query: 122 KDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDL 181
           ++P  D   N+     K     +S +        +SG   +K  E ++S   E +   D 
Sbjct: 502 EEPDKDKDPNASGEPDKDKEPDASGEPDKDKEPNASG-EPDKDKEPDASGEPEKDKDSDA 560

Query: 182 KGRPIQELGNNLSDSGLNEQDHN 204
            G+P ++     S+  +  +D N
Sbjct: 561 SGKPEKDKETKTSEGPIERKDQN 583


>gi|257421280|ref|ZP_05598270.1| lipoamidase [Enterococcus faecalis X98]
 gi|257163104|gb|EEU93064.1| lipoamidase [Enterococcus faecalis X98]
          Length = 725

 Score = 39.6 bits (91), Expect = 0.24,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 33/83 (39%), Gaps = 1/83 (1%)

Query: 122 KDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDL 181
           ++P  D   N+     K     +S +        +SG   +K  E ++S   E +   D 
Sbjct: 558 EEPDKDKDPNASGEPDKDKEPDASGEPDKDKEPNASG-EPDKDKEPDASGEPEKDKDSDA 616

Query: 182 KGRPIQELGNNLSDSGLNEQDHN 204
            G+P ++     S+  +  +D N
Sbjct: 617 SGKPEKDKETKTSEGPIERKDQN 639


>gi|322492395|emb|CBZ27669.1| conserved hypothetical protein [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 758

 Score = 39.3 bits (90), Expect = 0.33,   Method: Composition-based stats.
 Identities = 14/78 (17%), Positives = 29/78 (37%), Gaps = 5/78 (6%)

Query: 106 MNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTL 165
           ++A  HS Y I  + C  PI ++ +  +          S+    +   +  +   + +  
Sbjct: 366 LSASQHSSYAI-SIACPTPIRNTHAGPD--EPTPPRHDSAGPPAAYAIDPVTAREAGEHA 422

Query: 166 EKESSQPLENNLSMDLKG 183
           E   S     +  +D KG
Sbjct: 423 EPRRSD--NESPDVDYKG 438


>gi|307275515|ref|ZP_07556657.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecalis TX2134]
 gi|306507903|gb|EFM77031.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecalis TX2134]
          Length = 749

 Score = 39.3 bits (90), Expect = 0.37,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 33/83 (39%), Gaps = 1/83 (1%)

Query: 122 KDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDL 181
           ++P  D   N+     K     +S +        +SG   +K  E ++S   E +   D 
Sbjct: 582 EEPDKDKDPNASGEPDKDKEPDASGEPDKDKEPNASG-EPDKDKEPDASGEPEKDKDSDA 640

Query: 182 KGRPIQELGNNLSDSGLNEQDHN 204
            G+P ++     S+  +  +D N
Sbjct: 641 SGKPEKDKETKTSEGPIEGKDQN 663


>gi|114776981|ref|ZP_01452001.1| hypothetical protein SPV1_06454 [Mariprofundus ferrooxydans PV-1]
 gi|114552502|gb|EAU54962.1| hypothetical protein SPV1_06454 [Mariprofundus ferrooxydans PV-1]
          Length = 168

 Score = 38.9 bits (89), Expect = 0.41,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 41/118 (34%), Gaps = 14/118 (11%)

Query: 12  FVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKP--------- 62
            V SH    + A      AE   + K T  ++   + +  +A      I+          
Sbjct: 45  AVQSHVTVPDWATARQGDAELVWLQKSTTHLVHTKLALGDAADVEGWHIRLLGLASGLRV 104

Query: 63  MVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQ 120
                 DD       A V IS     R  + ++ GW+F + P +  +D   + +WL  
Sbjct: 105 KNSTFLDDENVHNPAALVEIS-----RGGKVVYRGWLFQEFPELFGLDDPEWKVWLKG 157


>gi|194756166|ref|XP_001960350.1| GF13317 [Drosophila ananassae]
 gi|190621648|gb|EDV37172.1| GF13317 [Drosophila ananassae]
          Length = 660

 Score = 38.9 bits (89), Expect = 0.45,   Method: Composition-based stats.
 Identities = 19/109 (17%), Positives = 47/109 (43%), Gaps = 16/109 (14%)

Query: 99  MFAD-SPAMNAIDHS----IYDIWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGS 153
           M A  SP +++++H+     Y     + K+   + ++     + +A+ + SS D  +  +
Sbjct: 511 MIAMISPGLHSVEHTLNTLRY---ANRVKELTVELVTRRTPNTVEAMPQSSSGDDETPTT 567

Query: 154 EKSSGSS-------SNKTLEKESSQPLENNLSMDLKGRPIQELGNNLSD 195
           +  S            +    +SS  L  ++   ++  P ++ G +L+D
Sbjct: 568 DPGSQPDVIYSSTVPEQYPLAKSSTSLAKDVGRVMRESPARQ-GTSLND 615


>gi|197116509|ref|YP_002136936.1| lipoprotein [Geobacter bemidjiensis Bem]
 gi|197085869|gb|ACH37140.1| lipoprotein, putative [Geobacter bemidjiensis Bem]
          Length = 159

 Score = 38.5 bits (88), Expect = 0.55,   Method: Composition-based stats.
 Identities = 9/31 (29%), Positives = 16/31 (51%)

Query: 84  EIFTDRIVRSIFSGWMFADSPAMNAIDHSIY 114
           +I      + I+ GW+F+  P  +A  H +Y
Sbjct: 118 QIVIREDAKEIYKGWLFSLYPTTHAFQHPLY 148


>gi|330976435|gb|EGH76490.1| hypothetical protein PSYAP_07299 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 176

 Score = 38.5 bits (88), Expect = 0.57,   Method: Composition-based stats.
 Identities = 14/94 (14%), Positives = 32/94 (34%), Gaps = 15/94 (15%)

Query: 99  MFADSPAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSG 158
           M + SP ++A               P        ++   +     +      +G+++  G
Sbjct: 15  MISASPLLHA-------------APPDQRGNGPDDNRGVQQPGPQNDGGPNQRGNDRGPG 61

Query: 159 SSSNKTLEKESSQPLENNLSMDLKG--RPIQELG 190
           + + +  +K  +         D +G  RP Q+ G
Sbjct: 62  NDNGRGPDKGPASQPGRQAHQDNRGGNRPPQDFG 95


>gi|119186255|ref|XP_001243734.1| hypothetical protein CIMG_03175 [Coccidioides immitis RS]
          Length = 888

 Score = 38.5 bits (88), Expect = 0.66,   Method: Composition-based stats.
 Identities = 13/73 (17%), Positives = 26/73 (35%), Gaps = 4/73 (5%)

Query: 116 IWLMQCKDPIN-DSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLE 174
           + +  C  P+   + S    +  +A S  + +D  +         SS +  E   + P +
Sbjct: 397 VTVYDCPTPLPAATDSGPVELPPQAPSTAAPSDTVA---PPGQSPSSPRQPESSEASPSQ 453

Query: 175 NNLSMDLKGRPIQ 187
             +S      P Q
Sbjct: 454 TTVSSPPAPTPSQ 466


>gi|194884922|ref|XP_001976353.1| GG20064 [Drosophila erecta]
 gi|190659540|gb|EDV56753.1| GG20064 [Drosophila erecta]
          Length = 624

 Score = 38.1 bits (87), Expect = 0.71,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 43/97 (44%), Gaps = 11/97 (11%)

Query: 99  MFAD-SPAMNAIDHS----IYDIWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGS 153
           M A  SP +++++H+     Y     + K+   +S+S  + +   +L   S  DI SQ  
Sbjct: 492 MIAMISPGLHSVEHTLNTLRY---ADRVKELSVESMS-PKRMQGPSLESTSMPDIISQSP 547

Query: 154 EKSSGSSSNKTLEKESSQPLENNLSM--DLKGRPIQE 188
            K    S++ T  + +  P +  L+   DL     QE
Sbjct: 548 SKRLFPSASSTSLRGAGNPAQKELNTTNDLNRAQKQE 584


>gi|302420585|ref|XP_003008123.1| ubiquitin thioesterase OTUB1 [Verticillium albo-atrum VaMs.102]
 gi|261353774|gb|EEY16202.1| ubiquitin thioesterase OTUB1 [Verticillium albo-atrum VaMs.102]
          Length = 648

 Score = 38.1 bits (87), Expect = 0.81,   Method: Composition-based stats.
 Identities = 24/109 (22%), Positives = 41/109 (37%), Gaps = 20/109 (18%)

Query: 102 DSP-AMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSEYSSTDITSQ--------- 151
            SP A++ + H+ YD        P   +   S   S  A+ + +    ++          
Sbjct: 532 ASPTAVSPM-HNAYD--------PSPQTPWLSAPFSDSAMQQTAPPAPSAALGLLRTQPR 582

Query: 152 GSEKSSGSSSNKTLEKESSQPLENNLSMDLKGRPIQELGNNLSDSGLNE 200
               SS + S     K  SQP++  L + L   P +EL +      L+E
Sbjct: 583 QPPPSSTTGSQAAPSKP-SQPVDYQLRVQLPMFPPEELSHRADVDALSE 630


>gi|70949310|ref|XP_744078.1| hypothetical protein [Plasmodium chabaudi chabaudi]
 gi|56523875|emb|CAH78554.1| hypothetical protein PC105047.00.0 [Plasmodium chabaudi chabaudi]
          Length = 602

 Score = 38.1 bits (87), Expect = 0.82,   Method: Composition-based stats.
 Identities = 13/78 (16%), Positives = 30/78 (38%), Gaps = 14/78 (17%)

Query: 123 DPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESS--------QPLE 174
            P  ++I      +K++  +   +    Q  ++S   S +++ +K ++        QP  
Sbjct: 474 TPTKETIPPP--YNKESEPQMPPSSSRDQSPDQSRDQSPDQSTDKPANKSADKPTGQPTN 531

Query: 175 NNLSM----DLKGRPIQE 188
            N+       L   P+ E
Sbjct: 532 QNVESINPNSLMTTPVNE 549


>gi|297260528|ref|XP_001103660.2| PREDICTED: uncharacterized protein KIAA0819 [Macaca mulatta]
          Length = 2001

 Score = 38.1 bits (87), Expect = 0.86,   Method: Composition-based stats.
 Identities = 18/89 (20%), Positives = 28/89 (31%), Gaps = 8/89 (8%)

Query: 122  KDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDL 181
            + P +            +    S   I SQ    +  +  + T      QP+    S  L
Sbjct: 1233 RTPASPGSPQPRPPVAASTPPPSPLPICSQPQPSTEAAVPSPTQSPIRFQPVPAKTSTPL 1292

Query: 182  KGRPIQ-------ELGNNLS-DSGLNEQD 202
               P+Q        LG+ L+ D  L   D
Sbjct: 1293 APLPVQSQSDTKDRLGSPLAVDEALRRSD 1321


>gi|119500180|ref|XP_001266847.1| C6 finger domain protein, putative [Neosartorya fischeri NRRL 181]
 gi|119415012|gb|EAW24950.1| C6 finger domain protein, putative [Neosartorya fischeri NRRL 181]
          Length = 776

 Score = 37.7 bits (86), Expect = 1.0,   Method: Composition-based stats.
 Identities = 9/59 (15%), Positives = 24/59 (40%)

Query: 127 DSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDLKGRP 185
            + S++E  + + + + +         E +      +T +  + QP E + S  ++  P
Sbjct: 17  QAASSTEQPAAETVPDQTPRPPAENAPETTPQPMPEQTPQAAAEQPTETSSSAPVQALP 75


>gi|251791621|ref|YP_003006342.1| signal recognition particle-docking protein FtsY [Dickeya zeae
           Ech1591]
 gi|247540242|gb|ACT08863.1| signal recognition particle-docking protein FtsY [Dickeya zeae
           Ech1591]
          Length = 452

 Score = 37.7 bits (86), Expect = 1.1,   Method: Composition-based stats.
 Identities = 12/66 (18%), Positives = 27/66 (40%), Gaps = 1/66 (1%)

Query: 123 DPINDSISNSESISKKALSEYSS-TDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDL 181
            P+ ++   ++  +  A        D+  +  E+ S  +         SQP E ++ ++L
Sbjct: 27  QPVPEATQAADEATPAAPESAQKIDDVAPEQPEQRSAPAETAQTTSPESQPTEASIPVEL 86

Query: 182 KGRPIQ 187
              P+Q
Sbjct: 87  PETPVQ 92


>gi|168273098|dbj|BAG10388.1| MICAL-3 protein [synthetic construct]
          Length = 1918

 Score = 37.7 bits (86), Expect = 1.1,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 40/113 (35%), Gaps = 11/113 (9%)

Query: 101  ADSPA-MNAIDHSIYD--IWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSS 157
            AD+P+ + A+   I    + L + + P++            +    S   I SQ    + 
Sbjct: 1126 ADAPSDLKAVHSPIRSQPVTLPEARTPVSPGSPQPRPPVAASTPPPSPLPICSQPQPSTE 1185

Query: 158  GSSSNKTLEKESSQPLENNLSMDLKGRPIQ-------ELGNNLS-DSGLNEQD 202
             +  + T      QP     S  L   P+Q        LG+ L+ D  L   D
Sbjct: 1186 ATVPSPTQSPIRFQPAPAKTSTPLAPLPVQSQSDTKDRLGSPLAVDEALRRSD 1238


>gi|332859095|ref|XP_001151830.2| PREDICTED: protein MICAL-3 [Pan troglodytes]
          Length = 2221

 Score = 37.3 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 40/113 (35%), Gaps = 11/113 (9%)

Query: 101  ADSPA-MNAIDHSIYD--IWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSS 157
            AD+P+ + A+   I    + L + + P++            +    S   I SQ    + 
Sbjct: 1429 ADAPSDLKAVHSPIRSQPVTLPEARTPVSPGSPQPRPPVAASTPPPSPLPICSQPQPSTE 1488

Query: 158  GSSSNKTLEKESSQPLENNLSMDLKGRPIQ-------ELGNNLS-DSGLNEQD 202
             +  + T      QP     S  L   P+Q        LG+ L+ D  L   D
Sbjct: 1489 ATVPSPTQSPIRFQPAPAKTSTPLAPLPVQSQSDTKDRLGSPLAVDEALRRSD 1541


>gi|256761790|ref|ZP_05502370.1| amidase [Enterococcus faecalis T3]
 gi|256683041|gb|EEU22736.1| amidase [Enterococcus faecalis T3]
          Length = 667

 Score = 37.3 bits (85), Expect = 1.3,   Method: Composition-based stats.
 Identities = 17/82 (20%), Positives = 31/82 (37%), Gaps = 1/82 (1%)

Query: 123 DPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDLK 182
           +P  D   N+     K     +S +        +SG    K  E ++S   E +   D  
Sbjct: 501 EPEKDKDPNASGEPDKDKEPDASGEPDKDKEPDASG-EPEKDKEPDASGEPEKDKDSDAS 559

Query: 183 GRPIQELGNNLSDSGLNEQDHN 204
           G+P ++     S+  +  +D N
Sbjct: 560 GKPDKDKETKTSEGPIEGKDQN 581


>gi|320037142|gb|EFW19080.1| HEAT repeat protein [Coccidioides posadasii str. Silveira]
          Length = 2050

 Score = 36.9 bits (84), Expect = 1.5,   Method: Composition-based stats.
 Identities = 9/67 (13%), Positives = 27/67 (40%)

Query: 116  IWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLEN 175
            +W+ +C   +  +   S+ I     +  ++        E +  +++  T  +++ +P   
Sbjct: 1224 VWVQRCHKVLTKTRPKSDEIPSPNTAAANTGGAELPDDEVAGFATAAATENRDAGEPDSP 1283

Query: 176  NLSMDLK 182
            +    LK
Sbjct: 1284 SGQEMLK 1290


>gi|303324285|ref|XP_003072130.1| HEAT repeat containing protein [Coccidioides posadasii C735 delta
            SOWgp]
 gi|240111840|gb|EER29985.1| HEAT repeat containing protein [Coccidioides posadasii C735 delta
            SOWgp]
          Length = 2003

 Score = 36.9 bits (84), Expect = 1.5,   Method: Composition-based stats.
 Identities = 9/67 (13%), Positives = 27/67 (40%)

Query: 116  IWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLEN 175
            +W+ +C   +  +   S+ I     +  ++        E +  +++  T  +++ +P   
Sbjct: 1224 VWVQRCHKVLTKTRPKSDEIPSPNTAAANTGGAELPDDEVAGFATAAATENRDAGEPDSP 1283

Query: 176  NLSMDLK 182
            +    LK
Sbjct: 1284 SGQEMLK 1290


>gi|301777123|ref|XP_002923977.1| PREDICTED: DNA repair protein XRCC1-like [Ailuropoda melanoleuca]
 gi|281352510|gb|EFB28094.1| hypothetical protein PANDA_013214 [Ailuropoda melanoleuca]
          Length = 630

 Score = 36.9 bits (84), Expect = 1.8,   Method: Composition-based stats.
 Identities = 18/107 (16%), Positives = 32/107 (29%), Gaps = 21/107 (19%)

Query: 117 WLMQC------------------KDPINDSISNSESISKKALSEYSSTDITSQGSEKSSG 158
           W++ C                      ++  S+S     +A         T     +++G
Sbjct: 382 WVLDCHRMRRRLPSRRYLMAGPGSSSEDEGTSHSGGSGDEAPKLPQKRPQTKTKPPQAAG 441

Query: 159 SSSNKTLEKESSQPLENNL---SMDLKGRPIQELGNNLSDSGLNEQD 202
            SS +  +        +       D  G   +E GN   DSG  E +
Sbjct: 442 PSSPQRPKTPEETKPASPGPQEDTDTDGEHSEEQGNGAEDSGDTEDE 488


>gi|119173480|ref|XP_001239183.1| hypothetical protein CIMG_10205 [Coccidioides immitis RS]
          Length = 2003

 Score = 36.9 bits (84), Expect = 1.8,   Method: Composition-based stats.
 Identities = 9/67 (13%), Positives = 26/67 (38%)

Query: 116  IWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLEN 175
            +W+ +C   +  +   S+ I     +  ++        E +  +++  T  +++ +P   
Sbjct: 1184 VWVQRCHKVLTKTRPKSDEIPSPNTAAANTGGAELPDDEVAGFATAAATENRDAGEPDSP 1243

Query: 176  NLSMDLK 182
                 LK
Sbjct: 1244 TGQEMLK 1250


>gi|117164843|emb|CAJ88392.1| putative membrane protein [Streptomyces ambofaciens ATCC 23877]
          Length = 751

 Score = 36.6 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 14/88 (15%), Positives = 29/88 (32%), Gaps = 2/88 (2%)

Query: 118 LMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNL 177
           ++ C +   +   ++   ++    E      T  G+  +S   + +T    +        
Sbjct: 508 MVDCINSGRECGPDTPPGAEPGEGEGPQEQPT--GTPDASQPPAEQTPTASAPADAGQGG 565

Query: 178 SMDLKGRPIQELGNNLSDSGLNEQDHND 205
             D K     E  N   D+G  +   ND
Sbjct: 566 QNDGKDEGNDEGNNEGDDTGQQDGGRND 593


>gi|332258583|ref|XP_003278377.1| PREDICTED: protein MICAL-3 [Nomascus leucogenys]
          Length = 2002

 Score = 36.2 bits (82), Expect = 2.7,   Method: Composition-based stats.
 Identities = 18/89 (20%), Positives = 28/89 (31%), Gaps = 8/89 (8%)

Query: 122  KDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDL 181
            + P++            +    S   I SQ    +  +  + T      QP     S  L
Sbjct: 1234 RTPVSPGSPQPRPPVAASTPPPSPLPICSQPQPSTEATVPSPTQSPIRFQPAPAKTSTPL 1293

Query: 182  KGRPIQ-------ELGNNLS-DSGLNEQD 202
               P+Q        LG+ L+ D  L   D
Sbjct: 1294 APLPVQSQSDTKDRLGSPLAVDEALRRSD 1322


>gi|322695589|gb|EFY87394.1| hypothetical protein MAC_06502 [Metarhizium acridum CQMa 102]
          Length = 345

 Score = 36.2 bits (82), Expect = 3.2,   Method: Composition-based stats.
 Identities = 13/80 (16%), Positives = 28/80 (35%), Gaps = 1/80 (1%)

Query: 120 QCKDPINDSISNSESISK-KALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLS 178
            C+  ++D      +I      SEY +       +   S +      +   S     +++
Sbjct: 93  DCRTCVSDDAGPKTNIQPLPGRSEYRTLRPLPSETPNPSVADPVSHDDSRKSLRKNGDVN 152

Query: 179 MDLKGRPIQELGNNLSDSGL 198
            +++    +     LSD GL
Sbjct: 153 AEVRLEKTKRSYAQLSDDGL 172


>gi|241997916|ref|XP_002433601.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215495360|gb|EEC05001.1| conserved hypothetical protein [Ixodes scapularis]
          Length = 639

 Score = 35.8 bits (81), Expect = 3.4,   Method: Composition-based stats.
 Identities = 18/98 (18%), Positives = 35/98 (35%), Gaps = 1/98 (1%)

Query: 112 SIY-DIWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESS 170
            ++ D W   C    +D +   +   ++   E    D     S +  G+ +    +    
Sbjct: 354 PVFSDGWAPDCSTGSDDQMMPQQPHPRRRSQEERMQDAFKTASPRRPGTQTPSEPDLHDP 413

Query: 171 QPLENNLSMDLKGRPIQELGNNLSDSGLNEQDHNDVQI 208
           +   + LS+D   RP  +        GL +Q    VQ+
Sbjct: 414 RDQRSELSVDSMERPDPQRQWRAWADGLRDQGAKLVQV 451


>gi|195332652|ref|XP_002033011.1| GM20646 [Drosophila sechellia]
 gi|194124981|gb|EDW47024.1| GM20646 [Drosophila sechellia]
          Length = 1627

 Score = 35.8 bits (81), Expect = 3.5,   Method: Composition-based stats.
 Identities = 19/106 (17%), Positives = 44/106 (41%), Gaps = 3/106 (2%)

Query: 104 PAMNAIDHSIYDIWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNK 163
           P  +A DH I  ++  +    I   + +  S    +  E SST   +Q  +        +
Sbjct: 330 PPEHADDHHI--VFTTEVPTKIASGLQDQTSSESNSFEEVSSTPAATQKPKTKPTQKPTQ 387

Query: 164 TLEKESSQPLENNLSMDLKGRPIQELGNNLSDSGLNEQDHNDVQIS 209
              ++++Q      + + K +P+ +L  ++    + ++   D+Q S
Sbjct: 388 KPTQKATQKPTPKPTQNAKPKPVPQLAESMKRP-IQQKPQQDLQFS 432


>gi|328772569|gb|EGF82607.1| hypothetical protein BATDEDRAFT_86540 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 1169

 Score = 35.8 bits (81), Expect = 3.9,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 23/54 (42%)

Query: 137 KKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDLKGRPIQELG 190
            +   E +      Q  E+  G +  + LE+   Q LE     +L+  P QELG
Sbjct: 609 PEQELEQTPEQELEQTPEQELGQTPEQELEQTPEQELEQTPEQELEQTPEQELG 662


>gi|313224517|emb|CBY20307.1| unnamed protein product [Oikopleura dioica]
          Length = 1425

 Score = 35.4 bits (80), Expect = 4.5,   Method: Composition-based stats.
 Identities = 27/155 (17%), Positives = 55/155 (35%), Gaps = 21/155 (13%)

Query: 55  FGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIY 114
            GS  +      S  D E    +AF +  E  +D          M A+ P + A +H   
Sbjct: 1   MGSTPMTAAAIESPSDAEVMATEAFPTAPEYDSDADT-------MVAE-PLLTAAEH--- 49

Query: 115 DIWLMQCKDPINDSISNSE---SISKKALSEYSSTDITSQGSEKSSGSSS----NKTLEK 167
              +   K P    + + E   S S+++  + +  + ++  + +           K    
Sbjct: 50  ---VESLKLPPGFRLVDIEIGESDSEESDDDEADEEPSTAEAPRGRIEQPALRATKRRSA 106

Query: 168 ESSQPLENNLSMDLKGRPIQELGNNLSDSGLNEQD 202
            +S P +  L+      P+++         L+E+D
Sbjct: 107 PASTPRKERLARQELKLPVEQRTPEEVSRSLHEKD 141


>gi|73949150|ref|XP_849640.1| PREDICTED: hypothetical protein XP_844547 [Canis familiaris]
          Length = 564

 Score = 35.4 bits (80), Expect = 4.6,   Method: Composition-based stats.
 Identities = 8/60 (13%), Positives = 20/60 (33%), Gaps = 3/60 (5%)

Query: 115 DIWLMQCKDPINDSISNSESISKKALS--EYSSTDITSQGSEKSSGSSSNKTLEKESSQP 172
           D+ +++C+ P      +  S + +A            +    K   +   +  +   S P
Sbjct: 237 DV-VVECRKPEAGGPPSPGSAAPEAPPVLPARPVATAATSPRKELLAPPAEHPKLPRSVP 295


>gi|295394415|ref|ZP_06804639.1| probable cell surface protein precursor [Brevibacterium mcbrellneri
            ATCC 49030]
 gi|294972767|gb|EFG48618.1| probable cell surface protein precursor [Brevibacterium mcbrellneri
            ATCC 49030]
          Length = 1591

 Score = 35.4 bits (80), Expect = 4.8,   Method: Composition-based stats.
 Identities = 11/56 (19%), Positives = 23/56 (41%)

Query: 120  QCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLEN 175
             C+ P  +   +         +   + D T+  +EK +   S    E+ +++P EN
Sbjct: 1344 DCETPTPEPSEDPSDEPTDEPTADPTEDPTADPTEKPTVKPSETPSEEPTTEPSEN 1399


>gi|315029723|gb|EFT41655.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecalis TX4000]
          Length = 783

 Score = 35.4 bits (80), Expect = 5.0,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 29/86 (33%), Gaps = 5/86 (5%)

Query: 122 KDPINDSISNSESISKKALSEYSSTDITSQGSE-----KSSGSSSNKTLEKESSQPLENN 176
           K+P      + +     +       D  + G         +    +K  E ++S   + +
Sbjct: 588 KEPDTSGEPDKDKEPNASGELDKDKDPDASGEPDKDKDPDASGEPDKDKEPDASGEPDKD 647

Query: 177 LSMDLKGRPIQELGNNLSDSGLNEQD 202
             +D  G P ++     S+  +  +D
Sbjct: 648 KELDTSGEPDKDKETKTSEGPIEGKD 673


>gi|307290005|ref|ZP_07569929.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecalis TX0411]
 gi|306498847|gb|EFM68341.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecalis TX0411]
          Length = 771

 Score = 35.4 bits (80), Expect = 5.0,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 29/86 (33%), Gaps = 5/86 (5%)

Query: 122 KDPINDSISNSESISKKALSEYSSTDITSQGSE-----KSSGSSSNKTLEKESSQPLENN 176
           K+P      + +     +       D  + G         +    +K  E ++S   + +
Sbjct: 588 KEPDTSGEPDKDKEPNASGELDKDKDPDASGEPDKDKDPDASGEPDKDKEPDASGEPDKD 647

Query: 177 LSMDLKGRPIQELGNNLSDSGLNEQD 202
             +D  G P ++     S+  +  +D
Sbjct: 648 KELDTSGEPDKDKETKTSEGPIEGKD 673


>gi|229546880|ref|ZP_04435605.1| amidase [Enterococcus faecalis TX1322]
 gi|229308045|gb|EEN74032.1| amidase [Enterococcus faecalis TX1322]
          Length = 797

 Score = 35.4 bits (80), Expect = 5.0,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 29/86 (33%), Gaps = 5/86 (5%)

Query: 122 KDPINDSISNSESISKKALSEYSSTDITSQGSE-----KSSGSSSNKTLEKESSQPLENN 176
           K+P      + +     +       D  + G         +    +K  E ++S   + +
Sbjct: 588 KEPDTSGEPDKDKEPNASGELDKDKDPDASGEPDKDKDPDASGEPDKDKEPDASGEPDKD 647

Query: 177 LSMDLKGRPIQELGNNLSDSGLNEQD 202
             +D  G P ++     S+  +  +D
Sbjct: 648 KELDTSGEPDKDKETKTSEGPIEGKD 673


>gi|225020412|ref|ZP_03709604.1| hypothetical protein CORMATOL_00419 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224946801|gb|EEG28010.1| hypothetical protein CORMATOL_00419 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 479

 Score = 35.0 bits (79), Expect = 5.8,   Method: Composition-based stats.
 Identities = 14/91 (15%), Positives = 32/91 (35%), Gaps = 3/91 (3%)

Query: 115 DIWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLE 174
           ++W+ +       +         K   E +    +  G ++ +    + + +  + QP  
Sbjct: 169 EVWVNE-SGKAAGACGPENPNGDKPEPEDAPASDSQSGRDQDTN--PDDSNQGNAEQPGN 225

Query: 175 NNLSMDLKGRPIQELGNNLSDSGLNEQDHND 205
            N       +  ++ G   SD G  +QD  D
Sbjct: 226 ENQDGKSADQDNKDQGTKPSDQGNKDQDSKD 256


>gi|330807083|ref|YP_004351545.1| Twin-arginine translocation system, TatA protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327375191|gb|AEA66541.1| Twin-arginine translocation system, TatA protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 95

 Score = 35.0 bits (79), Expect = 6.6,   Method: Composition-based stats.
 Identities = 8/56 (14%), Positives = 23/56 (41%)

Query: 133 ESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDLKGRPIQE 188
           ESI     +           +     +   + +  ++SQP+    ++D++ + ++E
Sbjct: 34  ESIKGFRKAMNDDEKPADPSAAPGQPAQPTQPVHPQASQPVNAPHTIDVQAQKVEE 89


>gi|270003732|gb|EFA00180.1| hypothetical protein TcasGA2_TC003005 [Tribolium castaneum]
          Length = 1179

 Score = 35.0 bits (79), Expect = 6.6,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 31/80 (38%), Gaps = 7/80 (8%)

Query: 126 NDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNL-------S 178
           + S ++    S K+    +      Q  +K    S  KT  K    P + +         
Sbjct: 560 DKSAASPRIDSPKSKKINTPVKPLEQEGQKGRSPSPKKTPIKSKVTPEKGSAPESVTKEE 619

Query: 179 MDLKGRPIQELGNNLSDSGL 198
             LK  P +E G+++SDS +
Sbjct: 620 RSLKATPNKESGDDISDSSV 639


>gi|114685030|ref|XP_514968.2| PREDICTED: microtubule associated monoxygenase, calponin and LIM
           domain containing 3 [Pan troglodytes]
          Length = 1139

 Score = 35.0 bits (79), Expect = 6.8,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 32/90 (35%), Gaps = 3/90 (3%)

Query: 101 ADSPA-MNAIDHSIYD--IWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSS 157
           AD+P+ + A+   I    + L + + P++            +    S   I SQ    + 
Sbjct: 347 ADAPSDLKAVHSPIRSQPVTLPEARTPVSPGSPQPRPPVAASTPPPSPLPICSQPQPSTE 406

Query: 158 GSSSNKTLEKESSQPLENNLSMDLKGRPIQ 187
            +  + T      QP     S  L   P+Q
Sbjct: 407 ATVPSPTQSPIRFQPAPAKTSTPLAPLPVQ 436


>gi|219115775|ref|XP_002178683.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217410418|gb|EEC50348.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 735

 Score = 35.0 bits (79), Expect = 7.1,   Method: Composition-based stats.
 Identities = 8/53 (15%), Positives = 17/53 (32%), Gaps = 1/53 (1%)

Query: 123 DPINDSISNSESISKKALSEYSSTDIT-SQGSEKSSGSSSNKTLEKESSQPLE 174
            P   + S  E  +       +  + T +     +S      +  + S+ P E
Sbjct: 592 TPREPTASPREPTATPREPTATPGEPTPTPREPTASPRDPTASPREPSATPRE 644


>gi|307269657|ref|ZP_07550991.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecalis TX4248]
 gi|306514019|gb|EFM82608.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecalis TX4248]
          Length = 758

 Score = 34.6 bits (78), Expect = 7.7,   Method: Composition-based stats.
 Identities = 14/81 (17%), Positives = 32/81 (39%), Gaps = 1/81 (1%)

Query: 122 KDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDL 181
           ++P  D   ++    +K     +S +        +SG   +K  E  +S   + +  +D 
Sbjct: 582 EEPDKDKEPDASGEPEKDKDPNASGEPDKDKEPDASG-EPDKDKEPNASGEPDKDKELDT 640

Query: 182 KGRPIQELGNNLSDSGLNEQD 202
            G P ++     S+  +  +D
Sbjct: 641 SGEPDKDKETKTSEGPIEGKD 661


>gi|315031682|gb|EFT43614.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecalis TX0017]
 gi|315034260|gb|EFT46192.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecalis TX0027]
          Length = 754

 Score = 34.6 bits (78), Expect = 7.8,   Method: Composition-based stats.
 Identities = 14/81 (17%), Positives = 32/81 (39%), Gaps = 1/81 (1%)

Query: 122 KDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDL 181
           ++P  D   ++    +K     +S +        +SG   +K  E  +S   + +  +D 
Sbjct: 582 EEPDKDKEPDASGEPEKDKDPNASGEPDKDKEPDASG-EPDKDKEPNASGEPDKDKELDT 640

Query: 182 KGRPIQELGNNLSDSGLNEQD 202
            G P ++     S+  +  +D
Sbjct: 641 SGEPDKDKETKTSEGPIEGKD 661


>gi|315147982|gb|EFT91998.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecalis TX4244]
          Length = 754

 Score = 34.6 bits (78), Expect = 7.9,   Method: Composition-based stats.
 Identities = 14/81 (17%), Positives = 32/81 (39%), Gaps = 1/81 (1%)

Query: 122 KDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDL 181
           ++P  D   ++    +K     +S +        +SG   +K  E  +S   + +  +D 
Sbjct: 582 EEPDKDKEPDASGEPEKDKDPNASGEPDKDKEPDASG-EPDKDKEPNASGEPDKDKELDT 640

Query: 182 KGRPIQELGNNLSDSGLNEQD 202
            G P ++     S+  +  +D
Sbjct: 641 SGEPDKDKETKTSEGPIEGKD 661


>gi|312868137|ref|ZP_07728341.1| LPXTG-motif cell wall anchor domain protein [Streptococcus
           parasanguinis F0405]
 gi|311096541|gb|EFQ54781.1| LPXTG-motif cell wall anchor domain protein [Streptococcus
           parasanguinis F0405]
          Length = 751

 Score = 34.6 bits (78), Expect = 8.2,   Method: Composition-based stats.
 Identities = 11/63 (17%), Positives = 24/63 (38%), Gaps = 1/63 (1%)

Query: 123 DPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDLK 182
            P N    ++        +  +     +QG+  + G+  N+   +    P +N  + D +
Sbjct: 564 TPDNPGTPDNPETPDNPGTPDNPGTPDNQGTPDNPGTPDNQGTPENPGTP-DNQGTPDNQ 622

Query: 183 GRP 185
           G P
Sbjct: 623 GTP 625


>gi|256957123|ref|ZP_05561294.1| amidase [Enterococcus faecalis DS5]
 gi|257077919|ref|ZP_05572280.1| amidase [Enterococcus faecalis JH1]
 gi|256947619|gb|EEU64251.1| amidase [Enterococcus faecalis DS5]
 gi|256985949|gb|EEU73251.1| amidase [Enterococcus faecalis JH1]
          Length = 676

 Score = 34.6 bits (78), Expect = 9.0,   Method: Composition-based stats.
 Identities = 14/81 (17%), Positives = 32/81 (39%), Gaps = 1/81 (1%)

Query: 122 KDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLENNLSMDL 181
           ++P  D   ++    +K     +S +        +SG   +K  E  +S   + +  +D 
Sbjct: 502 EEPDKDKEPDASGEPEKDKDPNASGEPDKDKEPDASG-EPDKDKEPNASGEPDKDKELDT 560

Query: 182 KGRPIQELGNNLSDSGLNEQD 202
            G P ++     S+  +  +D
Sbjct: 561 SGEPDKDKETKTSEGPIEGKD 581


>gi|4240124|dbj|BAA74842.1| KIAA0819 protein [Homo sapiens]
 gi|31044211|tpg|DAA01344.1| TPA_exp: MICAL3 [Homo sapiens]
          Length = 989

 Score = 34.6 bits (78), Expect = 9.3,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 32/90 (35%), Gaps = 3/90 (3%)

Query: 101 ADSPA-MNAIDHSIYD--IWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSS 157
           AD+P+ + A+   I    + L + + P++            +    S   I SQ    + 
Sbjct: 197 ADAPSDLKAVHSPIRSQPVTLPEARTPVSPGSPQPRPPVAASTPPPSPLPICSQPQPSTE 256

Query: 158 GSSSNKTLEKESSQPLENNLSMDLKGRPIQ 187
            +  + T      QP     S  L   P+Q
Sbjct: 257 ATVPSPTQSPIRFQPAPAKTSTPLAPLPVQ 286


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.304    0.136    0.412 

Lambda     K      H
   0.267   0.0421    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,277,189,077
Number of Sequences: 14124377
Number of extensions: 116856921
Number of successful extensions: 705196
Number of sequences better than 10.0: 894
Number of HSP's better than 10.0 without gapping: 838
Number of HSP's successfully gapped in prelim test: 545
Number of HSP's that attempted gapping in prelim test: 690245
Number of HSP's gapped (non-prelim): 13557
length of query: 210
length of database: 4,842,793,630
effective HSP length: 133
effective length of query: 77
effective length of database: 2,964,251,489
effective search space: 228247364653
effective search space used: 228247364653
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.9 bits)
S2: 78 (34.6 bits)