RPSBLAST alignment for GI: 254780542 and conserved domain: pfam09923

>gnl|CDD|150579 pfam09923, DUF2155, Uncharacterized protein conserved in bacteria (DUF2155). This domain, found in various hypothetical prokaryotic proteins, has no known function. Length = 91
 Score =  123 bits (311), Expect = 3e-29
 Identities = 37/92 (40%), Positives = 55/92 (59%), Gaps = 1/92 (1%)

Query: 30  AEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDR 89
           A   G+DKITGR    ++++ ++A+FG+L +    C  R   E    DAF  +  I    
Sbjct: 1   AVLRGLDKITGRTTDLELKVGETARFGALQVTLRECEKRYPEENPDGDAFAEL-TIRERG 59

Query: 90  IVRSIFSGWMFADSPAMNAIDHSIYDIWLMQC 121
               IFSGWMFA SPA+NA++H  YD+W+++C
Sbjct: 60  DGEPIFSGWMFASSPALNALEHPRYDVWVLRC 91