RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780542|ref|YP_003064955.1| hypothetical protein CLIBASIA_02145 [Candidatus Liberibacter asiaticus str. psy62] (210 letters) >gnl|CDD|34378 COG4765, COG4765, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 164 Score = 142 bits (359), Expect = 6e-35 Identities = 59/103 (57%), Positives = 77/103 (74%) Query: 20 ANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAF 79 A +ARF N VA+F+ +DKITGR+ FDV I ++ QFG+L + P VCYSR D EA + DAF Sbjct: 51 AEAARFKNYVAKFSALDKITGRITEFDVYIGETVQFGALQVTPRVCYSRLDDEAPKTDAF 110 Query: 80 VSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCK 122 V++ EI DR +R IF+GWMFA SP +NA++H IYD+WL CK Sbjct: 111 VTVDEITLDRKIRRIFTGWMFASSPGLNAVEHPIYDVWLKDCK 153 >gnl|CDD|38891 KOG3687, KOG3687, KOG3687, Tuberin - Rap/ran-GTPase-activating protein [Cell cycle control, cell division, chromosome partitioning, Signal transduction mechanisms]. Length = 1697 Score = 34.7 bits (79), Expect = 0.018 Identities = 14/83 (16%), Positives = 29/83 (34%), Gaps = 5/83 (6%) Query: 108 AIDHSIYDIWLMQCKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEK 167 + H + +W ++C+ P N + ++ S DI + S ++ +S Sbjct: 839 CLAHHVIAMWFIRCRLPFRKDFVNFITKGLRSNVLLSFDDIPEKDSFRARSTSLT----- 893 Query: 168 ESSQPLENNLSMDLKGRPIQELG 190 E + S D P + Sbjct: 894 ERGKSRIQTGSADENSVPQADDS 916 >gnl|CDD|30099 cd01377, MYSc_type_II, Myosin motor domain, type II myosins. Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle.. Length = 693 Score = 32.5 bits (74), Expect = 0.097 Identities = 19/77 (24%), Positives = 32/77 (41%), Gaps = 11/77 (14%) Query: 114 YDI--WLMQCKDPINDSI------SNSESISKKALSEYSSTDITSQGSEKSSGSSSNKT- 164 Y+I WL + KDP+ND++ S+ + +++ ++ G K S +T Sbjct: 505 YNIDGWLEKNKDPLNDNVVGLLKKSSDKLVAELFKDYAEASGDGGGGGGKKKKGGSFRTV 564 Query: 165 --LEKESSQPLENNLSM 179 L KE L L Sbjct: 565 SQLYKEQLNKLMTTLRS 581 >gnl|CDD|35035 COG5476, COG5476, Uncharacterized conserved protein [Function unknown]. Length = 488 Score = 29.5 bits (66), Expect = 0.72 Identities = 18/102 (17%), Positives = 31/102 (30%), Gaps = 14/102 (13%) Query: 8 LILFFVFSHAKFANSARFANKVAEFAGMDKITGRVLTFDVEINQSAQFGSLIIKPMVCYS 67 + + H FA + A ++ A + V F +PM Sbjct: 155 FAAYRTYPHTDFAETGERAWELLLDALRGGVRPVVSLFRRMP----FLLPTSREPMRSLY 210 Query: 68 RDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAI 109 + + D +S+S + G+ AD P M I Sbjct: 211 DRLKAQEARDGILSVS----------VAHGFPAADVPEMGTI 242 >gnl|CDD|176776 cd08798, Death_NFkB2_p100, Death domain of the Nuclear Factor-KappaB2 precursor protein p100. Death Domain (DD) of the Nuclear Factor-KappaB2 (NF-kB2) precursor protein p100. The NF-kB family of transcription factors play a central role in cardiovascular growth, stress response, and inflammation by controlling the expression of a network of different genes. There are five NF-kB proteins, all containing an N-terminal REL Homology Domain (RHD). NF-kB2 (or p52) is produced from the processing of the precursor protein p100, which contains ANK repeats and a C-terminal DD in addition to the RHD. It is regulated by the non-canonical NF-kB pathway. The p100 precursor is cytosolic and interacts with RelB. Upon phosphorylation by IKKalpha, p100 is processed to its 52kDa active, DNA binding form and the p52/RelB complex is translocated into the nucleus. The non-canonical pathway plays a role in adaptive immunity and lymphorganogenesis. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes. Length = 76 Score = 27.9 bits (62), Expect = 2.0 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Query: 165 LEKESSQPLENNL-SMDLKGRPIQELGNNLSDSGLNE 200 K + P + L S +L G P+Q L L D GL E Sbjct: 33 TYKPTQSPPGSLLRSYELAGGPLQGLIEALQDMGLRE 69 >gnl|CDD|114185 pfam05445, Pox_ser-thr_kin, Poxvirus serine/threonine protein kinase. Length = 434 Score = 26.2 bits (58), Expect = 6.7 Identities = 11/53 (20%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Query: 48 EINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIV-RSIFSGWM 99 EI + +F + + +C ++D + R+ + F + + R +FS W+ Sbjct: 381 EIEKDPEFNKALEEFFMCCTKDTCDKFRLKVSILHPISFLENFIMRDLFSNWI 433 >gnl|CDD|147016 pfam04654, DUF599, Protein of unknown function, DUF599. This family includes several uncharacterized proteins. Length = 216 Score = 26.0 bits (58), Expect = 7.8 Identities = 9/30 (30%), Positives = 18/30 (60%) Query: 1 MKYRVLLLILFFVFSHAKFANSARFANKVA 30 + ++LLL++ F+++ KF S R N + Sbjct: 105 FELKLLLLLVIFLYAFFKFTWSIRQFNYCS 134 >gnl|CDD|36175 KOG0957, KOG0957, KOG0957, PHD finger protein [General function prediction only]. Length = 707 Score = 25.9 bits (56), Expect = 9.0 Identities = 15/55 (27%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Query: 121 CKDPINDSISNSESISKKALSEYSSTDITSQGSEKSSGSSSNKTLEKESSQPLEN 175 D S S S + + GSE+ SGS S + ++E S+ EN Sbjct: 35 FATGSEDHSSGDGSDSD--FEVNPAEEDAKTGSEEDSGSDSQQLSDEEESEDEEN 87 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.315 0.129 0.359 Gapped Lambda K H 0.267 0.0622 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,259,700 Number of extensions: 106565 Number of successful extensions: 227 Number of sequences better than 10.0: 1 Number of HSP's gapped: 227 Number of HSP's successfully gapped: 14 Length of query: 210 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 120 Effective length of database: 4,318,927 Effective search space: 518271240 Effective search space used: 518271240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 55 (25.2 bits)