RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780542|ref|YP_003064955.1| hypothetical protein
CLIBASIA_02145 [Candidatus Liberibacter asiaticus str. psy62]
         (210 letters)



>d1es5a_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase
           {Streptomyces sp., K15 [TaxId: 1931]}
          Length = 260

 Score = 29.1 bits (64), Expect = 0.33
 Identities = 16/88 (18%), Positives = 29/88 (32%), Gaps = 2/88 (2%)

Query: 35  MDKITGRVLTFDVEINQSAQFGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSI 94
           M+  TG  L +    +     GS   K M       +    +DA V+I + ++D +V + 
Sbjct: 12  MNNGTGTTL-YTKAADTRRSTGSTT-KIMTAKVVLAQSNLNLDAKVTIQKAYSDYVVANN 69

Query: 95  FSGWMFADSPAMNAIDHSIYDIWLMQCK 122
            S         +         +    C 
Sbjct: 70  ASQAHLIVGDKVTVRQLLYGLMLPSGCD 97


>d1tzza2 d.54.1.1 (A:1006-1145) Hypothetical protein Bll6730
           {Bradyrhizobium japonicum [TaxId: 375]}
          Length = 140

 Score = 28.3 bits (62), Expect = 0.48
 Identities = 8/62 (12%), Positives = 19/62 (30%)

Query: 64  VCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKD 123
                D ++           +     ++ +   G     S A+  ID +++D        
Sbjct: 69  RILEADPKKLLNEAGDNLDPDKVWAAMMINEKPGGHGERSVAVGTIDMAVWDAVAKIAGK 128

Query: 124 PI 125
           P+
Sbjct: 129 PL 130


>d1muca2 d.54.1.1 (A:4-130) Muconate-lactonizing enzyme (cis
           muconate cycloisomerase) {Pseudomonas putida [TaxId:
           303]}
          Length = 127

 Score = 25.3 bits (54), Expect = 4.6
 Identities = 8/77 (10%), Positives = 24/77 (31%), Gaps = 6/77 (7%)

Query: 55  FGSLIIKPMVCYSRDDREAQRIDAFVSISEIFTDRIVRSIFSGW------MFADSPAMNA 108
            G       + Y  +  E  + +    ++         +I +           ++ A + 
Sbjct: 45  IGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSG 104

Query: 109 IDHSIYDIWLMQCKDPI 125
           I+ ++ D    +   P+
Sbjct: 105 IESALLDAQGKRLGLPV 121


>d1zeea1 a.266.1.2 (A:6-392) Hypothetical protein SO4414 {Shewanella
           oneidensis [TaxId: 70863]}
          Length = 387

 Score = 25.2 bits (55), Expect = 4.9
 Identities = 7/36 (19%), Positives = 14/36 (38%), Gaps = 3/36 (8%)

Query: 89  RIVRSIFSGWMFADSPAMNAIDHSIYDIWLMQCKDP 124
           R+   ++ G    D   +N ID +   + L    + 
Sbjct: 220 RVGSVVYRGANAGDFAGINVIDLT---LGLCFANEA 252


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.315    0.129    0.359 

Gapped
Lambda     K      H
   0.267   0.0616    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 687,002
Number of extensions: 28283
Number of successful extensions: 54
Number of sequences better than 10.0: 1
Number of HSP's gapped: 54
Number of HSP's successfully gapped: 5
Length of query: 210
Length of database: 2,407,596
Length adjustment: 81
Effective length of query: 129
Effective length of database: 1,295,466
Effective search space: 167115114
Effective search space used: 167115114
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (23.7 bits)