>cd04157 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases. Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development. Arl6 is also believed to have a role in cilia or flagella function. Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p. Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism. Older literature suggests that A

Probab=94.66 E-value=0.039 Score=34.42 Aligned_cols=105 Identities=26% Similarity=0.353 Sum_probs=54.0 Q ss_pred CEEECCCCCHHHHHHHHHHHCCCC-CCEE-CCCHHHHH---------HHHHHCCHHHHHHHHHHHHHHCCHHEEH-HHHH Q ss_conf 110037874258889999742469-9702-05857886---------4442033245999999998737801206-3235 Q gi|254780545|r 183 GVLLVGPPGTGKTLLARAVAGEAN-VPFF-TISGSDFV---------ELFVGVGASRVRDMFEQAKNNSPCIVFV-DEID 250 (647) Q Consensus 183 g~ll~GppGtGKTlla~a~a~e~~-~~f~-~~~~s~~~---------~~~~g~g~~~vr~lf~~a~~~~p~iifi-Deid 250 (647) T Consensus 1 ~Il~lGl~~sGKTtil~~l~~~~~~~~~~~pT~G~~~~~~~~~~~~~~iwD~~G~~~~r~lw~~y~~~~~~iI~VvDssd 80 (162) T cd04157 1 NILVVGLDNSGKTTIINQLKPENAQSQIIVPTVGFNVESFEKGNLSFTAFDMSGQGKYRGLWEHYYKNIQGIIFVIDSSD 80 (162) T ss_pred CEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCEEEEEEEECCEEEEEEECCCCCCCCHHHHHHHCCCCEEEEEEECCC T ss_conf 99999999998899999997289875641685075789998399889999858874420558987056744899970763 Q ss_pred HHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCC-CCEEEEEECCCCCCCC Q ss_conf 6414455789886268898899899853032357-7829999629810088 Q gi|254780545|r 251 AVGRHRGIGLGGGNDEREQTLNQLLVEMDGFESS-EGVILIAATNRPDVLD 300 (647) Q Consensus 251 a~~~~r~~~~~~~~~e~~~~ln~ll~~mdg~~~~-~~v~vi~aTn~~~~lD 300 (647) T Consensus 81 ~---~~-------~~~~~~~l~~ll~~~~-~~~~~~PiLI~~--NK~D~~~ 118 (162) T cd04157 81 R---LR-------LVVVKDELELLLNHPD-IKHRRVPILFFA--NKMDLPD 118 (162) T ss_pred H---HH-------HHHHHHHHHHHHHCHH-HCCCCCEEEEEE--ECCCCCC T ss_conf 8---88-------9999999999971765-517984599998--1477889

HHsearch alignment for GI: 254780545 and conserved domain: cd04157