>cd04158 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family. In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif. This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family. Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity. However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain. The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs. The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain. ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra

Probab=94.57 E-value=0.043 Score=34.15 Aligned_cols=102 Identities=25% Similarity=0.374 Sum_probs=59.9 Q ss_pred EEECCCCCHHHHHHHHHHHCCCCCCEECCCHHHHH---------HHHHHCCHHHHHHHHHHHHHHCCHHEEHHHHHHHHC Q ss_conf 10037874258889999742469970205857886---------444203324599999999873780120632356414 Q gi|254780545|r 184 VLLVGPPGTGKTLLARAVAGEANVPFFTISGSDFV---------ELFVGVGASRVRDMFEQAKNNSPCIVFVDEIDAVGR 254 (647) Q Consensus 184 ~ll~GppGtGKTlla~a~a~e~~~~f~~~~~s~~~---------~~~~g~g~~~vr~lf~~a~~~~p~iifiDeida~~~ 254 (647) T Consensus 2 IlilGl~~sGKTtil~~l~~~~~~~~~pT~G~~~~~i~~~~~~l~iwD~gG~~~~r~~w~~Yy~~~~~iIfV--vDssd~ 79 (169) T cd04158 2 VVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFV--VDSSHR 79 (169) T ss_pred EEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCEEEEEEECCCCCCCCHHHHHHCCCCCEEEEE--EECCHH T ss_conf 999998999889999999579968977868816699998988999998999724463678755576279999--986306 Q ss_pred CCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCC Q ss_conf 45578988626889889989985303235778299996298100 Q gi|254780545|r 255 HRGIGLGGGNDEREQTLNQLLVEMDGFESSEGVILIAATNRPDV 298 (647) Q Consensus 255 ~r~~~~~~~~~e~~~~ln~ll~~mdg~~~~~~v~vi~aTn~~~~ 298 (647) T Consensus 80 ~~-------~~ea~~~l~~ll~~~~~--~~~piLIla--NK~Dl 112 (169) T cd04158 80 DR-------VSEAHSELAKLLTEKEL--RDALLLIFA--NKQDV 112 (169) T ss_pred HH-------HHHHHHHHHHHHHHHHH--CCCEEEEEE--ECCCC T ss_conf 77-------99999999999712753--798499997--35567

HHsearch alignment for GI: 254780545 and conserved domain: cd04158