RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780546|ref|YP_003064959.1| hypothetical protein CLIBASIA_02165 [Candidatus Liberibacter asiaticus str. psy62] (423 letters) >gnl|CDD|162854 TIGR02432, lysidine_TilS_N, tRNA(Ile)-lysidine synthetase, N-terminal domain. The only examples in which the wobble position of a tRNA must discriminate between G and A of mRNA are AUA (Ile) vs. AUG (Met) and UGA (stop) vs. UGG (Trp). In all bacteria, the wobble position of the tRNA(Ile) recognizing AUA is lysidine, a lysine derivative of cytidine. This family describes a protein domain found, apparently, in all bacteria in a single copy. Eukaryotic sequences appear to be organellar. The domain archictecture of this protein family is variable; some, including characterized proteins of E. coli and B. subtilis known to be tRNA(Ile)-lysidine synthetase, include a conserved 50-residue domain that many other members lack. This protein belongs to the ATP-binding PP-loop family ( pfam01171). It appears in the literature and protein databases as TilS, YacA, and putative cell cycle protein MesJ (a misnomer). Length = 189 Score = 175 bits (446), Expect = 2e-44 Identities = 71/192 (36%), Positives = 94/192 (48%), Gaps = 9/192 (4%) Query: 21 HILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSRL 80 ILVAVSGG DSM LL H +L + KI+ A VDH LR + +E +V C +L Sbjct: 1 RILVAVSGGVDSMALL---HLLLKLQPKLKIRLIAAHVDHGLRPESDEEAEFVQQFCKKL 57 Query: 81 RIAHSVVSWKNSKPQ----TGLMAAAREARYALISEHAKTINATLIMTAHTFDDQLETVY 136 I + L AAREARY E AK A I+TAH DDQ ET+ Sbjct: 58 NIPLEIKKVDVKALAKGKKKNLEEAAREARYDFFEEIAKKHGADYILTAHHADDQAETIL 117 Query: 137 MRSQRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCRREDIRSFLLQRNISWCEDPSNTD 196 +R R +G LSGM + I RP L + +I +L + + W ED +N D Sbjct: 118 LRLLRGSGLRG--LSGMKPIRILGNGGQIIRPLLGISKSEIEEYLKENGLPWFEDETNQD 175 Query: 197 DRFERVRVRRFV 208 D++ R R+R + Sbjct: 176 DKYLRNRIRHEL 187 >gnl|CDD|182626 PRK10660, tilS, tRNA(Ile)-lysidine synthetase; Provisional. Length = 436 Score = 83.1 bits (206), Expect = 1e-16 Identities = 60/189 (31%), Positives = 85/189 (44%), Gaps = 9/189 (4%) Query: 21 HILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSRL 80 ILVA SGG DS LL L ++ + AI V H L A V++ VC + Sbjct: 17 QILVAFSGGLDSTVLLHLLVQWRTENP--GVTLRAIHVHHGLSPNADSWVKHCEQVCQQW 74 Query: 81 RIAHSVVSWKNSKPQTGLMAAAREARYALISEHAKTINATLIMTAHTFDDQLETVYMRSQ 140 ++ V + + G+ AAAR+ARY + L+ TA DDQ ET + + Sbjct: 75 QVPLVVERVQLDQRGLGIEAAARQARYQAFARTLLP-GEVLV-TAQHLDDQCETFLLALK 132 Query: 141 RDYAEKGMGLSGMCD-TILYDLNLWISRPFLRCRREDIRSFLLQRNISWCEDPSNTDDRF 199 R GLS M + + L RP L RE++ + + W ED SN DDR+ Sbjct: 133 R--GSGPAGLSAMAEVSPFAGTRLI--RPLLARSREELEQYAQAHGLRWIEDDSNQDDRY 188 Query: 200 ERVRVRRFV 208 +R +R V Sbjct: 189 DRNFLRLRV 197 >gnl|CDD|162088 TIGR00884, guaA_Cterm, GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit. This protein of purine de novo biosynthesis is well-conserved. However, it appears to split into two separate polypeptide chains in most of the Archaea. This C-terminal region would be the larger subunit. Length = 311 Score = 36.2 bits (84), Expect = 0.018 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 7/60 (11%) Query: 13 VRSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDH-CLRETAKDEVR 71 +R V A +++A+SGG DS ++ +VL+ R+ G + + + VDH LR+ ++V Sbjct: 10 IREQVGDAKVIIALSGGVDS-----SVAAVLAHRAIGD-RLTCVFVDHGLLRKGEAEQVV 63 >gnl|CDD|182655 PRK10696, PRK10696, tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional. Length = 258 Score = 35.2 bits (82), Expect = 0.028 Identities = 34/148 (22%), Positives = 52/148 (35%), Gaps = 61/148 (41%) Query: 22 ILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISV----------DHCLRE------- 64 ++V +SGG DS LL L ++ + I F ++V +H L E Sbjct: 32 VMVCLSGGKDSYTLLDILLNL---QKRAPINFELVAVNLDQKQPGFPEHVLPEYLESLGV 88 Query: 65 -----------TAKDEVR----YVSDVCSRLRIAHSVVSWKNSKPQTGLMAAAREARYAL 109 K+++ S +CSRLR R Y Sbjct: 89 PYHIEEQDTYSIVKEKIPEGKTTCS-LCSRLR---------------------RGILYRT 126 Query: 110 ISEHAKTINATLIMTAHTFDDQLETVYM 137 A+ + AT I H DD LET+++ Sbjct: 127 ----ARELGATKIALGHHRDDILETLFL 150 >gnl|CDD|177981 PLN02347, PLN02347, GMP synthetase. Length = 536 Score = 30.8 bits (70), Expect = 0.61 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 8/53 (15%) Query: 13 VRSLVYP-AHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDH-CLR 63 +++ V P H++ A+SGG DS +H + DR + VD+ LR Sbjct: 222 IKATVGPDEHVICALSGGVDSTVAATLVHKAIGDR------LHCVFVDNGLLR 268 >gnl|CDD|184485 PRK14068, PRK14068, exodeoxyribonuclease VII small subunit; Provisional. Length = 76 Score = 29.1 bits (65), Expect = 2.2 Identities = 12/28 (42%), Positives = 16/28 (57%) Query: 133 ETVYMRSQRDYAEKGMGLSGMCDTILYD 160 ETV + D ++GM LS CDT L + Sbjct: 25 ETVSLEESLDLYQRGMKLSAACDTTLKN 52 >gnl|CDD|168382 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional. Length = 252 Score = 28.5 bits (64), Expect = 3.5 Identities = 22/93 (23%), Positives = 39/93 (41%), Gaps = 24/93 (25%) Query: 220 MKKFQDLRVKVNNA---VAM--------LIPKYLTVHMRSIIAISQD----------ILN 258 + ++ + VNNA + LI K+++ +S+I SQ+ I+N Sbjct: 79 IDRYGVADILVNNAGLGLFSPFLNVDDKLIDKHISTDFKSVIYCSQELAKEMREGGAIVN 138 Query: 259 IDST---LLFYLLRVSAAICGGQISLPGYRSME 288 I S Y L + A+ I+L Y ++E Sbjct: 139 IASVAGIRPAYGLSIYGAMKAAVINLTKYLALE 171 >gnl|CDD|162310 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form. This model describes a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and per cent identity (UPGMA) trees. Members of this set include two or three copies of the lipoyl-binding domain. E. coli AceF is a member of this model, while mitochondrial and some other bacterial forms belong to a separate model. Length = 546 Score = 27.9 bits (62), Expect = 5.1 Identities = 12/54 (22%), Positives = 28/54 (51%) Query: 206 RFVRDIDLHALYLKMKKFQDLRVKVNNAVAMLIPKYLTVHMRSIIAISQDILNI 259 +F +DL L +KK+ ++ V V+ +L+P V + I ++ ++ ++ Sbjct: 392 KFNASLDLGGEQLILKKYVNIGVAVDTPNGLLVPVIKDVDRKGITELALELSDL 445 >gnl|CDD|177387 PHA02553, 6, baseplate wedge subunit; Provisional. Length = 611 Score = 27.7 bits (62), Expect = 5.7 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 5/48 (10%) Query: 118 NATLIMTAHTFDD--QLETVYMRSQ---RDYAEKGMGLSGMCDTILYD 160 I T+ FD+ Y+R+Q +DY +G L+ + D + Y+ Sbjct: 2 MIPDIFTSLDFDEIKSSLIEYLRTQDEFKDYDFEGSRLNVLIDLLAYN 49 >gnl|CDD|181212 PRK08056, PRK08056, threonine-phosphate decarboxylase; Provisional. Length = 356 Score = 27.7 bits (62), Expect = 6.1 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Query: 169 FLRCRREDI--RSFLLQRN--ISWCEDPSNTDDRFERVRVR 205 FLRC R DI + LL + I C + D R+ RV +R Sbjct: 297 FLRCERPDIDLQRALLTQRILIRSCANYPGLDSRYYRVAIR 337 >gnl|CDD|132327 TIGR03284, thym_sym, thymidylate synthase. Members of this protein family are thymidylate synthase, an enzyme that produces dTMP from dUMP. In prokaryotes, its gene usually is found close to that for dihydrofolate reductase, and in some systems the two enzymes are found as a fusion protein. This model excludes a set of related proteins (TIGR03283) that appears to replace this family in archaeal methanogens, where tetrahydrofolate is replaced by tetrahydromethanopterin. Length = 296 Score = 27.4 bits (61), Expect = 6.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Query: 318 ITRAVRNLPTLILYPEETTVWDGRYQ 343 +TR R LP L L PE+ ++D Y+ Sbjct: 252 LTREPRPLPKLKLNPEKKDIFDFEYE 277 >gnl|CDD|179167 PRK00919, PRK00919, GMP synthase subunit B; Validated. Length = 307 Score = 27.6 bits (62), Expect = 7.0 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 7/78 (8%) Query: 6 IESVRFFVRSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCL-RE 64 IE +R + ++A+SGG DS ++ +VL+ R+ G + + + VD L R+ Sbjct: 8 IEEAIEEIREEIGDGKAIIALSGGVDS-----SVAAVLAHRAIGD-RLTPVFVDTGLMRK 61 Query: 65 TAKDEVRYVSDVCSRLRI 82 + ++ LRI Sbjct: 62 GETERIKETFSDMLNLRI 79 >gnl|CDD|181483 PRK08576, PRK08576, hypothetical protein; Provisional. Length = 438 Score = 27.4 bits (61), Expect = 7.6 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 9/61 (14%) Query: 22 ILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSRLR 81 ++V SGG DS L+ L+ ++FG + A+ VD DE YV V +L Sbjct: 237 VIVPWSGGKDSTAALL-----LAKKAFGDVT--AVYVDTGYEMPLTDE--YVEKVAEKLG 287 Query: 82 I 82 + Sbjct: 288 V 288 >gnl|CDD|162115 TIGR00929, VirB4_CagE, type IV secretion/conjugal transfer ATPase, VirB4 family. Type IV secretion systems are found in Gram-negative pathogens. They export proteins, DNA, or complexes in different systems and are related to plasmid conjugation systems. This model represents related ATPases that include VirB4 in Agrobacterium tumefaciens (DNA export) CagE in Helicobacter pylori (protein export) and plasmid TraB (conjugation). Length = 785 Score = 27.3 bits (61), Expect = 7.6 Identities = 11/63 (17%), Positives = 23/63 (36%), Gaps = 3/63 (4%) Query: 321 AVRNLPTLILYPEETTVWDGRYQFQNLSDSLIQI---GPQSYRKADVPSGIPPIIAQRAL 377 + T I P + + L++ ++ P+ RK + G ++A+ L Sbjct: 684 ILEQCATKIFLPNPEADREDYAEGFKLTEREFELLKSTPEESRKFLIKQGQSSVVAELNL 743 Query: 378 SSM 380 M Sbjct: 744 GGM 746 >gnl|CDD|184331 PRK13795, PRK13795, hypothetical protein; Provisional. Length = 636 Score = 27.3 bits (61), Expect = 8.6 Identities = 18/61 (29%), Positives = 24/61 (39%), Gaps = 13/61 (21%) Query: 24 VAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCL--RETAKDEVRYVSDVCSRLR 81 V+ SGG DS L+ L L+ + F A + L ET V V +V Sbjct: 248 VSFSGGKDS---LVVLD--LAREALK--DFKAFFNNTGLEFPET----VENVKEVAEEYG 296 Query: 82 I 82 I Sbjct: 297 I 297 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.326 0.139 0.415 Gapped Lambda K H 0.267 0.0663 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 7,029,102 Number of extensions: 460238 Number of successful extensions: 1054 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1047 Number of HSP's successfully gapped: 18 Length of query: 423 Length of database: 5,994,473 Length adjustment: 96 Effective length of query: 327 Effective length of database: 3,920,105 Effective search space: 1281874335 Effective search space used: 1281874335 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 58 (26.3 bits)