RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780547|ref|YP_003064960.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62] (160 letters) >gnl|CDD|131849 TIGR02802, Pal_lipo, peptidoglycan-associated lipoprotein. Members of this protein are Pal (also called OprL), the Peptidoglycan-Associated Lipoprotein of the Tol-Pal system. The system appears to be involved both in the maintenance of outer membrane integrity and in the import of certain organic molecules as nutrients. Members of this family contain a hydrodrophobic lipoprotein signal sequence, a conserved N-terminal cleavage and modification site, a poorly conserved low-complexity region, together comprising about 65 amino acids, and a well-conserved C-terminal domain. The seed alignment for this model includes only the conserved C-terminal domain. Length = 104 Score = 127 bits (321), Expect = 2e-30 Identities = 45/102 (44%), Positives = 67/102 (65%), Gaps = 1/102 (0%) Query: 51 SVFFDTSSYSIRPADIQVLSNLGSWLEKH-DCDFLIEGHADELGSRNSSIALGLRRAYAV 109 V+FD S ++ +L ++L+K+ IEGH DE G+R ++ALG RRA AV Sbjct: 1 RVYFDFDSSDLKSEAQAILDAHAAYLKKNPSVRVTIEGHTDERGTREYNLALGERRANAV 60 Query: 110 FNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIV 151 +Y A+G+SAS+++ SYG+E P+ GHDE A+AKNRRA++ Sbjct: 61 KDYLQAKGVSASQIETVSYGEEKPACLGHDEAAWAKNRRAVL 102 >gnl|CDD|182744 PRK10802, PRK10802, peptidoglycan-associated outer membrane lipoprotein; Provisional. Length = 173 Score = 95.7 bits (238), Expect = 4e-21 Identities = 48/101 (47%), Positives = 64/101 (63%), Gaps = 1/101 (0%) Query: 52 VFFDTSSYSIRPADIQVLSNLGSWLEKH-DCDFLIEGHADELGSRNSSIALGLRRAYAVF 110 V+FD Y IR Q+L ++L + +EGHADE G+ +IALG RRA AV Sbjct: 71 VYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNIALGERRANAVK 130 Query: 111 NYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIV 151 Y +G+SA ++ + SYGKE P+V GHDE AYAKNRRA++ Sbjct: 131 MYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYAKNRRAVL 171 >gnl|CDD|182507 PRK10510, PRK10510, putative outer membrane lipoprotein; Provisional. Length = 219 Score = 50.6 bits (121), Expect = 2e-07 Identities = 28/105 (26%), Positives = 56/105 (53%), Gaps = 1/105 (0%) Query: 50 DSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFL-IEGHADELGSRNSSIALGLRRAYA 108 ++V FD+SS +++PA L+ + L+++ + + G+ D GS + ++ L +RA + Sbjct: 112 NNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADS 171 Query: 109 VFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFL 153 V + + +G+ ASR++ G P + A+NRR + L Sbjct: 172 VASALITQGVDASRIRTQGMGPANPIASNSTAEGKAQNRRVEITL 216 >gnl|CDD|181435 PRK08457, motB, flagellar motor protein MotB; Reviewed. Length = 257 Score = 49.7 bits (119), Expect = 4e-07 Identities = 27/123 (21%), Positives = 47/123 (38%), Gaps = 9/123 (7%) Query: 40 LQEQFSSSVGDSVFFDTSSYSIRPAD----IQVLSNLGSWLEKHDCDFLIEGHADELGSR 95 + + + + F+ S I AD ++ ++ + + L K + G+ D Sbjct: 112 IDNGIALKLPSKLLFENGSAEIINADMMDYLKRIAKIITKLPK-QVKINVRGYTDNSPLN 170 Query: 96 NSSIA----LGLRRAYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIV 151 S L RAY V + GI+ +R+ +SYG P + KN R + Sbjct: 171 KSRYKDHYELAAARAYNVMKVLIQYGINPNRLSFSSYGSNNPIAPNDSLENRLKNNRVEI 230 Query: 152 FLK 154 F K Sbjct: 231 FFK 233 >gnl|CDD|182748 PRK10808, PRK10808, outer membrane protein A; Reviewed. Length = 351 Score = 48.1 bits (115), Expect = 9e-07 Identities = 32/116 (27%), Positives = 53/116 (45%), Gaps = 12/116 (10%) Query: 52 VFFDTSSYSIRPADIQVLSNLGSWLEK---HDCDFLIEGHADELGSRNSSIALGLRRAYA 108 V F+ + +++P Q L L S L D ++ G+ D +GS + L +RA + Sbjct: 226 VLFNFNKATLKPEGQQALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSEKRAQS 285 Query: 109 VFNYFVARGISASRMKVTSYGKEMP-------SVYGHDE--DAYAKNRRAIVFLKG 155 V +Y V++GI A ++ GK P +V D A +RR + +KG Sbjct: 286 VVDYLVSKGIPADKISARGMGKSNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKG 341 >gnl|CDD|181619 PRK09039, PRK09039, hypothetical protein; Validated. Length = 343 Score = 46.5 bits (111), Expect = 3e-06 Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 19/120 (15%) Query: 48 VGD------SVFFDTSSYSIRPADIQVLSNLGSWLEK------HDCDFLI--EGHADEL- 92 VGD V F T S + P ++ L + L + + ++++ +GH D + Sbjct: 216 VGDRFVFQSEVLFPTGSAELNPEGQAEIAKLAAALIELAKEIPPEINWVLRVDGHTDNVP 275 Query: 93 ----GSRNSSIALGLRRAYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRR 148 G + L RA +V + +A G+ A R+ +G+ P G +A A+NRR Sbjct: 276 LSGTGRFRDNWELSSARAISVVKFLIALGVPADRLAAAGFGEFQPLDPGDTPEARARNRR 335 >gnl|CDD|102525 PRK06742, PRK06742, flagellar motor protein MotS; Reviewed. Length = 225 Score = 45.4 bits (107), Expect = 6e-06 Identities = 25/110 (22%), Positives = 49/110 (44%), Gaps = 5/110 (4%) Query: 50 DSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRN----SSIALGLRR 105 D++ FDT +++P +++S L + + ++EGH D N S+ L R Sbjct: 115 DNLIFDTGDANVKPEAKEIISQLVGFFQSVPNPIVVEGHTDSRPIHNDKFPSNWELSSAR 174 Query: 106 AYAVFNYFV-ARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFLK 154 A + ++ + + R+ Y P V + KNRR ++++K Sbjct: 175 AANMIHHLIEVYNVDDKRLAAVGYADTKPVVPNDSPQNWEKNRRVVIYIK 224 >gnl|CDD|163501 TIGR03789, pdsO, proteobacterial sortase system OmpA family protein. A newly defined histidine kinase (TIGR03785) and response regulator (TIGR03787) gene pair occurs exclusively in Proteobacteria, mostly of marine origin, nearly all of which contain a subfamily 6 sortase (TIGR03784) and its single dedicated target protein (TIGR03788) adjacent to to the sortase. This protein family shows up in only in those species with the histidine kinase/response regulator gene pair, and often adjacent to that pair. It belongs to the OmpA protein family (pfam00691). Its function is unknown. We assign the gene symbol pdsO, for Proteobacterial Dedicated Sortase system OmpA family protein. Length = 239 Score = 43.6 bits (103), Expect = 2e-05 Identities = 25/99 (25%), Positives = 45/99 (45%), Gaps = 5/99 (5%) Query: 41 QEQFSSS--VGDSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFLIE--GHADELGSRN 96 Q+Q +G +V F T S I P L + + L K + ++ G+AD G Sbjct: 124 QQQLLEELALGMNVQFRTGSSDIEPHFQPQLDEVAT-LMKQSPELKLDLSGYADRRGDSQ 182 Query: 97 SSIALGLRRAYAVFNYFVARGISASRMKVTSYGKEMPSV 135 + AL +R V +Y + +G+ +R+ ++G+ P Sbjct: 183 YNQALSEQRVLEVRSYLIKQGVDEARLTTQAFGESAPLK 221 >gnl|CDD|182172 PRK09967, PRK09967, putative outer membrane lipoprotein; Provisional. Length = 160 Score = 42.7 bits (100), Expect = 5e-05 Identities = 29/116 (25%), Positives = 50/116 (43%), Gaps = 10/116 (8%) Query: 44 FSSSVGDSVFFDTSSYSIRPADIQVLSNLGSWLE----KHDCDFLIEGHADELGSRNSSI 99 +S + D++ F + Y + P Q + + + L H ++GH D G + + Sbjct: 46 WSLGLSDAILFAKNDYKLLPESQQQIQTMAAKLASTGLTHA---RMDGHTDNYGEDSYNE 102 Query: 100 ALGLRRAYAVFNYFVARGISASRMKVTS--YGKEMPSVYGHDEDAYAKNRRAIVFL 153 L L+RA V + + A G R +T+ GK+ P A+NRR V + Sbjct: 103 GLSLKRANVVADAW-AMGGQIPRSNLTTQGLGKKYPIASNKTAQGRAENRRVAVVI 157 >gnl|CDD|181620 PRK09040, PRK09040, hypothetical protein; Provisional. Length = 214 Score = 42.3 bits (100), Expect = 6e-05 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 10/108 (9%) Query: 51 SVFFDTSSYSIRPADIQVLSNL----GSWLEKHDCDFLIEGHADELGSR--NSSIA---- 100 SV F +S ++P ++L +L ++L D ++ G D+ R N A Sbjct: 89 SVLFALNSDQLQPEGRELLKSLAGPLAAYLRARDEILMVSGFTDDQPVRAGNRRFADNWE 148 Query: 101 LGLRRAYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRR 148 L +RA V + G+ AS + ++G E P D++ AKNRR Sbjct: 149 LSAQRALTVTRALIDAGVPASSVFAAAFGSEQPVASNADDEGRAKNRR 196 >gnl|CDD|180754 PRK06925, PRK06925, flagellar motor protein MotS; Reviewed. Length = 230 Score = 40.1 bits (94), Expect = 3e-04 Identities = 33/123 (26%), Positives = 46/123 (37%), Gaps = 19/123 (15%) Query: 40 LQEQFSSSVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRN--- 96 LQE V F+T I L +G L D +EGH D SR Sbjct: 116 LQEA--------VLFETGEADILKQAEPFLHKIGVLLSTIPNDIKVEGHTD---SRPIST 164 Query: 97 ----SSIALGLRRAYAVFNYFVAR-GISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIV 151 S+ L RA +V YF ++ + +SR Y P V E+ +NRR + Sbjct: 165 YRYPSNWELSAARASSVIRYFTSKEKLDSSRFIAVGYADTKPVVPNTTEENMQENRRVEI 224 Query: 152 FLK 154 + Sbjct: 225 VIS 227 >gnl|CDD|181618 PRK09038, PRK09038, flagellar motor protein MotD; Reviewed. Length = 281 Score = 39.6 bits (93), Expect = 3e-04 Identities = 21/103 (20%), Positives = 37/103 (35%), Gaps = 4/103 (3%) Query: 50 DSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRNSSIA----LGLRR 105 S+ F + + +L + L+ +EG D + + L R Sbjct: 133 SSLLFGSGDAMLSDQAFAILEKVAEVLKPAPNPIHVEGFTDNVPIATAQFPSNWELSAAR 192 Query: 106 AYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRR 148 A +V G++ SR+ YG+ P + A+NRR Sbjct: 193 AASVVRLLADDGVAPSRLAAVGYGEFQPVADNDTAEGRARNRR 235 >gnl|CDD|132393 TIGR03350, type_VI_ompA, type VI secretion system OmpA/MotB family protein. The flagellar motor protein MotB and the Gram-negative bacterial outer membrane protein OmpA share a region of sequence homology. This model describes a domain found fused to type VI secretion system homologs of the type IV system protein DotU (see model TIGR03349), with OmpA/MotB homology. Length = 137 Score = 36.9 bits (86), Expect = 0.002 Identities = 24/104 (23%), Positives = 37/104 (35%), Gaps = 4/104 (3%) Query: 54 FDTSSYSIRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRNSSIA----LGLRRAYAV 109 F + S +R +L + L + GH D + R S L RA AV Sbjct: 34 FASGSAEVRADFEPLLDRIAKALAAVPGRITVVGHTDNVPIRTSRFPSNWHLSEARAKAV 93 Query: 110 FNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFL 153 + G+ A R++ G P A+NRR + + Sbjct: 94 ADVLAQGGVPAGRVRAEGRGDSEPIASNATAAGRAQNRRVEIDV 137 >gnl|CDD|181590 PRK08944, motB, flagellar motor protein MotB; Reviewed. Length = 302 Score = 35.4 bits (82), Expect = 0.007 Identities = 19/69 (27%), Positives = 29/69 (42%), Gaps = 5/69 (7%) Query: 85 IEGHADELGSRN----SSIALGLRRAYAVFNYFVA-RGISASRMKVTSYGKEMPSVYGHD 139 + GH D + + S+ L RA AV + + +G R+KV P V Sbjct: 214 VSGHTDNVPISSELYRSNWDLSSARAVAVAHELLKVKGFDPQRLKVVGMADTQPLVPNDT 273 Query: 140 EDAYAKNRR 148 + A+NRR Sbjct: 274 AENRARNRR 282 >gnl|CDD|180652 PRK06667, motB, flagellar motor protein MotB; Validated. Length = 252 Score = 34.0 bits (78), Expect = 0.018 Identities = 29/113 (25%), Positives = 45/113 (39%), Gaps = 11/113 (9%) Query: 46 SSVGDSVFFDTSSYSIRPADIQ-VLSNLGSWLEKHDCD---FLIEGHADEL-----GSRN 96 S D+ FF S ++ + + L + S++ D F IEGH D + G Sbjct: 122 SLASDA-FFYPGSAEVKLEENRETLQKIASFIGFLDLAGRNFRIEGHTDNVDVNPEGPWK 180 Query: 97 SSIALGLRRAYAVFNYFVARG-ISASRMKVTSYGKEMPSVYGHDEDAYAKNRR 148 S+ L RA + Y + G S S +V+ + P + A NRR Sbjct: 181 SNWELSGARAVNMLEYILNYGDQSESWFQVSGFAGSRPLATEDTPEGRAYNRR 233 >gnl|CDD|181095 PRK07734, motB, flagellar motor protein MotB; Reviewed. Length = 259 Score = 33.2 bits (76), Expect = 0.032 Identities = 30/147 (20%), Positives = 50/147 (34%), Gaps = 35/147 (23%) Query: 32 DTVLNESSLQEQFSSS---------VGDSVFFDTSSYSIRPADIQVLSNLGSWLEKHDC- 81 D + E L + + D++ FD+ +R D+ + + + L + Sbjct: 115 DQYIKEKQLSSSLQTKLTEEGLLITILDNILFDSGKADVRLEDLPLAKEISNLLVSNPPR 174 Query: 82 DFLIEGHADELGSRNSSIA----LGLRRAYAVFN-----------YFVARGISASRMKVT 126 + I GH D + N+ A L + RA F A+G Sbjct: 175 NITISGHTDNVPIANAQFASNWELSVMRAVNFMQVLLENKELDPEKFSAKG--------- 225 Query: 127 SYGKEMPSVYGHDEDAYAKNRRAIVFL 153 YG+ P + AKNRR V + Sbjct: 226 -YGEYKPIASNDTAEGRAKNRRVEVLI 251 >gnl|CDD|180801 PRK07033, PRK07033, hypothetical protein; Provisional. Length = 427 Score = 29.2 bits (66), Expect = 0.50 Identities = 28/104 (26%), Positives = 44/104 (42%), Gaps = 5/104 (4%) Query: 49 GDSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRN----SSIALGLR 104 GD +F ++S S+R VL+ + L + + L+ G++D + R S+ L Sbjct: 314 GDGLF-ASASTSVRDRYQPVLARVADALNQVKGNVLVTGYSDNVPIRTARFPSNWELSQA 372 Query: 105 RAYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRR 148 RA AV AR R+ G P + A+NRR Sbjct: 373 RAQAVRALLAARLGQPERVTAEGRGDSDPVAPNDSAENRARNRR 416 >gnl|CDD|151822 pfam11382, DUF3186, Protein of unknown function (DUF3186). This bacterial family of proteins has no known function. Length = 307 Score = 28.5 bits (64), Expect = 0.91 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Query: 18 ISGIDNLDTKISSPDTVLNESSLQEQFSSSVGD 50 +S +DN+DT TVL +L EQ + G Sbjct: 265 VSTVDNVDTVPGQVTTVL---ALVEQLNGGAGH 294 >gnl|CDD|184472 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisional. Length = 593 Score = 27.6 bits (62), Expect = 1.5 Identities = 8/12 (66%), Positives = 10/12 (83%) Query: 19 SGIDNLDTKISS 30 +GID +DT ISS Sbjct: 222 AGIDGVDTAISS 233 >gnl|CDD|179846 PRK04423, PRK04423, organic solvent tolerance protein; Provisional. Length = 798 Score = 26.8 bits (59), Expect = 3.0 Identities = 12/51 (23%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 35 LNESSLQEQFSSSVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFLI 85 L + +E+ S S G ++FD S +I ++ + +W+ D +++I Sbjct: 579 LRQDDGKEKLSLSAGQILYFDDSLVTINNSEQTIEQGKSAWVA--DANYMI 627 >gnl|CDD|181240 PRK08126, PRK08126, hypothetical protein; Provisional. Length = 432 Score = 26.6 bits (59), Expect = 3.2 Identities = 27/111 (24%), Positives = 48/111 (43%), Gaps = 8/111 (7%) Query: 45 SSSV---GDSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRN----S 97 SSV GD++F + ++ PA +++ + + + + GH D R+ S Sbjct: 316 HSSVVFRGDAMFVPGQA-TVNPAMGPLIAKIAREIARVGGKVTVTGHTDNQPIRSAQFAS 374 Query: 98 SIALGLRRAYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRR 148 ++ L +RA V + G+ ASR++ G P A+NRR Sbjct: 375 NLVLSEKRAAQVAQMLQSAGVPASRLEAVGKGDAQPVADNRTPQGRAQNRR 425 >gnl|CDD|173127 PRK14664, PRK14664, tRNA-specific 2-thiouridylase MnmA; Provisional. Length = 362 Score = 26.5 bits (58), Expect = 3.4 Identities = 10/28 (35%), Positives = 13/28 (46%) Query: 72 LGSWLEKHDCDFLIEGHADELGSRNSSI 99 L W +K C ++ GH L RN I Sbjct: 100 LIEWADKLGCAWIATGHYSRLEERNGHI 127 >gnl|CDD|162335 TIGR01392, homoserO_Ac_trn, homoserine O-acetyltransferase. This family describes homoserine-O-acetyltransferase, an enzyme of methionine biosynthesis. This model has been rebuilt to identify sequences more broadly, including a number of sequences suggested to be homoserine O-acetyltransferase based on proximity to other Met biosynthesis genes. Length = 351 Score = 25.0 bits (55), Expect = 8.5 Identities = 10/28 (35%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Query: 112 YFVARGISASRMKVTSYGKEMPSVYGHD 139 +A+ + A+ ++VT E+ S YGHD Sbjct: 308 RELAKALPAAGLRVTYV--EIESPYGHD 333 >gnl|CDD|132642 TIGR03603, cyclo_dehy_ocin, bacteriocin biosynthesis cyclodehydratase, SagC family. Members of this protein family include enzymes related to SagC, a cyclodehydratase involved in the biosynthesis of streptolysin S in Streptococcus pyogenes from the protoxin polypeptide (product of the sagA gene). This protein family serves as a marker for widely distributed prokaryotic systems for making a general class of heterocycle-containing bacteriocins. Note that this model does not find all possible examples of bacteriocin biosynthesis cyclodehydratases, an in particular misses the E. coli plasmid protein McbB of microcin B17 biosynthesis. Length = 318 Score = 24.9 bits (54), Expect = 9.9 Identities = 7/32 (21%), Positives = 15/32 (46%) Query: 3 YSTIFIILSAITMMSISGIDNLDTKISSPDTV 34 Y+ I I + + G++ L + P+T+ Sbjct: 152 YNYIIICTEHSNISLLRGLNKLSKETKKPNTI 183 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.318 0.132 0.372 Gapped Lambda K H 0.267 0.0643 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,488,727 Number of extensions: 144404 Number of successful extensions: 293 Number of sequences better than 10.0: 1 Number of HSP's gapped: 285 Number of HSP's successfully gapped: 27 Length of query: 160 Length of database: 5,994,473 Length adjustment: 86 Effective length of query: 74 Effective length of database: 4,136,185 Effective search space: 306077690 Effective search space used: 306077690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (24.4 bits)