RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780547|ref|YP_003064960.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62] (160 letters) >d1r1ma_ d.79.7.1 (A:) Outer membrane protein class 4, RmpM, C-terminal domain {Neisseria meningitidis [TaxId: 487]} Length = 140 Score = 72.2 bits (176), Expect = 2e-14 Identities = 31/113 (27%), Positives = 43/113 (38%), Gaps = 1/113 (0%) Query: 47 SVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKH-DCDFLIEGHADELGSRNSSIALGLRR 105 S+ F S+R L L L + +EGH D +GS + AL RR Sbjct: 9 SLSAKTLFGFDKDSLRAEAQDNLKVLAQRLSRTNIQSVRVEGHTDFMGSDKYNQALSERR 68 Query: 106 AYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFLKGCRA 158 AY V N V+ G+ SR+ G+ + E AK + K A Sbjct: 69 AYVVANNLVSNGVPVSRISAVGLGESQAQMTQVCEAEVAKLGAKVSKAKKREA 121 >d2hqsc1 d.79.7.1 (C:68-173) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Escherichia coli [TaxId: 562]} Length = 106 Score = 67.8 bits (165), Expect = 4e-13 Identities = 47/105 (44%), Positives = 66/105 (62%), Gaps = 2/105 (1%) Query: 50 DSVFFDTSSYSIRPADIQVLSNLGSWLEKH-DCDFLIEGHADELGSRNSSIALGLRRAYA 108 + V+FD Y IR Q+L ++L + +EGHADE G+ +I+LG RRA A Sbjct: 2 NIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANA 61 Query: 109 VFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRA-IVF 152 V Y +G+SA ++ + SYGKE P+V GHDE AY+KNRRA +V+ Sbjct: 62 VKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY 106 >d2aizp1 d.79.7.1 (P:1-134) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Haemophilus influenzae [TaxId: 727]} Length = 134 Score = 63.7 bits (154), Expect = 8e-12 Identities = 44/120 (36%), Positives = 69/120 (57%), Gaps = 7/120 (5%) Query: 35 LNESSLQEQFSSSVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKH-DCDFLIEGHADELG 93 + + LQ+++ ++V+F Y I +Q+L ++L L+EG+ DE G Sbjct: 20 YSVADLQQRY-----NTVYFGFDKYDITGEYVQILDAHAAYLNATPAAKVLVEGNTDERG 74 Query: 94 SRNSSIALGLRRAYAVFNYFVARGISASRMKVTSYGKEMPSVYGHDEDAYAKNRRA-IVF 152 + +IALG RRA AV Y +G+ A ++ SYG+E P+V GHDE AY+KNRRA + + Sbjct: 75 TPEYNIALGQRRADAVKGYLAGKGVDAGKLGTVSYGEEKPAVLGHDEAAYSKNRRAVLAY 134 >g1wht.1 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat (Triticum vulgare) [TaxId: 4565]} Length = 409 Score = 26.3 bits (57), Expect = 1.3 Identities = 8/40 (20%), Positives = 17/40 (42%) Query: 45 SSSVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFL 84 SSV + ++ ++P ++ N W + + FL Sbjct: 61 CSSVAYGASEELGAFRVKPRGAGLVLNEYRWNKVANVLFL 100 >d2p6ra2 a.289.1.2 (A:489-686) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 198 Score = 25.2 bits (55), Expect = 2.9 Identities = 8/43 (18%), Positives = 14/43 (32%), Gaps = 3/43 (6%) Query: 56 TSSYSIRPADIQVLSNLGSWLE---KHDCDFLIEGHADELGSR 95 + Y I P D++ + WL + + L R Sbjct: 92 CAKYGIAPGDLRRIVETAEWLSNAMNRIAEEVGNTSVSGLTER 134 >d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 217 Score = 25.3 bits (55), Expect = 2.9 Identities = 5/69 (7%), Positives = 20/69 (28%), Gaps = 6/69 (8%) Query: 22 DNLDTKISSPDTVLNESSLQEQFSSSVGDSVFF-----DTSSYSIRPADIQVLS-NLGSW 75 + V++ S + + + F + + +I+ + + Sbjct: 143 ELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKV 202 Query: 76 LEKHDCDFL 84 + ++L Sbjct: 203 EPREAQEYL 211 >g1gxs.1 c.69.1.5 (A:,B:) Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [TaxId: 4558]} Length = 425 Score = 25.2 bits (54), Expect = 3.1 Identities = 7/40 (17%), Positives = 16/40 (40%) Query: 45 SSSVGDSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFL 84 SS+G + ++ + +L N +W + + F Sbjct: 63 CSSIGLGAMQELGAFRVHTNGESLLLNEYAWNKAANILFA 102 >d1r3na1 c.56.5.4 (A:18-247,A:364-455) Peptidase-like beta-alanine synthase, catalytic domain {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Length = 322 Score = 23.5 bits (50), Expect = 9.8 Identities = 14/81 (17%), Positives = 31/81 (38%), Gaps = 5/81 (6%) Query: 64 ADIQVLSNLGSWLEKHDCDFLIEGHADE---LGSRNSSIALGLRRAYAVFNYFVARGISA 120 +I + + + ++++ D E H ++ L N +I + F+ +S Sbjct: 185 KNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAVNFHEVCIECVSR 244 Query: 121 SRMKVTSYG--KEMPSVYGHD 139 S +++ S GHD Sbjct: 245 SAFAQFKKDQVRQIWSGAGHD 265 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.318 0.132 0.372 Gapped Lambda K H 0.267 0.0504 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 546,299 Number of extensions: 22349 Number of successful extensions: 42 Number of sequences better than 10.0: 1 Number of HSP's gapped: 39 Number of HSP's successfully gapped: 8 Length of query: 160 Length of database: 2,407,596 Length adjustment: 78 Effective length of query: 82 Effective length of database: 1,336,656 Effective search space: 109605792 Effective search space used: 109605792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.2 bits)