BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780549|ref|YP_003064962.1| signal peptide protein [Candidatus Liberibacter asiaticus str. psy62] (271 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780549|ref|YP_003064962.1| signal peptide protein [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Score = 553 bits (1424), Expect = e-159, Method: Compositional matrix adjust. Identities = 271/271 (100%), Positives = 271/271 (100%) Query: 1 MRLENGLAISMILHVMFLLLLYFNFNVQLLVPISRREMLSVDNIYNEDYHSSKYKKIEEP 60 MRLENGLAISMILHVMFLLLLYFNFNVQLLVPISRREMLSVDNIYNEDYHSSKYKKIEEP Sbjct: 1 MRLENGLAISMILHVMFLLLLYFNFNVQLLVPISRREMLSVDNIYNEDYHSSKYKKIEEP 60 Query: 61 VVQFKGSSQENLVRDFSVQENGDRFSDQTKTHATENETKRSSSSKGEQALKESALLRMPV 120 VVQFKGSSQENLVRDFSVQENGDRFSDQTKTHATENETKRSSSSKGEQALKESALLRMPV Sbjct: 61 VVQFKGSSQENLVRDFSVQENGDRFSDQTKTHATENETKRSSSSKGEQALKESALLRMPV 120 Query: 121 SPYDKQKISKATNKEQDLQGISFAEKKSIDTVVVRPDKKELLSKVEKSSRKRIPSQDAIA 180 SPYDKQKISKATNKEQDLQGISFAEKKSIDTVVVRPDKKELLSKVEKSSRKRIPSQDAIA Sbjct: 121 SPYDKQKISKATNKEQDLQGISFAEKKSIDTVVVRPDKKELLSKVEKSSRKRIPSQDAIA 180 Query: 181 IVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLRENAR 240 IVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLRENAR Sbjct: 181 IVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLRENAR 240 Query: 241 KAVIKSQAFRLSPSTYKSWRNITLFFVPSKM 271 KAVIKSQAFRLSPSTYKSWRNITLFFVPSKM Sbjct: 241 KAVIKSQAFRLSPSTYKSWRNITLFFVPSKM 271 >gi|254780957|ref|YP_003065370.1| dihydrofolate reductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 176 Score = 33.1 bits (74), Expect = 0.004, Method: Compositional matrix adjust. Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 11/75 (14%) Query: 180 AIVRNRVIAN-----WNIPSDFKRFKKLRVKMHFQLNQKGF-VLGKINVDVVGGTELVRR 233 AI RN VI + W I SD KRFK L + + F +G++ + G T ++ Sbjct: 11 AITRNNVIGSCGGMPWKISSDLKRFKSLTTGNPVVMGYRTFQSIGRL---LPGRTNII-- 65 Query: 234 MLRENARKAVIKSQA 248 + R+N R+A + +A Sbjct: 66 ITRDNTRRASVNPEA 80 >gi|254780635|ref|YP_003065048.1| hypothetical protein CLIBASIA_02610 [Candidatus Liberibacter asiaticus str. psy62] Length = 412 Score = 26.2 bits (56), Expect = 0.68, Method: Compositional matrix adjust. Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Query: 148 SIDTVVVRPDKKELLSKVEKSSRKRIPSQDA-IAIVRNRVIANWN 191 +I+T+V P+KK L + + R RIP Q + + N+++ W+ Sbjct: 54 AIETLVTTPNKKNLENARLQWIRARIPYQQSEVYRFGNKIVDTWD 98 >gi|254780727|ref|YP_003065140.1| putative pilus assembly protein [Candidatus Liberibacter asiaticus str. psy62] Length = 474 Score = 25.8 bits (55), Expect = 0.84, Method: Compositional matrix adjust. Identities = 13/24 (54%), Positives = 15/24 (62%) Query: 75 DFSVQENGDRFSDQTKTHATENET 98 DFSV+ DRFS +T HA E T Sbjct: 244 DFSVKGVLDRFSFETVLHALERAT 267 >gi|254780989|ref|YP_003065402.1| GCN5-related N-acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Score = 22.7 bits (47), Expect = 7.1, Method: Compositional matrix adjust. Identities = 9/27 (33%), Positives = 17/27 (62%) Query: 128 ISKATNKEQDLQGISFAEKKSIDTVVV 154 + K N +L+G++FA ++ +D V V Sbjct: 1 MPKQPNVNIELEGLTFANEQRVDQVAV 27 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.131 0.359 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 161,328 Number of Sequences: 1233 Number of extensions: 6305 Number of successful extensions: 15 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 9 length of query: 271 length of database: 328,796 effective HSP length: 73 effective length of query: 198 effective length of database: 238,787 effective search space: 47279826 effective search space used: 47279826 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 37 (18.9 bits)