RPSBLAST alignment for GI: 254780552 and conserved domain: PRK12402

>gnl|CDD|183503 PRK12402, PRK12402, replication factor C small subunit 2; Reviewed. Length = 337
 Score = 43.8 bits (104), Expect = 6e-05
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 23 RPRTLEEFTGQVEACSNLKVFIEAAKARAEALDHVLFVGPPGLGKTTLAQVVAREL 78
          RP  LE+  GQ E    L   +++       L H+L  GPPG GKT   + +AREL
Sbjct: 10 RPALLEDILGQDEVVERLSRAVDSPN-----LPHLLVQGPPGSGKTAAVRALAREL 60