>TIGR00228 ruvC crossover junction endodeoxyribonuclease RuvC; InterPro: IPR002176 The Escherichia coli ruvC gene is involved in DNA repair and in the late step of RecE and RecF pathway recombination . RuvC protein (3.1.22.4 from EC) cleaves cruciform junctions, which are formed by the extrusion of inverted repeat sequences from a super-coiled plasmid and which are structurally analogous to Holliday junctions, by introducing nicks into strands with the same polarity. The nicks leave a 5'terminal phosphate and a 3'terminal hydroxyl group which are ligated by E. coli or Bacteriophage T4 DNA ligases. Analysis of the cleavage sites suggests that DNA topology rather than a particular sequence determines the cleavage site. RuvC protein also cleaves Holliday junctions that are formed between gapped circular and linear duplex DNA by the function of RecA protein. The active form of RuvC protein is a dimer. This is mechanistically suited for an endonuclease involved in swapping DNA strands at the crossover junctions. It is inferred that RuvC protein is an endonuclease that resolves Holliday structures in vivo . RucC is a small protein of about 20 kD. It requires and binds a magnesium ion. The structure of E. coli ruvC is a 3-layer alpha-beta sandwich containing a 5-stranded beta-sheet sandwiched between 5 alpha-helices .; GO: 0004520 endodeoxyribonuclease activity, 0006281 DNA repair, 0006310 DNA recombination.

Probab=100.00 E-value=0 Score=323.15 Aligned_cols=154 Identities=45% Similarity=0.725 Sum_probs=146.6 Q ss_pred EEEECCCCCEEEEEEEEEECCEEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEHHHHCCCHHHHHHHH Q ss_conf 99997888720589999719968999833687388999888999999989998622796277885033202412478899 Q gi|254780554|r 7 IIGIDPGLRRTGWGIVDVAGDNLCFVSSGTIVSCVRQSLAFRLCQLYEGLTDVIKNWRPEEAAVEQVFVNKDAVATLKLG 86 (169) Q Consensus 7 ILGIDPGl~~tG~avie~~~~~~~li~~g~I~t~~~~~~~~Rl~~I~~~l~~ii~~~~Pd~vaiE~~F~~~n~~t~~~lg 86 (169) T Consensus 1 ILGIDPGSR~~GY~vI~~~~~~L~~l~~G~I~~~~-~~L~~~l~~~~~~~~~~~~~f~~n~~AIE~vF~a~N~~S~lKL~ 79 (158) T TIGR00228 1 ILGIDPGSRVTGYGVIRQAGKKLSYLGSGFIRIKV-TDLPERLKDIYAGVTEIITQFQPNEFAIEQVFMAKNADSALKLG 79 (158) T ss_pred CCCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEH-HHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHCCCHHHHHHHH T ss_conf 97768987511258988753443334245003303-46889999999999999843066600121243202725788876 Q ss_pred HHHHHHHHHHHHCCCCEE-EECHHHHHHHHCCCCCCCHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHHHCCCH Q ss_conf 999999999986016177-526067776531688889999999999962889-999955678999999976416875 Q gi|254780554|r 87 QARAIAILSPALARIPVS-EYAPNTIKKAVIGVGHGDKKQIHMMLKMLMPES-FFKGKDAADALAIAVCHAYHANSG 161 (169) Q Consensus 87 ~arGvi~l~~~~~~i~v~-ey~P~~vKkavtG~G~A~KeqV~~mV~~ll~~~-~~~~~D~aDAlAiAl~h~~~~~~~ 161 (169) T Consensus 80 Q~RG~A~~~~v~~~l~~FsEY~~~~VK~~~~G~G~A~K~QV~~MV~~lL~l~~~~~P~D~~DAlA~AITHa~~~~~~ 156 (158) T TIGR00228 80 QARGVAIVAAVNERLPVFSEYAARQVKKTVVGIGSAAKEQVQFMVKRLLKLTSEPKPADAADALAIAITHAHRLKNA 156 (158) T ss_pred HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHH T ss_conf 44469999999862687310557766565305773003889999999860556788455777999999999999863

HHsearch alignment for GI: 254780554 and conserved domain: TIGR00228